F359405

General Info

Members Datasets Scaffolds Average Seq Length
247 140 494 136

Family's Representative Sequence

Representative Sequence 3300049708|Ga0501245_065150|Ga0501245_065150_58_540
Length 160
Sequence MQVSAYLRYFYRRKMKIESSIKIRSLVQLFEVLPENERIMVDVLRQIIIENLPARCKEKISFNVPFFYGNRGICIIWPASIPRGGFKQGVLLGFWFGNKLKDKEHYLTHGTNKKVFYKIFQSAEDIGEEPIASLLKEALRIDELHQPVHVKPKKRAHARS

Samples

Sample ID Description Type Environment
1 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
140 2842903701 Olivibacter sp. R-72191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 1.21
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 31.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501245_065150 3300049708 Bacteria 675
2 Ga0065712_10249882 3300005290 Unclassified 958
3 Ga0065712_10740806 3300005290 Unclassified 532
4 Ga0065707_10115455 3300005295 Bacteria 2266
5 Ga0070683_100010911 3300005329 Bacteria 7823
6 Ga0070683_100039617 3300005329 Unclassified 4327
7 Ga0070683_100876163 3300005329 Bacteria 861
8 Ga0070670_100180795 3300005331 Unclassified 1831
9 Ga0070670_100541813 3300005331 Unclassified 1038
10 Ga0068869_100035349 3300005334 Bacteria 3540
11 Ga0068869_100387236 3300005334 Unclassified 1147
12 Ga0070666_10117859 3300005335 Bacteria 1840
13 Ga0070682_100000066 3300005337 Bacteria 98643
14 Ga0070682_100189994 3300005337 Bacteria 1441
15 Ga0070661_100010275 3300005344 Bacteria 6505
16 Ga0070668_101406357 3300005347 Bacteria 636
17 Ga0070669_100124886 3300005353 Unclassified 1968
18 Ga0070669_100147620 3300005353 Bacteria 1818
19 Ga0070669_100153789 3300005353 Unclassified 1782
20 Ga0070669_100337704 3300005353 Unclassified 1220
21 Ga0070675_100079905 3300005354 Unclassified 2726
22 Ga0070675_100154532 3300005354 Unclassified 1969
23 Ga0070671_100535425 3300005355 Bacteria 1009
24 Ga0070673_100522559 3300005364 Bacteria 1076
25 Ga0070688_100093317 3300005365 Bacteria 1971
26 Ga0070688_100574581 3300005365 Bacteria 860
27 Ga0070688_100935024 3300005365 Unclassified 685
28 Ga0070688_101501138 3300005365 Unclassified 548
29 Ga0070659_100015193 3300005366 Bacteria 5761
30 Ga0070659_100689598 3300005366 Unclassified 883
31 Ga0070659_100791215 3300005366 Bacteria 824
32 Ga0070667_100202792 3300005367 Bacteria 1760
33 Ga0070667_100279821 3300005367 Unclassified 1498
34 Ga0070667_101126608 3300005367 Bacteria 734
35 Ga0070663_100179862 3300005455 Unclassified 1640
36 Ga0070678_100693776 3300005456 Bacteria 917
37 Ga0070662_100017315 3300005457 Unclassified 4857
38 Ga0070662_100030723 3300005457 Bacteria 3763
39 Ga0070681_10505852 3300005458 Bacteria 1121
40 Ga0070706_100601997 3300005467 Bacteria 1021
41 Ga0070684_100004454 3300005535 Bacteria 10671
42 Ga0070684_100012624 3300005535 Bacteria 6776
43 Ga0070684_100335027 3300005535 Unclassified 1391
44 Ga0070684_101329343 3300005535 Unclassified 677
45 Ga0068853_100072628 3300005539 Bacteria 2999
46 Ga0068853_100360976 3300005539 Bacteria 1353
47 Ga0070672_100359904 3300005543 Unclassified 1242
48 Ga0070672_101166721 3300005543 Unclassified 686
49 Ga0070672_101531564 3300005543 Bacteria 598
50 Ga0070686_100423645 3300005544 Bacteria 1017
51 Ga0070665_100116220 3300005548 Unclassified 2678
52 Ga0070665_100510708 3300005548 Bacteria 1213
53 Ga0068855_101049345 3300005563 Bacteria 854
54 Ga0068855_101064224 3300005563 Bacteria 847
55 Ga0068855_102123302 3300005563 Unclassified 565
56 Ga0070664_100008111 3300005564 Bacteria 8491
57 Ga0070664_100022947 3300005564 Bacteria 5148
58 Ga0070664_100099995 3300005564 Unclassified 2521
59 Ga0070664_100653067 3300005564 Bacteria 978
60 Ga0068857_100015925 3300005577 Bacteria 6583
61 Ga0068857_100235822 3300005577 Bacteria 1674
62 Ga0068857_100272838 3300005577 Unclassified 1555
63 Ga0068857_100648266 3300005577 Bacteria 1001
64 Ga0068857_101161215 3300005577 Bacteria 747
65 Ga0068854_100209687 3300005578 Bacteria 1536
66 Ga0068852_100241494 3300005616 Unclassified 1727
67 Ga0068852_100672105 3300005616 Bacteria 1044
68 Ga0068852_101166662 3300005616 Bacteria 791
69 Ga0068859_100025542 3300005617 Bacteria 5925
70 Ga0068859_100085507 3300005617 Bacteria 3199
71 Ga0068859_100226068 3300005617 Unclassified 1959
72 Ga0068859_102532405 3300005617 Unclassified 565
73 Ga0068864_100033140 3300005618 Unclassified 4391
74 Ga0068861_100191939 3300005719 Bacteria 1708
75 Ga0068863_100363362 3300005841 Bacteria 1411
76 Ga0068858_100334132 3300005842 Unclassified 1449
77 Ga0068858_100699910 3300005842 Unclassified 986
78 Ga0068858_101888307 3300005842 Bacteria 590
79 Ga0068860_100008878 3300005843 Bacteria 10013
80 Ga0068860_100011306 3300005843 Bacteria 8797
81 Ga0068862_100460242 3300005844 Bacteria 1201
82 Ga0081539_10294320 3300005985 Bacteria 700
83 Ga0075366_10008043 3300006195 Bacteria 5845
84 Ga0097621_100052745 3300006237 Bacteria 3314
85 Ga0097621_100477560 3300006237 Bacteria 1126
86 Ga0097621_100693019 3300006237 Bacteria 937
87 Ga0097621_101280991 3300006237 Unclassified 692
88 Ga0068865_101352245 3300006881 Unclassified 635
89 Ga0097620_100025542 3300006931 Bacteria 5925
90 Ga0097620_100085499 3300006931 Bacteria 3199
91 Ga0097620_100226059 3300006931 Unclassified 1959
92 Ga0097620_102532530 3300006931 Unclassified 565
93 Ga0105251_10095923 3300009011 Bacteria 1359
94 Ga0105245_10055450 3300009098 Bacteria 3560
95 Ga0105247_10006997 3300009101 Bacteria 6942
96 Ga0105249_10017939 3300009553 Bacteria 6289
97 Ga0105249_10064222 3300009553 Bacteria 3375
98 Ga0105249_10662061 3300009553 Bacteria 1102
99 Ga0105249_11584550 3300009553 Unclassified 727
100 Ga0105239_10071177 3300010375 Bacteria 3821
101 Ga0105246_10161205 3300011119 Unclassified 1708
102 Ga0105246_10564713 3300011119 Bacteria 977
103 Ga0105246_11688344 3300011119 Unclassified 601
104 Ga0157321_1030820 3300012487 Bacteria 546
105 Ga0157373_10045627 3300013100 Unclassified 3128
106 Ga0157374_10008886 3300013296 Bacteria 8605
107 Ga0157374_10020847 3300013296 Bacteria 5822
108 Ga0157378_10253044 3300013297 Unclassified 1687
109 Ga0157378_10511969 3300013297 Unclassified 1200
110 Ga0157378_10547364 3300013297 Bacteria 1162
111 Ga0157378_11225218 3300013297 Bacteria 790
112 Ga0157378_12292995 3300013297 Unclassified 591
113 Ga0163162_10000391 3300013306 Bacteria 40141
114 Ga0163162_10173140 3300013306 Unclassified 2283
115 Ga0163162_10274598 3300013306 Bacteria 1817
116 Ga0157372_11329236 3300013307 Unclassified 829
117 Ga0157375_10067561 3300013308 Unclassified 3572
118 Ga0163163_10020184 3300014325 Bacteria 6271
119 Ga0163163_10153636 3300014325 Unclassified 2345
120 Ga0163163_10586731 3300014325 Unclassified 1178
121 Ga0157380_10251526 3300014326 Unclassified 1600
122 Ga0157380_10277676 3300014326 Bacteria 1531
123 Ga0157380_10495370 3300014326 Bacteria 1185
124 Ga0157380_10662272 3300014326 Unclassified 1043
125 Ga0157377_10034782 3300014745 Unclassified 2758
126 Ga0157379_10020556 3300014968 Bacteria 5840
127 Ga0157379_10637973 3300014968 Bacteria 996
128 Ga0157379_10940780 3300014968 Bacteria 821
129 Ga0157379_11959016 3300014968 Unclassified 578
130 Ga0157376_10096752 3300014969 Unclassified 2570
131 Ga0157376_10195477 3300014969 Bacteria 1858
132 Ga0157376_10337854 3300014969 Bacteria 1437
133 Ga0157376_10380482 3300014969 Bacteria 1360
134 Ga0157376_12949096 3300014969 Unclassified 515
135 Ga0163161_11165203 3300017792 Bacteria 665
136 Ga0207656_10335345 3300025321 Unclassified 753
137 Ga0207713_1146671 3300025735 Bacteria 766
138 Ga0207710_10010082 3300025900 Bacteria 3975
139 Ga0207680_10033023 3300025903 Bacteria 2948
140 Ga0207680_10804080 3300025903 Unclassified 674
141 Ga0207643_10271279 3300025908 Bacteria 1050
142 Ga0207684_10618274 3300025910 Bacteria 924
143 Ga0207662_11285504 3300025918 Unclassified 520
144 Ga0207657_10493730 3300025919 Bacteria 959
145 Ga0207649_10002192 3300025920 Bacteria 11033
146 Ga0207649_10273217 3300025920 Bacteria 1226
147 Ga0207649_10652859 3300025920 Bacteria 813
148 Ga0207681_10282156 3300025923 Unclassified 1308
149 Ga0207681_10558804 3300025923 Bacteria 942
150 Ga0207681_11525056 3300025923 Unclassified 560
151 Ga0207659_10014782 3300025926 Bacteria 5044
152 Ga0207644_10466984 3300025931 Bacteria 1038
153 Ga0207644_11000285 3300025931 Bacteria 702
154 Ga0207690_10189908 3300025932 Bacteria 1553
155 Ga0207706_10020402 3300025933 Bacteria 5958
156 Ga0207706_10162690 3300025933 Bacteria 1962
157 Ga0207706_10278192 3300025933 Bacteria 1460
158 Ga0207670_10066473 3300025936 Unclassified 2477
159 Ga0207670_10098671 3300025936 Unclassified 2082
160 Ga0207704_10466594 3300025938 Unclassified 1011
161 Ga0207691_10111297 3300025940 Unclassified 2435
162 Ga0207691_11130028 3300025940 Bacteria 651
163 Ga0207689_10007976 3300025942 Bacteria 9251
164 Ga0207689_10050869 3300025942 Bacteria 3415
165 Ga0207661_10011969 3300025944 Bacteria 6301
166 Ga0207661_10955835 3300025944 Bacteria 789
167 Ga0207679_10000660 3300025945 Bacteria 23125
168 Ga0207679_10029085 3300025945 Unclassified 3843
169 Ga0207679_10171674 3300025945 Bacteria 1786
170 Ga0207679_10624294 3300025945 Bacteria 973
171 Ga0207667_10260268 3300025949 Bacteria 1774
172 Ga0207651_10055986 3300025960 Unclassified 2712
173 Ga0207712_10006864 3300025961 Bacteria 7189
174 Ga0207712_10016546 3300025961 Unclassified 4779
175 Ga0207712_11187250 3300025961 Bacteria 681
176 Ga0207658_10067440 3300025986 Unclassified 2695
177 Ga0207658_10161268 3300025986 Bacteria 1838
178 Ga0207658_10943726 3300025986 Bacteria 786
179 Ga0207677_10009678 3300026023 Bacteria 5429
180 Ga0207677_10349918 3300026023 Bacteria 1238
181 Ga0207703_10060267 3300026035 Bacteria 3103
182 Ga0207703_10942197 3300026035 Bacteria 827
183 Ga0207639_10010265 3300026041 Bacteria 6482
184 Ga0207639_10147282 3300026041 Bacteria 1968
185 Ga0207641_10000690 3300026088 Bacteria 36445
186 Ga0207641_10146893 3300026088 Unclassified 2133
187 Ga0207648_10086060 3300026089 Bacteria 2742
188 Ga0207648_10211003 3300026089 Bacteria 1724
189 Ga0207648_10284963 3300026089 Bacteria 1478
190 Ga0207676_10045172 3300026095 Unclassified 3402
191 Ga0207676_10944905 3300026095 Bacteria 847
192 Ga0207674_10037932 3300026116 Bacteria 5006
193 Ga0207674_10100451 3300026116 Unclassified 2875
194 Ga0207674_10425389 3300026116 Bacteria 1283
195 Ga0207675_100307271 3300026118 Bacteria 1546
196 Ga0207698_10583634 3300026142 Bacteria 1100
197 Ga0207698_10651674 3300026142 Bacteria 1043
198 Ga0207698_11076182 3300026142 Bacteria 816
199 Ga0268266_10131607 3300028379 Unclassified 2238
200 Ga0268265_10060265 3300028380 Bacteria 2908
201 Ga0268265_10312942 3300028380 Bacteria 1419
202 Ga0268264_10004044 3300028381 Bacteria 12552
203 Ga0268264_10007948 3300028381 Bacteria 8826
204 Ga0268264_10271938 3300028381 Unclassified 1583
205 Ga0268264_11009479 3300028381 Bacteria 839
206 Ga0265331_10488430 3300031250 Bacteria 554
207 Ga0307509_10319905 3300031507 Unclassified 1289
208 Ga0307410_10442496 3300031852 Bacteria 1059
209 Ga0373957_0121915 3300035120 Bacteria 1056
210 Ga0373931_0580045 3300035691 Unclassified 731
211 Ga0373935_0769550 3300035692 Unclassified 710
212 Ga0373933_0019458 3300035724 Bacteria 3836
213 Ga0373947_0319435 3300035725 Unclassified 1038
214 Ga0373937_0175355 3300036401 Bacteria 2012
215 Ga0373925_0225575 3300037068 Bacteria 1497
216 Ga0451800_0830458 3300041459 Unclassified 761
217 Ga0451802_0979116 3300041460 Bacteria 957
218 Ga0451841_0273537 3300041498 Bacteria 635
219 Ga0451853_2373503 3300041512 Bacteria 1298
220 Ga0451577_0837088 3300042876 Bacteria 830
221 Ga0495592_0175431 3300046454 Bacteria 1464
222 Ga0495638_0270356 3300046460 Bacteria 928
223 Ga0495653_0058743 3300046463 Bacteria 2923
224 Ga0495664_0511407 3300046477 Bacteria 717
225 Ga0495608_0040767 3300046511 Bacteria 3110
226 Ga0495628_0013274 3300046516 Bacteria 6929
227 Ga0495630_0021936 3300046517 Bacteria 4716
228 Ga0495640_0079693 3300046533 Bacteria 2180
229 Ga0495667_0192639 3300046559 Bacteria 1306
230 Ga0495634_0170931 3300046642 Bacteria 1366
231 Ga0495635_0946885 3300046663 Bacteria 550
232 Ga0495646_0040194 3300046680 Bacteria 2882
233 Ga0495613_0146212 3300046689 Bacteria 1687
234 Ga0495600_0203973 3300046809 Bacteria 1269
235 Ga0495680_0189625 3300047322 Bacteria 1480
236 Ga0495684_0655251 3300047471 Bacteria 702
237 Ga0495686_0144146 3300047472 Bacteria 1403
238 Ga0496110_0323359 3300048913 Unclassified 1405
239 Ga0496125_0372867 3300048928 Bacteria 844
240 nmdc:mga0k408_184334_c1 3300050493 Unclassified 1245
241 Ga0500583_0000209 3300053092 Bacteria 22215
242 Ga0500562_043784 3300053108 Bacteria 1192
243 Ga0500642_0279920 3300053130 Unclassified 758
244 Ga0500622_0004007 3300053156 Bacteria 9491
245 Ga0500622_0251317 3300053156 Bacteria 776
246 Ga0500587_039446 3300053739 Bacteria 672
247 2842904599 2842903701 Bacteria 6986368
248 Ga0501245_065150
249 Ga0065712_10249882
250 Ga0065712_10740806
251 Ga0065707_10115455
252 Ga0070683_100010911
253 Ga0070683_100039617
254 Ga0070683_100876163
255 Ga0070670_100180795
256 Ga0070670_100541813
257 Ga0068869_100035349
258 Ga0068869_100387236
259 Ga0070666_10117859
260 Ga0070682_100000066
261 Ga0070682_100189994
262 Ga0070661_100010275
263 Ga0070668_101406357
264 Ga0070669_100124886
265 Ga0070669_100147620
266 Ga0070669_100153789
267 Ga0070669_100337704
268 Ga0070675_100079905
269 Ga0070675_100154532
270 Ga0070671_100535425
271 Ga0070673_100522559
272 Ga0070688_100093317
273 Ga0070688_100574581
274 Ga0070688_100935024
275 Ga0070688_101501138
276 Ga0070659_100015193
277 Ga0070659_100689598
278 Ga0070659_100791215
279 Ga0070667_100202792
280 Ga0070667_100279821
281 Ga0070667_101126608
282 Ga0070663_100179862
283 Ga0070678_100693776
284 Ga0070662_100017315
285 Ga0070662_100030723
286 Ga0070681_10505852
287 Ga0070706_100601997
288 Ga0070684_100004454
289 Ga0070684_100012624
290 Ga0070684_100335027
291 Ga0070684_101329343
292 Ga0068853_100072628
293 Ga0068853_100360976
294 Ga0070672_100359904
295 Ga0070672_101166721
296 Ga0070672_101531564
297 Ga0070686_100423645
298 Ga0070665_100116220
299 Ga0070665_100510708
300 Ga0068855_101049345
301 Ga0068855_101064224
302 Ga0068855_102123302
303 Ga0070664_100008111
304 Ga0070664_100022947
305 Ga0070664_100099995
306 Ga0070664_100653067
307 Ga0068857_100015925
308 Ga0068857_100235822
309 Ga0068857_100272838
310 Ga0068857_100648266
311 Ga0068857_101161215
312 Ga0068854_100209687
313 Ga0068852_100241494
314 Ga0068852_100672105
315 Ga0068852_101166662
316 Ga0068859_100025542
317 Ga0068859_100085507
318 Ga0068859_100226068
319 Ga0068859_102532405
320 Ga0068864_100033140
321 Ga0068861_100191939
322 Ga0068863_100363362
323 Ga0068858_100334132
324 Ga0068858_100699910
325 Ga0068858_101888307
326 Ga0068860_100008878
327 Ga0068860_100011306
328 Ga0068862_100460242
329 Ga0081539_10294320
330 Ga0075366_10008043
331 Ga0097621_100052745
332 Ga0097621_100477560
333 Ga0097621_100693019
334 Ga0097621_101280991
335 Ga0068865_101352245
336 Ga0097620_100025542
337 Ga0097620_100085499
338 Ga0097620_100226059
339 Ga0097620_102532530
340 Ga0105251_10095923
341 Ga0105245_10055450
342 Ga0105247_10006997
343 Ga0105249_10017939
344 Ga0105249_10064222
345 Ga0105249_10662061
346 Ga0105249_11584550
347 Ga0105239_10071177
348 Ga0105246_10161205
349 Ga0105246_10564713
350 Ga0105246_11688344
351 Ga0157321_1030820
352 Ga0157373_10045627
353 Ga0157374_10008886
354 Ga0157374_10020847
355 Ga0157378_10253044
356 Ga0157378_10511969
357 Ga0157378_10547364
358 Ga0157378_11225218
359 Ga0157378_12292995
360 Ga0163162_10000391
361 Ga0163162_10173140
362 Ga0163162_10274598
363 Ga0157372_11329236
364 Ga0157375_10067561
365 Ga0163163_10020184
366 Ga0163163_10153636
367 Ga0163163_10586731
368 Ga0157380_10251526
369 Ga0157380_10277676
370 Ga0157380_10495370
371 Ga0157380_10662272
372 Ga0157377_10034782
373 Ga0157379_10020556
374 Ga0157379_10637973
375 Ga0157379_10940780
376 Ga0157379_11959016
377 Ga0157376_10096752
378 Ga0157376_10195477
379 Ga0157376_10337854
380 Ga0157376_10380482
381 Ga0157376_12949096
382 Ga0163161_11165203
383 Ga0207656_10335345
384 Ga0207713_1146671
385 Ga0207710_10010082
386 Ga0207680_10033023
387 Ga0207680_10804080
388 Ga0207643_10271279
389 Ga0207684_10618274
390 Ga0207662_11285504
391 Ga0207657_10493730
392 Ga0207649_10002192
393 Ga0207649_10273217
394 Ga0207649_10652859
395 Ga0207681_10282156
396 Ga0207681_10558804
397 Ga0207681_11525056
398 Ga0207659_10014782
399 Ga0207644_10466984
400 Ga0207644_11000285
401 Ga0207690_10189908
402 Ga0207706_10020402
403 Ga0207706_10162690
404 Ga0207706_10278192
405 Ga0207670_10066473
406 Ga0207670_10098671
407 Ga0207704_10466594
408 Ga0207691_10111297
409 Ga0207691_11130028
410 Ga0207689_10007976
411 Ga0207689_10050869
412 Ga0207661_10011969
413 Ga0207661_10955835
414 Ga0207679_10000660
415 Ga0207679_10029085
416 Ga0207679_10171674
417 Ga0207679_10624294
418 Ga0207667_10260268
419 Ga0207651_10055986
420 Ga0207712_10006864
421 Ga0207712_10016546
422 Ga0207712_11187250
423 Ga0207658_10067440
424 Ga0207658_10161268
425 Ga0207658_10943726
426 Ga0207677_10009678
427 Ga0207677_10349918
428 Ga0207703_10060267
429 Ga0207703_10942197
430 Ga0207639_10010265
431 Ga0207639_10147282
432 Ga0207641_10000690
433 Ga0207641_10146893
434 Ga0207648_10086060
435 Ga0207648_10211003
436 Ga0207648_10284963
437 Ga0207676_10045172
438 Ga0207676_10944905
439 Ga0207674_10037932
440 Ga0207674_10100451
441 Ga0207674_10425389
442 Ga0207675_100307271
443 Ga0207698_10583634
444 Ga0207698_10651674
445 Ga0207698_11076182
446 Ga0268266_10131607
447 Ga0268265_10060265
448 Ga0268265_10312942
449 Ga0268264_10004044
450 Ga0268264_10007948
451 Ga0268264_10271938
452 Ga0268264_11009479
453 Ga0265331_10488430
454 Ga0307509_10319905
455 Ga0307410_10442496
456 Ga0373957_0121915
457 Ga0373931_0580045
458 Ga0373935_0769550
459 Ga0373933_0019458
460 Ga0373947_0319435
461 Ga0373937_0175355
462 Ga0373925_0225575
463 Ga0451800_0830458
464 Ga0451802_0979116
465 Ga0451841_0273537
466 Ga0451853_2373503
467 Ga0451577_0837088
468 Ga0495592_0175431
469 Ga0495638_0270356
470 Ga0495653_0058743
471 Ga0495664_0511407
472 Ga0495608_0040767
473 Ga0495628_0013274
474 Ga0495630_0021936
475 Ga0495640_0079693
476 Ga0495667_0192639
477 Ga0495634_0170931
478 Ga0495635_0946885
479 Ga0495646_0040194
480 Ga0495613_0146212
481 Ga0495600_0203973
482 Ga0495680_0189625
483 Ga0495684_0655251
484 Ga0495686_0144146
485 Ga0496110_0323359
486 Ga0496125_0372867
487 nmdc:mga0k408_184334_c1
488 Ga0500583_0000209
489 Ga0500562_043784
490 Ga0500642_0279920
491 Ga0500622_0004007
492 Ga0500622_0251317
493 Ga0500587_039446
494 2842904599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

37

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.673 50 151
7pas-assembly1.cif.gz_2 70s ribosome with p/e-site trna in mycoplasma pneumoniae cells 0.6506 59 77
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6082 49 150
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.5624 98 148
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.5358 49 150
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8716 37 147 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8069 37 147 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6431 48 150 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5696 48 150 3.90.1150.30
1hi9A02 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Dipeptide transport protein 0.5578 98 148 3.30.1360.130
ID Description Score Start End GO Terms
AF-A0A7Y5E6V1-F1-model_v4 YdhG-like domain-containing protein 0.9944 33 152
AF-W6UHA1-F1-model_v4 YdhG-like domain-containing protein 0.9937 32 151
AF-A0A537JP88-F1-model_v4 DUF1801 domain-containing protein 0.9889 24 151
AF-A0A838T7Y2-F1-model_v4 DUF1801 domain-containing protein 0.9867 25 151
AF-A0A5J5IF46-F1-model_v4 DUF1801 domain-containing protein 0.9843 41 151

Map