F359331

General Info

Members Datasets Scaffolds Average Seq Length
247 107 494 380

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0039876|Ga0495676_0039876_1281_2513
Length 410
Sequence MLTDSTLDATHSSQVDGGRAPCRVAHLTSAHPRNDARIFVKQCRTLAAHGYRVELIVADGKGDACQDGVAIHDVGVLAGRLKRIFRTTSRVMRKAVELDADIYQLHDPELIPIGLQLKRLGKAVIFDSHEDVPTQLLAKPYLDPVSRRVLAASFSVYERFACARFDGVIAATSTIRDKFMQVNRNTVEVTNYPIIAEFDDAISWEDKTAEVCYVGGITAIRGIRELVRACSLLKSPARLALAGQFSDPDLQPELSAMPGWERVTTHGVLDRVGVRQVMRRAMAGLVTLHPVANYLDALPVKMFEYMAAGIPVIGSCFPLWRDIIDSAGCGVCVDPLDPGAIAAAIDLIVNNPGIARSMGENGRRAVREKYNWSAQAAKLIDFYGAISDARKPVAAGLPRAMAARQVGGIT

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
19 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
20 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
21 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
22 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
23 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
24 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
25 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
26 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
27 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
28 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
29 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
30 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
31 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
32 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
33 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
34 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
35 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
36 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
37 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
38 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
39 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
40 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
41 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
44 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
45 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
46 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
47 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
48 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
49 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
50 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
51 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
52 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
53 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
54 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
57 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
58 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
59 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
64 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
65 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
66 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
67 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
71 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
72 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
73 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
81 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
82 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
83 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
86 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
87 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
98 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 2643221556 Massilia sp. Root1485 Isolate Unclassified
104 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
105 2643221684 Massilia sp. Root133 Isolate Unclassified
106 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
107 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 2.43
Rhizosphere 90.28
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0039876 3300047321 Bacteria 3884
2 rootH1_10042000 3300003323 Bacteria 29725
3 rootH1_10128287 3300003323 Unclassified 1856
4 JGI25407J50210_10009957 3300003373 Bacteria 2414
5 Ga0065165_1001661 3300005262 Bacteria 22512
6 Ga0065165_1001883 3300005262 Bacteria 20264
7 Ga0070669_100000484 3300005353 Bacteria 30243
8 Ga0070705_100000890 3300005440 Bacteria 16672
9 Ga0070694_100004568 3300005444 Bacteria 8324
10 Ga0070698_100094619 3300005471 Bacteria 2966
11 Ga0070697_100011978 3300005536 Bacteria 6788
12 Ga0070696_100005327 3300005546 Bacteria 8584
13 Ga0070704_100013112 3300005549 Bacteria 5134
14 Ga0081538_10001118 3300005981 Bacteria 28443
15 Ga0081538_10011218 3300005981 Bacteria 7278
16 Ga0105250_10002571 3300009092 Bacteria 9057
17 Ga0157372_10655238 3300013307 Bacteria 1223
18 Ga0209025_1000125 3300025294 Bacteria 201444
19 Ga0207696_1002020 3300025711 Bacteria 10267
20 Ga0207681_10005197 3300025923 Bacteria 7993
21 Ga0395900_0118507 3300037418 Bacteria 2717
22 Ga0395901_0036567 3300038443 Bacteria 5076
23 Ga0450904_000408 3300042139 Bacteria 8771
24 Ga0466982_0015859 3300044672 Bacteria 4142
25 Ga0466970_0077006 3300044765 Bacteria 1798
26 Ga0466959_0031670 3300045049 Bacteria 3913
27 Ga0466967_0257511 3300045976 Bacteria 1669
28 Ga0495603_0014945 3300046455 Bacteria 4694
29 Ga0495603_0060362 3300046455 Bacteria 2240
30 Ga0495590_0000080 3300046457 Bacteria 63569
31 Ga0495591_000043 3300046458 Bacteria 148885
32 Ga0495591_011901 3300046458 Bacteria 3267
33 Ga0495629_0008077 3300046459 Bacteria 7746
34 Ga0495629_0185207 3300046459 Bacteria 1442
35 Ga0495653_0009772 3300046463 Bacteria 7842
36 Ga0495582_0004700 3300046473 Bacteria 7678
37 Ga0495605_0000236 3300046474 Bacteria 67212
38 Ga0495584_0000209 3300046491 Bacteria 42070
39 Ga0495584_0004953 3300046491 Bacteria 7099
40 Ga0495584_0005336 3300046491 Bacteria 6811
41 Ga0495584_0009240 3300046491 Bacteria 5082
42 Ga0495584_0011164 3300046491 Bacteria 4605
43 Ga0495584_0017313 3300046491 Bacteria 3670
44 Ga0495584_0029857 3300046491 Bacteria 2762
45 Ga0495585_0000699 3300046492 Bacteria 30438
46 Ga0495585_0005540 3300046492 Bacteria 7945
47 Ga0495585_0007854 3300046492 Bacteria 6490
48 Ga0495585_0009145 3300046492 Bacteria 5963
49 Ga0495585_0010292 3300046492 Bacteria 5577
50 Ga0495585_0012950 3300046492 Bacteria 4899
51 Ga0495585_0101027 3300046492 Bacteria 1542
52 Ga0495594_0002110 3300046499 Bacteria 10356
53 Ga0495594_0007435 3300046499 Bacteria 5634
54 Ga0495594_0012874 3300046499 Bacteria 4361
55 Ga0495596_0002357 3300046500 Bacteria 10222
56 Ga0495596_0005418 3300046500 Bacteria 6030
57 Ga0495596_0007553 3300046500 Bacteria 4899
58 Ga0495596_0023343 3300046500 Bacteria 2510
59 Ga0495596_0057377 3300046500 Bacteria 1519
60 Ga0495607_0002903 3300046501 Bacteria 13518
61 Ga0495607_0017302 3300046501 Bacteria 4629
62 Ga0495607_0023620 3300046501 Bacteria 3845
63 Ga0495607_0036680 3300046501 Bacteria 2951
64 Ga0495583_0000217 3300046506 Bacteria 96747
65 Ga0495583_0000560 3300046506 Bacteria 51454
66 Ga0495583_0000654 3300046506 Bacteria 45704
67 Ga0495583_0002314 3300046506 Bacteria 16601
68 Ga0495583_0006148 3300046506 Bacteria 7911
69 Ga0495583_0018126 3300046506 Bacteria 3715
70 Ga0495583_0062139 3300046506 Bacteria 1664
71 Ga0495606_0012259 3300046507 Bacteria 6896
72 Ga0495606_0078945 3300046507 Bacteria 2051
73 Ga0495610_0002972 3300046512 Bacteria 13676
74 Ga0495616_0000126 3300046513 Bacteria 66696
75 Ga0495616_0007124 3300046513 Bacteria 6713
76 Ga0495616_0022135 3300046513 Bacteria 3434
77 Ga0495616_0024821 3300046513 Bacteria 3209
78 Ga0495631_0003121 3300046518 Bacteria 9129
79 Ga0495631_0006140 3300046518 Bacteria 6227
80 Ga0495631_0009230 3300046518 Bacteria 4936
81 Ga0495631_0010465 3300046518 Bacteria 4586
82 Ga0495631_0015076 3300046518 Bacteria 3713
83 Ga0495632_0005128 3300046519 Bacteria 8745
84 Ga0495632_0046867 3300046519 Bacteria 2146
85 Ga0495637_0000009 3300046520 Bacteria 402028
86 Ga0495637_0008488 3300046520 Bacteria 5043
87 Ga0495637_0009429 3300046520 Bacteria 4762
88 Ga0495643_0000171 3300046522 Bacteria 103167
89 Ga0495643_0003127 3300046522 Bacteria 12350
90 Ga0495643_0005094 3300046522 Bacteria 8989
91 Ga0495643_0086497 3300046522 Bacteria 1623
92 Ga0495643_0087773 3300046522 Bacteria 1609
93 Ga0495644_0001444 3300046523 Bacteria 9714
94 Ga0495644_0005234 3300046523 Bacteria 5072
95 Ga0495644_0016469 3300046523 Bacteria 2829
96 Ga0495644_0040600 3300046523 Bacteria 1753
97 Ga0495644_0053938 3300046523 Bacteria 1510
98 Ga0495648_0019909 3300046524 Bacteria 4698
99 Ga0495648_0062465 3300046524 Bacteria 2205
100 Ga0495663_0002764 3300046525 Bacteria 5196
101 Ga0495663_0006637 3300046525 Bacteria 3192
102 Ga0495666_0000106 3300046526 Bacteria 33981
103 Ga0495666_0016737 3300046526 Bacteria 3650
104 Ga0495642_0003814 3300046528 Bacteria 5909
105 Ga0495642_0005141 3300046528 Bacteria 5035
106 Ga0495642_0010010 3300046528 Bacteria 3632
107 Ga0495642_0015868 3300046528 Bacteria 2932
108 Ga0495642_0066321 3300046528 Bacteria 1504
109 Ga0495665_0013372 3300046531 Bacteria 4439
110 Ga0495665_0022676 3300046531 Bacteria 3374
111 Ga0495586_0001613 3300046535 Bacteria 12367
112 Ga0495609_0010915 3300046538 Bacteria 4340
113 Ga0495609_0018879 3300046538 Bacteria 3193
114 Ga0495609_0024441 3300046538 Bacteria 2772
115 Ga0495597_0000609 3300046542 Bacteria 29320
116 Ga0495597_0004754 3300046542 Bacteria 7347
117 Ga0495597_0006963 3300046542 Bacteria 5795
118 Ga0495597_0023276 3300046542 Bacteria 2866
119 Ga0495597_0081158 3300046542 Bacteria 1387
120 Ga0495622_0014231 3300046557 Bacteria 3694
121 Ga0495622_0041769 3300046557 Bacteria 2132
122 Ga0495622_0075743 3300046557 Bacteria 1550
123 Ga0495633_0003854 3300046558 Bacteria 9804
124 Ga0495633_0009154 3300046558 Bacteria 5496
125 Ga0495656_0000668 3300046615 Bacteria 10984
126 Ga0495656_0006667 3300046615 Bacteria 4053
127 Ga0495668_0001547 3300046616 Bacteria 21809
128 Ga0495668_0010013 3300046616 Bacteria 5773
129 Ga0495668_0011947 3300046616 Bacteria 5171
130 Ga0495668_0056783 3300046616 Bacteria 2160
131 Ga0495668_0062955 3300046616 Bacteria 2043
132 Ga0495634_0145418 3300046642 Bacteria 1502
133 Ga0495611_0000202 3300046648 Bacteria 41897
134 Ga0495611_0001553 3300046648 Bacteria 11268
135 Ga0495611_0007657 3300046648 Bacteria 4586
136 Ga0495625_0009014 3300046660 Bacteria 8427
137 Ga0495625_0018500 3300046660 Bacteria 5438
138 Ga0495661_0000882 3300046665 Bacteria 27670
139 Ga0495661_0000956 3300046665 Bacteria 26186
140 Ga0495661_0003872 3300046665 Bacteria 10935
141 Ga0495661_0012908 3300046665 Bacteria 5628
142 Ga0495661_0013476 3300046665 Bacteria 5489
143 Ga0495661_0023114 3300046665 Bacteria 4039
144 Ga0495661_0025568 3300046665 Bacteria 3812
145 Ga0495661_0041860 3300046665 Bacteria 2830
146 Ga0495661_0074763 3300046665 Bacteria 1971
147 Ga0495661_0074902 3300046665 Bacteria 1968
148 Ga0495661_0092084 3300046665 Bacteria 1723
149 Ga0495588_0014201 3300046674 Bacteria 3808
150 Ga0495588_0015128 3300046674 Bacteria 3706
151 Ga0495658_0026765 3300046683 Bacteria 3095
152 Ga0495669_0000206 3300046684 Bacteria 35834
153 Ga0495669_0001732 3300046684 Bacteria 8935
154 Ga0495669_0001820 3300046684 Bacteria 8715
155 Ga0495669_0003013 3300046684 Bacteria 6919
156 Ga0495669_0014117 3300046684 Bacteria 3414
157 Ga0495613_0010629 3300046689 Bacteria 6828
158 Ga0495670_0000317 3300046691 Bacteria 22950
159 Ga0495670_0029378 3300046691 Bacteria 2728
160 Ga0495671_0001158 3300046692 Bacteria 18096
161 Ga0495671_0040768 3300046692 Bacteria 2340
162 Ga0495649_0000363 3300046694 Bacteria 39271
163 Ga0495649_0002610 3300046694 Bacteria 12574
164 Ga0495649_0013605 3300046694 Bacteria 4690
165 Ga0495649_0015921 3300046694 Bacteria 4271
166 Ga0495649_0043414 3300046694 Bacteria 2454
167 Ga0495649_0080912 3300046694 Bacteria 1737
168 Ga0495589_0000427 3300046794 Bacteria 31241
169 Ga0495589_0001642 3300046794 Bacteria 12803
170 Ga0495589_0022348 3300046794 Bacteria 3227
171 Ga0495660_0000173 3300046810 Bacteria 69912
172 Ga0495660_0009524 3300046810 Bacteria 5661
173 Ga0495660_0013161 3300046810 Bacteria 4794
174 Ga0495581_0014454 3300047315 Bacteria 4578
175 Ga0495604_0007876 3300047317 Bacteria 8438
176 Ga0495604_0056103 3300047317 Bacteria 3034
177 Ga0495604_0120466 3300047317 Bacteria 1900
178 Ga0495636_0011036 3300047318 Bacteria 3575
179 Ga0495674_0014467 3300047319 Bacteria 7385
180 Ga0495672_0000055 3300047320 Bacteria 229428
181 Ga0495672_0002856 3300047320 Bacteria 15354
182 Ga0495672_0006391 3300047320 Bacteria 9149
183 Ga0495672_0021789 3300047320 Bacteria 4174
184 Ga0495672_0058129 3300047320 Bacteria 2243
185 Ga0495676_0000100 3300047321 Bacteria 65339
186 Ga0495676_0098894 3300047321 Bacteria 2163
187 Ga0495680_0005852 3300047322 Bacteria 11511
188 Ga0495683_0000240 3300047323 Bacteria 49829
189 Ga0495683_0033508 3300047323 Bacteria 2613
190 Ga0495683_0075513 3300047323 Bacteria 1650
191 Ga0495687_000012 3300047443 Bacteria 391586
192 Ga0495687_000279 3300047443 Bacteria 67230
193 Ga0495675_0003407 3300047444 Bacteria 9577
194 Ga0495677_0000724 3300047445 Bacteria 13307
195 Ga0495677_0000800 3300047445 Bacteria 12710
196 Ga0495677_0001012 3300047445 Bacteria 11316
197 Ga0495677_0003727 3300047445 Bacteria 5900
198 Ga0495677_0006795 3300047445 Bacteria 4304
199 Ga0495677_0019084 3300047445 Bacteria 2487
200 Ga0495679_020464 3300047446 Bacteria 2304
201 Ga0495679_031099 3300047446 Bacteria 1725
202 Ga0495685_012173 3300047447 Bacteria 2912
203 Ga0495685_017482 3300047447 Bacteria 2456
204 Ga0495681_0000251 3300047470 Bacteria 43835
205 Ga0495681_0000807 3300047470 Bacteria 24161
206 Ga0495681_0022027 3300047470 Bacteria 3419
207 Ga0495686_0000474 3300047472 Bacteria 59917
208 Ga0495593_0001135 3300047673 Bacteria 15510
209 Ga0495614_0002240 3300048089 Bacteria 8579
210 Ga0495614_0010057 3300048089 Bacteria 4175
211 Ga0495626_0000386 3300048091 Bacteria 45608
212 Ga0495626_0000879 3300048091 Bacteria 26620
213 Ga0495626_0001211 3300048091 Bacteria 21303
214 Ga0495626_0002189 3300048091 Bacteria 14036
215 Ga0495626_0005046 3300048091 Bacteria 7877
216 Ga0495626_0014846 3300048091 Bacteria 4003
217 Ga0495626_0020519 3300048091 Bacteria 3290
218 Ga0495626_0055338 3300048091 Bacteria 1818
219 Ga0495626_0078726 3300048091 Bacteria 1468
220 Ga0496102_0000598 3300048905 Bacteria 37839
221 Ga0496102_0144881 3300048905 Bacteria 2229
222 Ga0496103_0018953 3300048906 Bacteria 4132
223 Ga0496109_0003716 3300048912 Bacteria 12751
224 Ga0496113_0000875 3300048916 Bacteria 15804
225 Ga0496115_0008818 3300048918 Bacteria 7472
226 Ga0496122_0000452 3300048925 Bacteria 85514
227 Ga0496122_0015698 3300048925 Bacteria 7221
228 Ga0496123_0000514 3300048926 Bacteria 67374
229 Ga0496123_0003216 3300048926 Bacteria 18608
230 Ga0496124_0003443 3300048927 Bacteria 19359
231 Ga0496124_0046960 3300048927 Bacteria 3696
232 Ga0496124_0186944 3300048927 Bacteria 1589
233 Ga0496125_0000572 3300048928 Bacteria 63057
234 Ga0495678_000025 3300049459 Bacteria 227891
235 Ga0495678_007222 3300049459 Bacteria 5787
236 Ga0495678_008696 3300049459 Bacteria 5097
237 Ga0495682_0002058 3300049460 Bacteria 9849
238 Ga0495682_0007346 3300049460 Bacteria 4394
239 Ga0501042_0076459 3300049578 Unclassified 2397
240 Ga0501046_0097242 3300049580 Unclassified 2262
241 Ga0501048_0209777 3300049582 Bacteria 1382
242 nmdc:mga0n895_369938_c1 3300050512 Bacteria 1451
243 2643802824 2643221556 Bacteria 7251154
244 2644027238 2643221603 Bacteria 6147767
245 2644472329 2643221684 Bacteria 7145183
246 2857595030 2857591370 Bacteria 6569758
247 8047678575 8047673197 Bacteria 7395230
248 Ga0495676_0039876
249 rootH1_10042000
250 rootH1_10128287
251 JGI25407J50210_10009957
252 Ga0065165_1001661
253 Ga0065165_1001883
254 Ga0070669_100000484
255 Ga0070705_100000890
256 Ga0070694_100004568
257 Ga0070698_100094619
258 Ga0070697_100011978
259 Ga0070696_100005327
260 Ga0070704_100013112
261 Ga0081538_10001118
262 Ga0081538_10011218
263 Ga0105250_10002571
264 Ga0157372_10655238
265 Ga0209025_1000125
266 Ga0207696_1002020
267 Ga0207681_10005197
268 Ga0395900_0118507
269 Ga0395901_0036567
270 Ga0450904_000408
271 Ga0466982_0015859
272 Ga0466970_0077006
273 Ga0466959_0031670
274 Ga0466967_0257511
275 Ga0495603_0014945
276 Ga0495603_0060362
277 Ga0495590_0000080
278 Ga0495591_000043
279 Ga0495591_011901
280 Ga0495629_0008077
281 Ga0495629_0185207
282 Ga0495653_0009772
283 Ga0495582_0004700
284 Ga0495605_0000236
285 Ga0495584_0000209
286 Ga0495584_0004953
287 Ga0495584_0005336
288 Ga0495584_0009240
289 Ga0495584_0011164
290 Ga0495584_0017313
291 Ga0495584_0029857
292 Ga0495585_0000699
293 Ga0495585_0005540
294 Ga0495585_0007854
295 Ga0495585_0009145
296 Ga0495585_0010292
297 Ga0495585_0012950
298 Ga0495585_0101027
299 Ga0495594_0002110
300 Ga0495594_0007435
301 Ga0495594_0012874
302 Ga0495596_0002357
303 Ga0495596_0005418
304 Ga0495596_0007553
305 Ga0495596_0023343
306 Ga0495596_0057377
307 Ga0495607_0002903
308 Ga0495607_0017302
309 Ga0495607_0023620
310 Ga0495607_0036680
311 Ga0495583_0000217
312 Ga0495583_0000560
313 Ga0495583_0000654
314 Ga0495583_0002314
315 Ga0495583_0006148
316 Ga0495583_0018126
317 Ga0495583_0062139
318 Ga0495606_0012259
319 Ga0495606_0078945
320 Ga0495610_0002972
321 Ga0495616_0000126
322 Ga0495616_0007124
323 Ga0495616_0022135
324 Ga0495616_0024821
325 Ga0495631_0003121
326 Ga0495631_0006140
327 Ga0495631_0009230
328 Ga0495631_0010465
329 Ga0495631_0015076
330 Ga0495632_0005128
331 Ga0495632_0046867
332 Ga0495637_0000009
333 Ga0495637_0008488
334 Ga0495637_0009429
335 Ga0495643_0000171
336 Ga0495643_0003127
337 Ga0495643_0005094
338 Ga0495643_0086497
339 Ga0495643_0087773
340 Ga0495644_0001444
341 Ga0495644_0005234
342 Ga0495644_0016469
343 Ga0495644_0040600
344 Ga0495644_0053938
345 Ga0495648_0019909
346 Ga0495648_0062465
347 Ga0495663_0002764
348 Ga0495663_0006637
349 Ga0495666_0000106
350 Ga0495666_0016737
351 Ga0495642_0003814
352 Ga0495642_0005141
353 Ga0495642_0010010
354 Ga0495642_0015868
355 Ga0495642_0066321
356 Ga0495665_0013372
357 Ga0495665_0022676
358 Ga0495586_0001613
359 Ga0495609_0010915
360 Ga0495609_0018879
361 Ga0495609_0024441
362 Ga0495597_0000609
363 Ga0495597_0004754
364 Ga0495597_0006963
365 Ga0495597_0023276
366 Ga0495597_0081158
367 Ga0495622_0014231
368 Ga0495622_0041769
369 Ga0495622_0075743
370 Ga0495633_0003854
371 Ga0495633_0009154
372 Ga0495656_0000668
373 Ga0495656_0006667
374 Ga0495668_0001547
375 Ga0495668_0010013
376 Ga0495668_0011947
377 Ga0495668_0056783
378 Ga0495668_0062955
379 Ga0495634_0145418
380 Ga0495611_0000202
381 Ga0495611_0001553
382 Ga0495611_0007657
383 Ga0495625_0009014
384 Ga0495625_0018500
385 Ga0495661_0000882
386 Ga0495661_0000956
387 Ga0495661_0003872
388 Ga0495661_0012908
389 Ga0495661_0013476
390 Ga0495661_0023114
391 Ga0495661_0025568
392 Ga0495661_0041860
393 Ga0495661_0074763
394 Ga0495661_0074902
395 Ga0495661_0092084
396 Ga0495588_0014201
397 Ga0495588_0015128
398 Ga0495658_0026765
399 Ga0495669_0000206
400 Ga0495669_0001732
401 Ga0495669_0001820
402 Ga0495669_0003013
403 Ga0495669_0014117
404 Ga0495613_0010629
405 Ga0495670_0000317
406 Ga0495670_0029378
407 Ga0495671_0001158
408 Ga0495671_0040768
409 Ga0495649_0000363
410 Ga0495649_0002610
411 Ga0495649_0013605
412 Ga0495649_0015921
413 Ga0495649_0043414
414 Ga0495649_0080912
415 Ga0495589_0000427
416 Ga0495589_0001642
417 Ga0495589_0022348
418 Ga0495660_0000173
419 Ga0495660_0009524
420 Ga0495660_0013161
421 Ga0495581_0014454
422 Ga0495604_0007876
423 Ga0495604_0056103
424 Ga0495604_0120466
425 Ga0495636_0011036
426 Ga0495674_0014467
427 Ga0495672_0000055
428 Ga0495672_0002856
429 Ga0495672_0006391
430 Ga0495672_0021789
431 Ga0495672_0058129
432 Ga0495676_0000100
433 Ga0495676_0098894
434 Ga0495680_0005852
435 Ga0495683_0000240
436 Ga0495683_0033508
437 Ga0495683_0075513
438 Ga0495687_000012
439 Ga0495687_000279
440 Ga0495675_0003407
441 Ga0495677_0000724
442 Ga0495677_0000800
443 Ga0495677_0001012
444 Ga0495677_0003727
445 Ga0495677_0006795
446 Ga0495677_0019084
447 Ga0495679_020464
448 Ga0495679_031099
449 Ga0495685_012173
450 Ga0495685_017482
451 Ga0495681_0000251
452 Ga0495681_0000807
453 Ga0495681_0022027
454 Ga0495686_0000474
455 Ga0495593_0001135
456 Ga0495614_0002240
457 Ga0495614_0010057
458 Ga0495626_0000386
459 Ga0495626_0000879
460 Ga0495626_0001211
461 Ga0495626_0002189
462 Ga0495626_0005046
463 Ga0495626_0014846
464 Ga0495626_0020519
465 Ga0495626_0055338
466 Ga0495626_0078726
467 Ga0496102_0000598
468 Ga0496102_0144881
469 Ga0496103_0018953
470 Ga0496109_0003716
471 Ga0496113_0000875
472 Ga0496115_0008818
473 Ga0496122_0000452
474 Ga0496122_0015698
475 Ga0496123_0000514
476 Ga0496123_0003216
477 Ga0496124_0003443
478 Ga0496124_0046960
479 Ga0496124_0186944
480 Ga0496125_0000572
481 Ga0495678_000025
482 Ga0495678_007222
483 Ga0495678_008696
484 Ga0495682_0002058
485 Ga0495682_0007346
486 Ga0501042_0076459
487 Ga0501046_0097242
488 Ga0501048_0209777
489 nmdc:mga0n895_369938_c1
490 2643802824
491 2644027238
492 2644472329
493 2857595030
494 8047678575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

195

365

0.89

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

36

194

0.86

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

208

351

0.84

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

221

381

0.8

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

36

193

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8433 185 342
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8387 185 342
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8185 185 342
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.814 185 342
3c4q-assembly2.cif.gz_B structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.7784 1 365
ID Description Score Start End Superfamily
af_Q2G1K0_190_352_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8831 182 340 3.40.50.2000
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8756 183 339 3.40.50.2000
af_Q2G1K0_190_352_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8583 182 340 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.856 184 337 3.40.50.2000
3okaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.854 185 341 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A524AWY4-F1-model_v4 Glycosyltransferase WbuB 0.9508 2 364 GO:0016758
AF-A0A4Q5RS49-F1-model_v4 Glycosyltransferase 0.9478 3 364 GO:0016758
AF-A0A7V6RIJ3-F1-model_v4 Glycosyltransferase 0.947 2 364 GO:0016757
AF-A0A524AWY4-F1-model_v4 Glycosyltransferase WbuB 0.9432 2 364 GO:0016758
AF-A0A235BZL1-F1-model_v4 Uncharacterized protein 0.9407 2 365 GO:0016757

Map