F359753

General Info

Members Datasets Scaffolds Average Seq Length
248 156 248 207

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100032811|Ga0068860_1000328112
Length 219
Sequence MIPDFIHEFVPGASNRTLLLLHGTGGNERDLIPLGRELDPNAALLSPRGKVLENGMPRFFRRLAEGVFDLEDLKYRANELADFVTAAAKHYGFALDNLVGVGYSNGANIAASMLLLRPEIMNAAILFRAMVPLIPAKLPDLSSAHVWIGEGDQDPIIATSEGQRLVDLLRDAGADVTVRFFHAGHGLTNSDLEAAGQWLEALNNPTRKGEAHQREAGLP

Samples

Sample ID Description Type Environment
1 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.05
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1001588 3300002126 Bacteria 2148
2 Ga0065714_10165100 3300005288 Bacteria 1006
3 Ga0065704_10168164 3300005289 Bacteria 1308
4 Ga0065704_10176607 3300005289 Bacteria 1260
5 Ga0065712_10009253 3300005290 Bacteria 3491
6 Ga0065712_10016720 3300005290 Bacteria 2093
7 Ga0065712_10112090 3300005290 Bacteria 1806
8 Ga0065715_10014472 3300005293 Bacteria 1869
9 Ga0065715_10223809 3300005293 Bacteria 1209
10 Ga0070658_10515865 3300005327 Bacteria 1033
11 Ga0070683_100046502 3300005329 Bacteria 4010
12 Ga0070683_100098523 3300005329 Bacteria 2751
13 Ga0070683_100192289 3300005329 Bacteria 1938
14 Ga0070666_10054373 3300005335 Bacteria 2701
15 Ga0068868_100116814 3300005338 Bacteria 2173
16 Ga0070660_100192597 3300005339 Bacteria 1652
17 Ga0070689_100028658 3300005340 Bacteria 4211
18 Ga0070689_100071874 3300005340 Bacteria 2703
19 Ga0070689_100378416 3300005340 Bacteria 1193
20 Ga0070691_10067336 3300005341 Bacteria 1732
21 Ga0070687_100210015 3300005343 Bacteria 1185
22 Ga0070661_100095175 3300005344 Bacteria 2209
23 Ga0070668_100468820 3300005347 Bacteria 1086
24 Ga0070669_100475740 3300005353 Unclassified 1033
25 Ga0070675_100113422 3300005354 Bacteria 2296
26 Ga0070675_100380121 3300005354 Bacteria 1257
27 Ga0070671_100265416 3300005355 Bacteria 1459
28 Ga0070673_100009311 3300005364 Bacteria 6590
29 Ga0070688_100026161 3300005365 Bacteria 3464
30 Ga0070688_100102711 3300005365 Bacteria 1887
31 Ga0070667_100346217 3300005367 Bacteria 1345
32 Ga0070713_100035280 3300005436 Bacteria 4026
33 Ga0070713_100610013 3300005436 Bacteria 1037
34 Ga0070710_10092316 3300005437 Bacteria 1788
35 Ga0070711_100662871 3300005439 Unclassified 876
36 Ga0070705_100934304 3300005440 Bacteria 700
37 Ga0070700_100242118 3300005441 Bacteria 1289
38 Ga0070708_100053464 3300005445 Bacteria 3583
39 Ga0070708_100134149 3300005445 Unclassified 2292
40 Ga0070708_100248727 3300005445 Bacteria 1670
41 Ga0070708_100359261 3300005445 Unclassified 1373
42 Ga0070663_100226044 3300005455 Bacteria 1471
43 Ga0070663_100370607 3300005455 Bacteria 1164
44 Ga0070662_100091691 3300005457 Bacteria 2282
45 Ga0070662_100596006 3300005457 Bacteria 929
46 Ga0070681_10022992 3300005458 Bacteria 6266
47 Ga0070681_10334056 3300005458 Bacteria 1425
48 Ga0070706_100040614 3300005467 Bacteria 4295
49 Ga0070706_100132114 3300005467 Bacteria 2330
50 Ga0070706_100221673 3300005467 Bacteria 1765
51 Ga0070706_100270087 3300005467 Bacteria 1587
52 Ga0070707_100018094 3300005468 Bacteria 6629
53 Ga0070707_100070725 3300005468 Bacteria 3361
54 Ga0070707_100133381 3300005468 Bacteria 2415
55 Ga0070707_100223729 3300005468 Bacteria 1832
56 Ga0070707_100248595 3300005468 Bacteria 1731
57 Ga0070707_100641208 3300005468 Bacteria 1025
58 Ga0070698_100602432 3300005471 Bacteria 1039
59 Ga0070698_100743073 3300005471 Unclassified 924
60 Ga0070699_100516838 3300005518 Bacteria 1085
61 Ga0070679_100421169 3300005530 Bacteria 1281
62 Ga0070684_100020836 3300005535 Bacteria 5441
63 Ga0070684_100417189 3300005535 Unclassified 1239
64 Ga0070697_100059734 3300005536 Bacteria 3105
65 Ga0070697_100093333 3300005536 Bacteria 2492
66 Ga0070697_100125510 3300005536 Bacteria 2150
67 Ga0070686_100086552 3300005544 Bacteria 2087
68 Ga0070686_100104801 3300005544 Bacteria 1916
69 Ga0070665_100056148 3300005548 Bacteria 3949
70 Ga0070665_100088770 3300005548 Bacteria 3097
71 Ga0070665_100405833 3300005548 Bacteria 1371
72 Ga0070664_100194508 3300005564 Bacteria 1808
73 Ga0070664_100290082 3300005564 Bacteria 1477
74 Ga0068856_100042624 3300005614 Bacteria 4464
75 Ga0068858_100019895 3300005842 Bacteria 6275
76 Ga0068858_100543828 3300005842 Bacteria 1124
77 Ga0068860_100032811 3300005843 Bacteria 4987
78 Ga0081455_10051824 3300005937 Bacteria 3518
79 Ga0081540_1039251 3300005983 Bacteria 2483
80 Ga0081540_1064581 3300005983 Bacteria 1726
81 Ga0081540_1071827 3300005983 Bacteria 1597
82 Ga0081539_10011187 3300005985 Bacteria 7144
83 Ga0070717_10033845 3300006028 Bacteria 4125
84 Ga0070717_10044135 3300006028 Bacteria 3640
85 Ga0070717_10085773 3300006028 Bacteria 2651
86 Ga0070717_10120465 3300006028 Bacteria 2247
87 Ga0070715_10095519 3300006163 Bacteria 1376
88 Ga0070715_10413470 3300006163 Unclassified 753
89 Ga0070716_100156765 3300006173 Bacteria 1471
90 Ga0070712_100009507 3300006175 Bacteria 6129
91 Ga0070712_100024824 3300006175 Bacteria 3977
92 Ga0070712_100112728 3300006175 Unclassified 2032
93 Ga0070712_100297223 3300006175 Bacteria 1306
94 Ga0070712_100451298 3300006175 Bacteria 1071
95 Ga0075434_100378784 3300006871 Bacteria 1436
96 Ga0068865_100231488 3300006881 Bacteria 1450
97 Ga0075435_100813359 3300007076 Bacteria 814
98 Ga0111539_10606019 3300009094 Bacteria 1275
99 Ga0105245_10188840 3300009098 Bacteria 1973
100 Ga0105245_10360058 3300009098 Bacteria 1444
101 Ga0114129_11430393 3300009147 Unclassified 852
102 Ga0105243_10846355 3300009148 Unclassified 905
103 Ga0105241_10121610 3300009174 Bacteria 2103
104 Ga0105241_10794099 3300009174 Unclassified 871
105 Ga0105242_10388002 3300009176 Unclassified 1300
106 Ga0105237_10408514 3300009545 Bacteria 1363
107 Ga0099796_10076504 3300010159 Bacteria 1219
108 Ga0105239_10198047 3300010375 Bacteria 2250
109 Ga0105239_10231553 3300010375 Bacteria 2073
110 Ga0105239_10760578 3300010375 Bacteria 1109
111 Ga0157371_10092457 3300013102 Bacteria 2143
112 Ga0157371_10538313 3300013102 Unclassified 865
113 Ga0157369_10050547 3300013105 Bacteria 4502
114 Ga0157374_10033991 3300013296 Bacteria 4655
115 Ga0157374_10161158 3300013296 Bacteria 2185
116 Ga0157374_11318037 3300013296 Unclassified 744
117 Ga0157378_10824079 3300013297 Bacteria 955
118 Ga0163162_10058184 3300013306 Bacteria 3894
119 Ga0163162_10228538 3300013306 Bacteria 1991
120 Ga0157372_10049286 3300013307 Bacteria 4683
121 Ga0157375_10016687 3300013308 Bacteria 6605
122 Ga0157375_10523581 3300013308 Bacteria 1349
123 Ga0157375_10733265 3300013308 Bacteria 1140
124 Ga0182008_10271034 3300014497 Unclassified 881
125 Ga0157379_10229129 3300014968 Bacteria 1684
126 Ga0157376_10023588 3300014969 Bacteria 4817
127 Ga0157376_10123603 3300014969 Bacteria 2298
128 Ga0157376_10139328 3300014969 Bacteria 2174
129 Ga0207666_1002300 3300025271 Bacteria 2293
130 Ga0207673_1023760 3300025290 Bacteria 835
131 Ga0207697_10005185 3300025315 Bacteria 6082
132 Ga0207697_10006387 3300025315 Bacteria 5337
133 Ga0207697_10031994 3300025315 Bacteria 2152
134 Ga0207697_10046168 3300025315 Bacteria 1794
135 Ga0207697_10150753 3300025315 Bacteria 1011
136 Ga0207692_10097214 3300025898 Unclassified 1609
137 Ga0207688_10142760 3300025901 Bacteria 1410
138 Ga0207680_10175965 3300025903 Unclassified 1444
139 Ga0207647_10033083 3300025904 Bacteria 3315
140 Ga0207684_10006284 3300025910 Bacteria 10837
141 Ga0207684_10020514 3300025910 Bacteria 5648
142 Ga0207684_10527172 3300025910 Unclassified 1011
143 Ga0207654_10032046 3300025911 Bacteria 2900
144 Ga0207707_10035267 3300025912 Bacteria 4375
145 Ga0207693_10023424 3300025915 Bacteria 4903
146 Ga0207693_10035606 3300025915 Bacteria 3924
147 Ga0207693_10042841 3300025915 Bacteria 3563
148 Ga0207693_10151920 3300025915 Bacteria 1821
149 Ga0207693_10261954 3300025915 Bacteria 1356
150 Ga0207662_10130108 3300025918 Bacteria 1586
151 Ga0207657_10170599 3300025919 Bacteria 1763
152 Ga0207649_10014995 3300025920 Bacteria 4351
153 Ga0207649_10399825 3300025920 Bacteria 1028
154 Ga0207652_10386732 3300025921 Bacteria 1262
155 Ga0207652_10465616 3300025921 Bacteria 1139
156 Ga0207646_10025334 3300025922 Bacteria 5427
157 Ga0207646_10065350 3300025922 Bacteria 3248
158 Ga0207646_10071236 3300025922 Bacteria 3105
159 Ga0207646_10165448 3300025922 Unclassified 1996
160 Ga0207646_10524925 3300025922 Bacteria 1066
161 Ga0207681_10212169 3300025923 Bacteria 1493
162 Ga0207659_10140708 3300025926 Bacteria 1873
163 Ga0207659_10318253 3300025926 Bacteria 1283
164 Ga0207687_10078717 3300025927 Bacteria 2374
165 Ga0207700_10069507 3300025928 Bacteria 2703
166 Ga0207700_10189976 3300025928 Bacteria 1725
167 Ga0207700_10263525 3300025928 Bacteria 1477
168 Ga0207664_10054692 3300025929 Bacteria 3164
169 Ga0207664_10482418 3300025929 Bacteria 1109
170 Ga0207690_10510529 3300025932 Bacteria 973
171 Ga0207706_10131625 3300025933 Bacteria 2200
172 Ga0207706_10422758 3300025933 Bacteria 1154
173 Ga0207686_10110223 3300025934 Bacteria 1855
174 Ga0207670_10259331 3300025936 Bacteria 1347
175 Ga0207665_10114646 3300025939 Bacteria 1897
176 Ga0207691_10060688 3300025940 Bacteria 3436
177 Ga0207711_10876257 3300025941 Bacteria 835
178 Ga0207679_10103938 3300025945 Bacteria 2227
179 Ga0207679_10569981 3300025945 Bacteria 1017
180 Ga0207712_10076777 3300025961 Bacteria 2419
181 Ga0207658_10500857 3300025986 Bacteria 1082
182 Ga0207678_10162485 3300026067 Bacteria 1907
183 Ga0207702_10933461 3300026078 Bacteria 860
184 Ga0207641_10019892 3300026088 Bacteria 5510
185 Ga0207641_10403012 3300026088 Bacteria 1314
186 Ga0207683_10058220 3300026121 Bacteria 3393
187 Ga0268266_10153811 3300028379 Bacteria 2076
188 Ga0268266_10366443 3300028379 Bacteria 1356
189 Ga0268264_10019057 3300028381 Bacteria 5610
190 Ga0373934_0188778 3300035086 Bacteria 848
191 Ga0373953_0137607 3300035117 Bacteria 1044
192 Ga0373953_0191360 3300035117 Unclassified 884
193 Ga0373943_0051396 3300035170 Bacteria 2029
194 Ga0373931_0151052 3300035691 Unclassified 1354
195 Ga0373935_0005347 3300035692 Bacteria 7562
196 Ga0373925_0073135 3300037068 Unclassified 2594
197 Ga0395899_0068440 3300037312 Bacteria 2603
198 Ga0395900_0002931 3300037418 Bacteria 18585
199 Ga0395900_0463126 3300037418 Bacteria 1222
200 Ga0395898_0010885 3300037466 Bacteria 9495
201 Ga0395898_0229883 3300037466 Bacteria 1769
202 Ga0395898_0880064 3300037466 Unclassified 834
203 Ga0395905_0454024 3300037471 Bacteria 1180
204 Ga0395901_0069465 3300038443 Bacteria 3668
205 Ga0395901_0189821 3300038443 Bacteria 2155
206 Ga0439455_0027456 3300042012 Bacteria 1395
207 Ga0439458_0075429 3300042157 Bacteria 856
208 Ga0466967_0363784 3300045976 Bacteria 1402
209 Ga0495592_0004150 3300046454 Bacteria 10560
210 Ga0495608_0179764 3300046511 Unclassified 1339
211 Ga0495628_0057347 3300046516 Bacteria 3063
212 Ga0495630_0148001 3300046517 Bacteria 1786
213 Ga0495666_0168165 3300046526 Bacteria 1015
214 Ga0495652_0039740 3300046529 Bacteria 4067
215 Ga0495586_0012119 3300046535 Bacteria 4578
216 Ga0495587_0044969 3300046536 Bacteria 2625
217 Ga0495645_0011137 3300046543 Bacteria 6324
218 Ga0495667_0262274 3300046559 Bacteria 1099
219 Ga0495634_0031169 3300046642 Bacteria 3674
220 Ga0495599_0034595 3300046678 Bacteria 3173
221 Ga0495623_0127989 3300046679 Bacteria 1523
222 Ga0495646_0040473 3300046680 Bacteria 2870
223 Ga0495658_0514967 3300046683 Bacteria 766
224 Ga0495669_0026849 3300046684 Bacteria 2517
225 Ga0495581_0098341 3300047315 Bacteria 1700
226 Ga0495604_0033241 3300047317 Bacteria 4084
227 Ga0495674_0111284 3300047319 Bacteria 2321
228 Ga0495674_0918043 3300047319 Bacteria 675
229 Ga0495675_0089661 3300047444 Unclassified 1930
230 Ga0495684_0011575 3300047471 Bacteria 6811
231 Ga0495602_0039828 3300048088 Bacteria 4320
232 Ga0496101_0025846 3300048904 Bacteria 4077
233 Ga0496104_0368642 3300048907 Bacteria 1349
234 Ga0496104_0553255 3300048907 Bacteria 1061
235 Ga0496105_0343680 3300048908 Bacteria 1193
236 Ga0496106_0745862 3300048909 Unclassified 779
237 Ga0496107_0109764 3300048910 Bacteria 2027
238 Ga0496112_0076589 3300048915 Bacteria 3308
239 Ga0496112_0187924 3300048915 Bacteria 2029
240 Ga0496112_0254988 3300048915 Bacteria 1704
241 Ga0496112_0466445 3300048915 Bacteria 1200
242 Ga0496113_0109982 3300048916 Bacteria 2144
243 Ga0496114_0029720 3300048917 Bacteria 4493
244 Ga0496114_0658573 3300048917 Bacteria 920
245 Ga0496115_0109597 3300048918 Bacteria 2267
246 Ga0496115_0344595 3300048918 Bacteria 1216
247 nmdc:mga08y16_447108_c1 3300050511 Bacteria 1318
248 Ga0495601_0092171 3300053077 Bacteria 1951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0466445 Ga0496112_0466445_47_622 182
2 3300048916 Ga0496113_0109982 Ga0496113_0109982_1439_2011 182
3 3300046679 Ga0495623_0127989 Ga0495623_0127989_16_573 184
4 3300042157 Ga0439458_0075429 Ga0439458_0075429_194_763 185
5 3300048907 Ga0496104_0368642 Ga0496104_0368642_571_1188 187
6 3300048918 Ga0496115_0344595 Ga0496115_0344595_124_741 187
7 3300005983 Ga0081540_1064581 Ga0081540_10645813 190
8 3300037418 Ga0395900_0463126 Ga0395900_0463126_57_656 196
9 3300025941 Ga0207711_10876257 Ga0207711_108762572 197
10 3300005347 Ga0070668_100468820 Ga0070668_1004688202 200
11 3300005440 Ga0070705_100934304 Ga0070705_1009343041 200
12 3300009148 Ga0105243_10846355 Ga0105243_108463551 200
13 3300005467 Ga0070706_100221673 Ga0070706_1002216732 201
14 3300025910 Ga0207684_10006284 Ga0207684_1000628411 201
15 3300005329 Ga0070683_100046502 Ga0070683_1000465024 202
16 3300005329 Ga0070683_100098523 Ga0070683_1000985233 202
17 3300005335 Ga0070666_10054373 Ga0070666_100543732 202
18 3300005338 Ga0068868_100116814 Ga0068868_1001168142 202
19 3300005339 Ga0070660_100192597 Ga0070660_1001925973 202
20 3300005340 Ga0070689_100071874 Ga0070689_1000718743 202
21 3300005340 Ga0070689_100378416 Ga0070689_1003784162 202
22 3300005341 Ga0070691_10067336 Ga0070691_100673362 202
23 3300005343 Ga0070687_100210015 Ga0070687_1002100151 202
24 3300005344 Ga0070661_100095175 Ga0070661_1000951753 202
25 3300005354 Ga0070675_100113422 Ga0070675_1001134223 202
26 3300005355 Ga0070671_100265416 Ga0070671_1002654162 202
27 3300005364 Ga0070673_100009311 Ga0070673_1000093116 202
28 3300005365 Ga0070688_100102711 Ga0070688_1001027112 202
29 3300005367 Ga0070667_100346217 Ga0070667_1003462172 202
30 3300005436 Ga0070713_100610013 Ga0070713_1006100132 202
31 3300005441 Ga0070700_100242118 Ga0070700_1002421181 202
32 3300005455 Ga0070663_100370607 Ga0070663_1003706071 202
33 3300005457 Ga0070662_100091691 Ga0070662_1000916913 202
34 3300005457 Ga0070662_100596006 Ga0070662_1005960061 202
35 3300005458 Ga0070681_10022992 Ga0070681_100229925 202
36 3300005530 Ga0070679_100421169 Ga0070679_1004211692 202
37 3300005535 Ga0070684_100020836 Ga0070684_1000208366 202
38 3300005544 Ga0070686_100104801 Ga0070686_1001048012 202
39 3300005564 Ga0070664_100194508 Ga0070664_1001945083 202
40 3300005564 Ga0070664_100290082 Ga0070664_1002900822 202
41 3300005614 Ga0068856_100042624 Ga0068856_1000426244 202
42 3300005842 Ga0068858_100019895 Ga0068858_1000198953 202
43 3300005843 Ga0068860_100032811 Ga0068860_1000328112 202
44 3300009098 Ga0105245_10360058 Ga0105245_103600581 202
45 3300009174 Ga0105241_10121610 Ga0105241_101216102 202
46 3300009545 Ga0105237_10408514 Ga0105237_104085142 202
47 3300010375 Ga0105239_10198047 Ga0105239_101980473 202
48 3300010375 Ga0105239_10760578 Ga0105239_107605782 202
49 3300013102 Ga0157371_10092457 Ga0157371_100924572 202
50 3300013105 Ga0157369_10050547 Ga0157369_100505473 202
51 3300013296 Ga0157374_10161158 Ga0157374_101611582 202
52 3300013297 Ga0157378_10824079 Ga0157378_108240792 202
53 3300013306 Ga0163162_10228538 Ga0163162_102285383 202
54 3300013307 Ga0157372_10049286 Ga0157372_100492866 202
55 3300013308 Ga0157375_10016687 Ga0157375_100166877 202
56 3300013308 Ga0157375_10523581 Ga0157375_105235811 202
57 3300014968 Ga0157379_10229129 Ga0157379_102291292 202
58 3300014969 Ga0157376_10023588 Ga0157376_100235883 202
59 3300025290 Ga0207673_1023760 Ga0207673_10237601 202
60 3300025315 Ga0207697_10005185 Ga0207697_100051855 202
61 3300025315 Ga0207697_10006387 Ga0207697_100063874 202
62 3300025903 Ga0207680_10175965 Ga0207680_101759652 202
63 3300025904 Ga0207647_10033083 Ga0207647_100330831 202
64 3300025910 Ga0207684_10527172 Ga0207684_105271722 202
65 3300025911 Ga0207654_10032046 Ga0207654_100320462 202
66 3300025912 Ga0207707_10035267 Ga0207707_100352675 202
67 3300025918 Ga0207662_10130108 Ga0207662_101301083 202
68 3300025919 Ga0207657_10170599 Ga0207657_101705993 202
69 3300025920 Ga0207649_10014995 Ga0207649_100149954 202
70 3300025921 Ga0207652_10386732 Ga0207652_103867322 202
71 3300025926 Ga0207659_10140708 Ga0207659_101407082 202
72 3300025927 Ga0207687_10078717 Ga0207687_100787174 202
73 3300025933 Ga0207706_10131625 Ga0207706_101316252 202
74 3300025936 Ga0207670_10259331 Ga0207670_102593312 202
75 3300025945 Ga0207679_10103938 Ga0207679_101039383 202
76 3300025961 Ga0207712_10076777 Ga0207712_100767772 202
77 3300025986 Ga0207658_10500857 Ga0207658_105008572 202
78 3300026078 Ga0207702_10933461 Ga0207702_109334611 202
79 3300026088 Ga0207641_10019892 Ga0207641_100198927 202
80 3300026121 Ga0207683_10058220 Ga0207683_100582204 202
81 3300028379 Ga0268266_10366443 Ga0268266_103664431 202
82 3300028381 Ga0268264_10019057 Ga0268264_100190572 202
83 3300035086 Ga0373934_0188778 Ga0373934_0188778_129_740 202
84 3300035692 Ga0373935_0005347 Ga0373935_0005347_3238_3846 202
85 3300046517 Ga0495630_0148001 Ga0495630_0148001_632_1264 202
86 3300046526 Ga0495666_0168165 Ga0495666_0168165_29_661 202
87 3300046535 Ga0495586_0012119 Ga0495586_0012119_1315_1926 202
88 3300047315 Ga0495581_0098341 Ga0495581_0098341_64_696 202
89 3300047319 Ga0495674_0918043 Ga0495674_0918043_21_659 202
90 3300048907 Ga0496104_0553255 Ga0496104_0553255_381_1019 202
91 3300048915 Ga0496112_0254988 Ga0496112_0254988_687_1325 202
92 3300048917 Ga0496114_0029720 Ga0496114_0029720_354_992 202
93 3300005445 Ga0070708_100134149 Ga0070708_1001341493 203
94 3300005445 Ga0070708_100359261 Ga0070708_1003592613 203
95 3300005468 Ga0070707_100070725 Ga0070707_1000707253 203
96 3300005468 Ga0070707_100223729 Ga0070707_1002237292 203
97 3300005471 Ga0070698_100743073 Ga0070698_1007430731 203
98 3300007076 Ga0075435_100813359 Ga0075435_1008133592 203
99 3300025922 Ga0207646_10025334 Ga0207646_100253344 203
100 3300025922 Ga0207646_10071236 Ga0207646_100712363 203
101 3300002126 JGI24035J26624_1001588 JGI24035J26624_10015883 204
102 3300005288 Ga0065714_10165100 Ga0065714_101651002 204
103 3300005289 Ga0065704_10168164 Ga0065704_101681641 204
104 3300005289 Ga0065704_10176607 Ga0065704_101766072 204
105 3300005290 Ga0065712_10009253 Ga0065712_100092533 204
106 3300005290 Ga0065712_10016720 Ga0065712_100167203 204
107 3300005290 Ga0065712_10112090 Ga0065712_101120902 204
108 3300005293 Ga0065715_10014472 Ga0065715_100144722 204
109 3300005293 Ga0065715_10223809 Ga0065715_102238092 204
110 3300005327 Ga0070658_10515865 Ga0070658_105158652 204
111 3300005329 Ga0070683_100192289 Ga0070683_1001922893 204
112 3300005340 Ga0070689_100028658 Ga0070689_1000286586 204
113 3300005353 Ga0070669_100475740 Ga0070669_1004757402 204
114 3300005354 Ga0070675_100380121 Ga0070675_1003801212 204
115 3300005365 Ga0070688_100026161 Ga0070688_1000261616 204
116 3300005436 Ga0070713_100035280 Ga0070713_1000352803 204
117 3300005437 Ga0070710_10092316 Ga0070710_100923162 204
118 3300005439 Ga0070711_100662871 Ga0070711_1006628711 204
119 3300005445 Ga0070708_100053464 Ga0070708_1000534645 204
120 3300005445 Ga0070708_100248727 Ga0070708_1002487272 204
121 3300005455 Ga0070663_100226044 Ga0070663_1002260442 204
122 3300005458 Ga0070681_10334056 Ga0070681_103340562 204
123 3300005467 Ga0070706_100040614 Ga0070706_1000406143 204
124 3300005467 Ga0070706_100132114 Ga0070706_1001321142 204
125 3300005467 Ga0070706_100270087 Ga0070706_1002700872 204
126 3300005468 Ga0070707_100018094 Ga0070707_1000180942 204
127 3300005468 Ga0070707_100133381 Ga0070707_1001333812 204
128 3300005468 Ga0070707_100248595 Ga0070707_1002485952 204
129 3300005468 Ga0070707_100641208 Ga0070707_1006412082 204
130 3300005471 Ga0070698_100602432 Ga0070698_1006024322 204
131 3300005518 Ga0070699_100516838 Ga0070699_1005168382 204
132 3300005535 Ga0070684_100417189 Ga0070684_1004171892 204
133 3300005536 Ga0070697_100059734 Ga0070697_1000597342 204
134 3300005536 Ga0070697_100093333 Ga0070697_1000933333 204
135 3300005536 Ga0070697_100125510 Ga0070697_1001255103 204
136 3300005544 Ga0070686_100086552 Ga0070686_1000865523 204
137 3300005548 Ga0070665_100056148 Ga0070665_1000561483 204
138 3300005548 Ga0070665_100088770 Ga0070665_1000887706 204
139 3300005548 Ga0070665_100405833 Ga0070665_1004058332 204
140 3300005842 Ga0068858_100543828 Ga0068858_1005438282 204
141 3300005937 Ga0081455_10051824 Ga0081455_100518244 204
142 3300005983 Ga0081540_1039251 Ga0081540_10392513 204
143 3300005983 Ga0081540_1071827 Ga0081540_10718272 204
144 3300005985 Ga0081539_10011187 Ga0081539_100111876 204
145 3300006028 Ga0070717_10033845 Ga0070717_100338452 204
146 3300006028 Ga0070717_10044135 Ga0070717_100441353 204
147 3300006028 Ga0070717_10085773 Ga0070717_100857732 204
148 3300006028 Ga0070717_10120465 Ga0070717_101204652 204
149 3300006163 Ga0070715_10095519 Ga0070715_100955192 204
150 3300006163 Ga0070715_10413470 Ga0070715_104134701 204
151 3300006173 Ga0070716_100156765 Ga0070716_1001567652 204
152 3300006175 Ga0070712_100009507 Ga0070712_1000095073 204
153 3300006175 Ga0070712_100024824 Ga0070712_1000248243 204
154 3300006175 Ga0070712_100112728 Ga0070712_1001127282 204
155 3300006175 Ga0070712_100297223 Ga0070712_1002972231 204
156 3300006175 Ga0070712_100451298 Ga0070712_1004512981 204
157 3300006871 Ga0075434_100378784 Ga0075434_1003787842 204
158 3300006881 Ga0068865_100231488 Ga0068865_1002314882 204
159 3300009094 Ga0111539_10606019 Ga0111539_106060192 204
160 3300009098 Ga0105245_10188840 Ga0105245_101888401 204
161 3300009147 Ga0114129_11430393 Ga0114129_114303932 204
162 3300009174 Ga0105241_10794099 Ga0105241_107940992 204
163 3300009176 Ga0105242_10388002 Ga0105242_103880022 204
164 3300010159 Ga0099796_10076504 Ga0099796_100765042 204
165 3300010375 Ga0105239_10231553 Ga0105239_102315531 204
166 3300013102 Ga0157371_10538313 Ga0157371_105383131 204
167 3300013296 Ga0157374_10033991 Ga0157374_100339914 204
168 3300013296 Ga0157374_11318037 Ga0157374_113180371 204
169 3300013306 Ga0163162_10058184 Ga0163162_100581843 204
170 3300013308 Ga0157375_10733265 Ga0157375_107332652 204
171 3300014497 Ga0182008_10271034 Ga0182008_102710342 204
172 3300014969 Ga0157376_10123603 Ga0157376_101236033 204
173 3300014969 Ga0157376_10139328 Ga0157376_101393281 204
174 3300025271 Ga0207666_1002300 Ga0207666_10023003 204
175 3300025315 Ga0207697_10031994 Ga0207697_100319942 204
176 3300025315 Ga0207697_10046168 Ga0207697_100461682 204
177 3300025315 Ga0207697_10150753 Ga0207697_101507532 204
178 3300025898 Ga0207692_10097214 Ga0207692_100972142 204
179 3300025901 Ga0207688_10142760 Ga0207688_101427601 204
180 3300025910 Ga0207684_10020514 Ga0207684_100205145 204
181 3300025915 Ga0207693_10023424 Ga0207693_100234243 204
182 3300025915 Ga0207693_10035606 Ga0207693_100356064 204
183 3300025915 Ga0207693_10042841 Ga0207693_100428412 204
184 3300025915 Ga0207693_10151920 Ga0207693_101519202 204
185 3300025915 Ga0207693_10261954 Ga0207693_102619542 204
186 3300025920 Ga0207649_10399825 Ga0207649_103998252 204
187 3300025921 Ga0207652_10465616 Ga0207652_104656162 204
188 3300025922 Ga0207646_10065350 Ga0207646_100653502 204
189 3300025922 Ga0207646_10165448 Ga0207646_101654483 204
190 3300025922 Ga0207646_10524925 Ga0207646_105249252 204
191 3300025923 Ga0207681_10212169 Ga0207681_102121692 204
192 3300025926 Ga0207659_10318253 Ga0207659_103182531 204
193 3300025928 Ga0207700_10069507 Ga0207700_100695072 204
194 3300025928 Ga0207700_10189976 Ga0207700_101899762 204
195 3300025928 Ga0207700_10263525 Ga0207700_102635252 204
196 3300025929 Ga0207664_10054692 Ga0207664_100546922 204
197 3300025929 Ga0207664_10482418 Ga0207664_104824182 204
198 3300025932 Ga0207690_10510529 Ga0207690_105105292 204
199 3300025933 Ga0207706_10422758 Ga0207706_104227582 204
200 3300025934 Ga0207686_10110223 Ga0207686_101102232 204
201 3300025939 Ga0207665_10114646 Ga0207665_101146462 204
202 3300025940 Ga0207691_10060688 Ga0207691_100606885 204
203 3300025945 Ga0207679_10569981 Ga0207679_105699811 204
204 3300026067 Ga0207678_10162485 Ga0207678_101624852 204
205 3300026088 Ga0207641_10403012 Ga0207641_104030122 204
206 3300028379 Ga0268266_10153811 Ga0268266_101538113 204
207 3300035117 Ga0373953_0137607 Ga0373953_0137607_317_934 204
208 3300035117 Ga0373953_0191360 Ga0373953_0191360_227_844 204
209 3300035170 Ga0373943_0051396 Ga0373943_0051396_1145_1765 204
210 3300035691 Ga0373931_0151052 Ga0373931_0151052_698_1318 204
211 3300037068 Ga0373925_0073135 Ga0373925_0073135_1266_1886 204
212 3300037312 Ga0395899_0068440 Ga0395899_0068440_1216_1836 204
213 3300037418 Ga0395900_0002931 Ga0395900_0002931_15383_16003 204
214 3300037466 Ga0395898_0010885 Ga0395898_0010885_8577_9197 204
215 3300037466 Ga0395898_0229883 Ga0395898_0229883_1007_1627 204
216 3300037466 Ga0395898_0880064 Ga0395898_0880064_179_799 204
217 3300037471 Ga0395905_0454024 Ga0395905_0454024_269_889 204
218 3300038443 Ga0395901_0069465 Ga0395901_0069465_287_907 204
219 3300038443 Ga0395901_0189821 Ga0395901_0189821_337_972 204
220 3300042012 Ga0439455_0027456 Ga0439455_0027456_688_1308 204
221 3300045976 Ga0466967_0363784 Ga0466967_0363784_350_982 204
222 3300046454 Ga0495592_0004150 Ga0495592_0004150_5034_5651 204
223 3300046511 Ga0495608_0179764 Ga0495608_0179764_598_1215 204
224 3300046516 Ga0495628_0057347 Ga0495628_0057347_1110_1727 204
225 3300046529 Ga0495652_0039740 Ga0495652_0039740_3392_4009 204
226 3300046536 Ga0495587_0044969 Ga0495587_0044969_596_1213 204
227 3300046543 Ga0495645_0011137 Ga0495645_0011137_3215_3832 204
228 3300046559 Ga0495667_0262274 Ga0495667_0262274_70_687 204
229 3300046642 Ga0495634_0031169 Ga0495634_0031169_175_792 204
230 3300046678 Ga0495599_0034595 Ga0495599_0034595_1626_2243 204
231 3300046680 Ga0495646_0040473 Ga0495646_0040473_345_962 204
232 3300046683 Ga0495658_0514967 Ga0495658_0514967_10_627 204
233 3300046684 Ga0495669_0026849 Ga0495669_0026849_290_928 204
234 3300047317 Ga0495604_0033241 Ga0495604_0033241_1878_2495 204
235 3300047319 Ga0495674_0111284 Ga0495674_0111284_888_1505 204
236 3300047444 Ga0495675_0089661 Ga0495675_0089661_182_799 204
237 3300047471 Ga0495684_0011575 Ga0495684_0011575_5278_5895 204
238 3300048088 Ga0495602_0039828 Ga0495602_0039828_726_1343 204
239 3300048904 Ga0496101_0025846 Ga0496101_0025846_2487_3110 204
240 3300048908 Ga0496105_0343680 Ga0496105_0343680_297_935 204
241 3300048909 Ga0496106_0745862 Ga0496106_0745862_38_679 204
242 3300048910 Ga0496107_0109764 Ga0496107_0109764_38_661 204
243 3300048915 Ga0496112_0076589 Ga0496112_0076589_895_1509 204
244 3300048915 Ga0496112_0187924 Ga0496112_0187924_972_1610 204
245 3300048917 Ga0496114_0658573 Ga0496114_0658573_214_837 204
246 3300048918 Ga0496115_0109597 Ga0496115_0109597_1395_2018 204
247 3300050511 nmdc:mga08y16_447108_c1 nmdc:mga08y16_447108_c1_45_689 204
248 3300053077 Ga0495601_0092171 Ga0495601_0092171_1023_1640 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

61

214

0.86

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

11

203

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9737 4 201
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9501 4 201
3og9-assembly2.cif.gz_B structure of yahd with malic acid 0.9386 7 201
3b5e-assembly1.cif.gz_A crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution 0.9344 7 202
2r8b-assembly2.cif.gz_B the crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58 0.9074 7 201
ID Description Score Start End Superfamily
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9555 8 201 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9509 9 200 3.40.50.1820
3og9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9387 7 201 3.40.50.1820
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9364 8 201 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9229 9 200 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6F891-F1-model_v4 Phospholipase 0.9938 47 200 GO:0016787
AF-A0A7W1D5N5-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9915 100 201 GO:0016787
AF-A0A2V5LB80-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9915 125 199 GO:0016787
AF-A0A2W4R6H2-F1-model_v4 Phospholipase 0.9899 6 201 GO:0016787
AF-A0A537J3H5-F1-model_v4 Alpha/beta hydrolase 0.9847 3 201 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map