F359092
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 247 | 160 | 247 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10286615|Ga0207648_102866152 |
| Length | 317 |
| Sequence | VKCGRRGVAFWLSPQINESVCREPPRPPALLQNVKRYDSIKTMRVHFRCAVWTVIACLGASLSVRAQWLNQPMAGAPRTPDGKINMTAPVPMLNGKPDLSGIWQVQAEPRAPGGLFGLGESPNSRYFRDILSDFKPDERPLTPAGADLLRRHSQPGVFNPSLNCLPDGVPHGDLLPEPFKIIHSRGVIVMLYEVETTFRQIFMDGRKLPVDPSRTWQGYSVGRWEGDTLVVDTTGFNDLSWLDARGTGHSEEMRVEERFLRRDYGHLELTITVVDPKTFTRPITFTVVEELLPDTDLFEHYCLENEKDAAHQPLKGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 117 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.21 |
| Rhizosphere | 98.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10073797 | 3300005327 | Bacteria | 2798 |
| 2 | Ga0070683_100308004 | 3300005329 | Unclassified | 1507 |
| 3 | Ga0070670_100033138 | 3300005331 | Bacteria | 4449 |
| 4 | Ga0068869_100136634 | 3300005334 | Bacteria | 1889 |
| 5 | Ga0070666_10143512 | 3300005335 | Bacteria | 1663 |
| 6 | Ga0070689_100522430 | 3300005340 | Bacteria | 1019 |
| 7 | Ga0070661_100034142 | 3300005344 | Bacteria | 3689 |
| 8 | Ga0070661_100109998 | 3300005344 | Bacteria | 2057 |
| 9 | Ga0070692_10037049 | 3300005345 | Unclassified | 2478 |
| 10 | Ga0070669_100023869 | 3300005353 | Unclassified | 4382 |
| 11 | Ga0070669_100147423 | 3300005353 | Bacteria | 1819 |
| 12 | Ga0070675_100001559 | 3300005354 | Bacteria | 16935 |
| 13 | Ga0070675_100241201 | 3300005354 | Bacteria | 1579 |
| 14 | Ga0070674_100007122 | 3300005356 | Bacteria | 6578 |
| 15 | Ga0070673_100074297 | 3300005364 | Bacteria | 2739 |
| 16 | Ga0070673_100185519 | 3300005364 | Bacteria | 1783 |
| 17 | Ga0070688_100003798 | 3300005365 | Bacteria | 7828 |
| 18 | Ga0070688_100225171 | 3300005365 | Bacteria | 1324 |
| 19 | Ga0070667_100232063 | 3300005367 | Bacteria | 1646 |
| 20 | Ga0070709_10212524 | 3300005434 | Bacteria | 1376 |
| 21 | Ga0070711_100236234 | 3300005439 | Bacteria | 1427 |
| 22 | Ga0070700_100042526 | 3300005441 | Unclassified | 2790 |
| 23 | Ga0070708_100014817 | 3300005445 | Bacteria | 6426 |
| 24 | Ga0070678_100020502 | 3300005456 | Bacteria | 4338 |
| 25 | Ga0070681_10039981 | 3300005458 | Bacteria | 4702 |
| 26 | Ga0068867_100048561 | 3300005459 | Bacteria | 3123 |
| 27 | Ga0068867_100150739 | 3300005459 | Bacteria | 1826 |
| 28 | Ga0070685_10198613 | 3300005466 | Unclassified | 1302 |
| 29 | Ga0070699_100049198 | 3300005518 | Bacteria | 3649 |
| 30 | Ga0070672_100150815 | 3300005543 | Bacteria | 1923 |
| 31 | Ga0070686_100219360 | 3300005544 | Bacteria | 1373 |
| 32 | Ga0070704_100205459 | 3300005549 | Unclassified | 1593 |
| 33 | Ga0068855_100012829 | 3300005563 | Bacteria | 10110 |
| 34 | Ga0068855_100435600 | 3300005563 | Unclassified | 1432 |
| 35 | Ga0070664_100011610 | 3300005564 | Bacteria | 7146 |
| 36 | Ga0070664_100356473 | 3300005564 | Bacteria | 1331 |
| 37 | Ga0068857_100015444 | 3300005577 | Bacteria | 6669 |
| 38 | Ga0068852_100380915 | 3300005616 | Bacteria | 1384 |
| 39 | Ga0068859_100514199 | 3300005617 | Bacteria | 1292 |
| 40 | Ga0068864_100041365 | 3300005618 | Bacteria | 3942 |
| 41 | Ga0068861_100036220 | 3300005719 | Bacteria | 3660 |
| 42 | Ga0068870_10060079 | 3300005840 | Bacteria | 2040 |
| 43 | Ga0068858_100029215 | 3300005842 | Bacteria | 5118 |
| 44 | Ga0068860_100020778 | 3300005843 | Bacteria | 6360 |
| 45 | Ga0068862_100021674 | 3300005844 | Bacteria | 5373 |
| 46 | Ga0081539_10000285 | 3300005985 | Bacteria | 114370 |
| 47 | Ga0081539_10008879 | 3300005985 | Bacteria | 8586 |
| 48 | Ga0070717_10027930 | 3300006028 | Unclassified | 4512 |
| 49 | Ga0070717_10051841 | 3300006028 | Bacteria | 3378 |
| 50 | Ga0068871_100011018 | 3300006358 | Bacteria | 6626 |
| 51 | Ga0068871_100141229 | 3300006358 | Unclassified | 2048 |
| 52 | Ga0075428_100007944 | 3300006844 | Bacteria | 11766 |
| 53 | Ga0075430_100080721 | 3300006846 | Bacteria | 2724 |
| 54 | Ga0075431_100000646 | 3300006847 | Bacteria | 29552 |
| 55 | Ga0075431_100191146 | 3300006847 | Bacteria | 2097 |
| 56 | Ga0075433_10001205 | 3300006852 | Bacteria | 18840 |
| 57 | Ga0075433_10014476 | 3300006852 | Bacteria | 6444 |
| 58 | Ga0075433_10399469 | 3300006852 | Unclassified | 1213 |
| 59 | Ga0075434_100000561 | 3300006871 | Bacteria | 28555 |
| 60 | Ga0075429_100001853 | 3300006880 | Bacteria | 17516 |
| 61 | Ga0068865_100076088 | 3300006881 | Bacteria | 2395 |
| 62 | Ga0097620_100514173 | 3300006931 | Bacteria | 1292 |
| 63 | Ga0075435_100026299 | 3300007076 | Unclassified | 4538 |
| 64 | Ga0105240_10025370 | 3300009093 | Bacteria | 7790 |
| 65 | Ga0105240_10079637 | 3300009093 | Bacteria | 4031 |
| 66 | Ga0111539_10001859 | 3300009094 | Bacteria | 28033 |
| 67 | Ga0111539_10075015 | 3300009094 | Bacteria | 3985 |
| 68 | Ga0111539_10260659 | 3300009094 | Bacteria | 2018 |
| 69 | Ga0111539_10946899 | 3300009094 | Bacteria | 1001 |
| 70 | Ga0105245_10016786 | 3300009098 | Bacteria | 6392 |
| 71 | Ga0105245_10033480 | 3300009098 | Bacteria | 4556 |
| 72 | Ga0105245_10666729 | 3300009098 | Bacteria | 1071 |
| 73 | Ga0105247_10016956 | 3300009101 | Unclassified | 4369 |
| 74 | Ga0114129_10070863 | 3300009147 | Unclassified | 4860 |
| 75 | Ga0114129_10094418 | 3300009147 | Unclassified | 4142 |
| 76 | Ga0105242_10018990 | 3300009176 | Bacteria | 5384 |
| 77 | Ga0105242_10025213 | 3300009176 | Bacteria | 4703 |
| 78 | Ga0105242_10286948 | 3300009176 | Unclassified | 1497 |
| 79 | Ga0105248_10018613 | 3300009177 | Bacteria | 7678 |
| 80 | Ga0105248_10023579 | 3300009177 | Bacteria | 6836 |
| 81 | Ga0105248_10258168 | 3300009177 | Bacteria | 1962 |
| 82 | Ga0105248_10298231 | 3300009177 | Bacteria | 1815 |
| 83 | Ga0105248_10392777 | 3300009177 | Bacteria | 1562 |
| 84 | Ga0105237_10011447 | 3300009545 | Bacteria | 9384 |
| 85 | Ga0105237_10906951 | 3300009545 | Bacteria | 888 |
| 86 | Ga0105238_10154660 | 3300009551 | Unclassified | 2268 |
| 87 | Ga0105249_10029251 | 3300009553 | Unclassified | 4975 |
| 88 | Ga0105249_10031356 | 3300009553 | Bacteria | 4807 |
| 89 | Ga0105239_10010768 | 3300010375 | Bacteria | 10217 |
| 90 | Ga0105246_10038869 | 3300011119 | Bacteria | 3202 |
| 91 | Ga0105246_10057601 | 3300011119 | Bacteria | 2689 |
| 92 | Ga0105246_10238385 | 3300011119 | Unclassified | 1437 |
| 93 | Ga0157370_10001504 | 3300013104 | Bacteria | 28790 |
| 94 | Ga0157370_10002991 | 3300013104 | Bacteria | 20085 |
| 95 | Ga0157374_10015689 | 3300013296 | Bacteria | 6650 |
| 96 | Ga0157374_10145927 | 3300013296 | Unclassified | 2298 |
| 97 | Ga0163162_10010669 | 3300013306 | Bacteria | 8934 |
| 98 | Ga0163162_10044253 | 3300013306 | Bacteria | 4458 |
| 99 | Ga0163162_10076114 | 3300013306 | Bacteria | 3418 |
| 100 | Ga0163162_10103415 | 3300013306 | Bacteria | 2942 |
| 101 | Ga0157372_10018269 | 3300013307 | Bacteria | 7536 |
| 102 | Ga0157375_10031235 | 3300013308 | Bacteria | 5030 |
| 103 | Ga0157375_10069163 | 3300013308 | Bacteria | 3536 |
| 104 | Ga0157375_10155516 | 3300013308 | Bacteria | 2425 |
| 105 | Ga0157375_10158544 | 3300013308 | Unclassified | 2404 |
| 106 | Ga0157375_10241587 | 3300013308 | Bacteria | 1966 |
| 107 | Ga0157375_10359159 | 3300013308 | Bacteria | 1623 |
| 108 | Ga0163163_10018223 | 3300014325 | Bacteria | 6567 |
| 109 | Ga0163163_10058596 | 3300014325 | Bacteria | 3808 |
| 110 | Ga0163163_10181053 | 3300014325 | Bacteria | 2155 |
| 111 | Ga0157380_10018043 | 3300014326 | Bacteria | 5234 |
| 112 | Ga0157379_10016206 | 3300014968 | Bacteria | 6557 |
| 113 | Ga0157379_10045212 | 3300014968 | Bacteria | 3931 |
| 114 | Ga0157376_10004354 | 3300014969 | Bacteria | 9846 |
| 115 | Ga0157376_10034139 | 3300014969 | Bacteria | 4105 |
| 116 | Ga0157376_10098692 | 3300014969 | Bacteria | 2546 |
| 117 | Ga0157376_10478899 | 3300014969 | Unclassified | 1219 |
| 118 | Ga0157376_10514622 | 3300014969 | Bacteria | 1178 |
| 119 | Ga0163161_10206536 | 3300017792 | Bacteria | 1515 |
| 120 | Ga0207673_1007317 | 3300025290 | Bacteria | 1382 |
| 121 | Ga0207682_10009615 | 3300025893 | Unclassified | 3811 |
| 122 | Ga0207682_10101309 | 3300025893 | Bacteria | 1259 |
| 123 | Ga0207688_10061927 | 3300025901 | Bacteria | 2109 |
| 124 | Ga0207688_10099355 | 3300025901 | Bacteria | 1679 |
| 125 | Ga0207705_10074467 | 3300025909 | Bacteria | 2465 |
| 126 | Ga0207707_10026825 | 3300025912 | Bacteria | 5034 |
| 127 | Ga0207695_10014870 | 3300025913 | Bacteria | 9188 |
| 128 | Ga0207649_10019938 | 3300025920 | Bacteria | 3839 |
| 129 | Ga0207649_10101379 | 3300025920 | Bacteria | 1906 |
| 130 | Ga0207652_10099941 | 3300025921 | Bacteria | 2560 |
| 131 | Ga0207646_10202570 | 3300025922 | Bacteria | 1793 |
| 132 | Ga0207681_10113982 | 3300025923 | Bacteria | 1971 |
| 133 | Ga0207681_10146763 | 3300025923 | Bacteria | 1763 |
| 134 | Ga0207694_10020239 | 3300025924 | Bacteria | 5031 |
| 135 | Ga0207694_10082139 | 3300025924 | Bacteria | 2532 |
| 136 | Ga0207694_10285155 | 3300025924 | Unclassified | 1357 |
| 137 | Ga0207650_10127190 | 3300025925 | Bacteria | 1990 |
| 138 | Ga0207650_10341485 | 3300025925 | Unclassified | 1230 |
| 139 | Ga0207659_10007448 | 3300025926 | Bacteria | 6730 |
| 140 | Ga0207687_10005396 | 3300025927 | Bacteria | 8454 |
| 141 | Ga0207687_10014462 | 3300025927 | Bacteria | 5164 |
| 142 | Ga0207687_10447802 | 3300025927 | Unclassified | 1070 |
| 143 | Ga0207706_10040847 | 3300025933 | Bacteria | 4112 |
| 144 | Ga0207686_10008561 | 3300025934 | Bacteria | 5528 |
| 145 | Ga0207686_10063723 | 3300025934 | Bacteria | 2345 |
| 146 | Ga0207670_10083015 | 3300025936 | Bacteria | 2246 |
| 147 | Ga0207669_10083213 | 3300025937 | Bacteria | 2057 |
| 148 | Ga0207704_10062396 | 3300025938 | Bacteria | 2317 |
| 149 | Ga0207665_10514260 | 3300025939 | Unclassified | 926 |
| 150 | Ga0207691_10057887 | 3300025940 | Bacteria | 3526 |
| 151 | Ga0207691_10084788 | 3300025940 | Bacteria | 2844 |
| 152 | Ga0207689_10054674 | 3300025942 | Unclassified | 3287 |
| 153 | Ga0207661_10168633 | 3300025944 | Bacteria | 1904 |
| 154 | Ga0207679_10007752 | 3300025945 | Bacteria | 6822 |
| 155 | Ga0207679_10076987 | 3300025945 | Bacteria | 2536 |
| 156 | Ga0207667_10843080 | 3300025949 | Unclassified | 911 |
| 157 | Ga0207651_10007553 | 3300025960 | Bacteria | 5799 |
| 158 | Ga0207651_10030560 | 3300025960 | Bacteria | 3432 |
| 159 | Ga0207712_10014099 | 3300025961 | Bacteria | 5130 |
| 160 | Ga0207712_10347602 | 3300025961 | Bacteria | 1232 |
| 161 | Ga0207668_10100065 | 3300025972 | Bacteria | 2152 |
| 162 | Ga0207658_10360430 | 3300025986 | Bacteria | 1268 |
| 163 | Ga0207677_10025811 | 3300026023 | Bacteria | 3672 |
| 164 | Ga0207703_10037907 | 3300026035 | Unclassified | 3843 |
| 165 | Ga0207678_10021218 | 3300026067 | Bacteria | 5694 |
| 166 | Ga0207708_10068773 | 3300026075 | Bacteria | 2710 |
| 167 | Ga0207702_10649051 | 3300026078 | Unclassified | 1038 |
| 168 | Ga0207641_10076209 | 3300026088 | Bacteria | 2899 |
| 169 | Ga0207648_10286615 | 3300026089 | Bacteria | 1474 |
| 170 | Ga0207648_10514320 | 3300026089 | Bacteria | 1096 |
| 171 | Ga0207648_10681460 | 3300026089 | Bacteria | 952 |
| 172 | Ga0207676_10091459 | 3300026095 | Unclassified | 2500 |
| 173 | Ga0207676_10663998 | 3300026095 | Unclassified | 1007 |
| 174 | Ga0207674_10057457 | 3300026116 | Bacteria | 3944 |
| 175 | Ga0207675_100103613 | 3300026118 | Bacteria | 2681 |
| 176 | Ga0207675_100125297 | 3300026118 | Bacteria | 2433 |
| 177 | Ga0207683_10006350 | 3300026121 | Bacteria | 10124 |
| 178 | Ga0207428_10000893 | 3300027907 | Bacteria | 33463 |
| 179 | Ga0207428_10030612 | 3300027907 | Bacteria | 4448 |
| 180 | Ga0268266_10051518 | 3300028379 | Bacteria | 3534 |
| 181 | Ga0268266_10085852 | 3300028379 | Bacteria | 2751 |
| 182 | Ga0268264_10416282 | 3300028381 | Bacteria | 1295 |
| 183 | Ga0373944_0023163 | 3300035089 | Bacteria | 1810 |
| 184 | Ga0373952_0061041 | 3300035092 | Bacteria | 922 |
| 185 | Ga0373923_0062149 | 3300035111 | Bacteria | 1588 |
| 186 | Ga0373932_0039102 | 3300035112 | Bacteria | 1359 |
| 187 | Ga0373956_0052039 | 3300035119 | Bacteria | 1841 |
| 188 | Ga0373943_0016041 | 3300035170 | Bacteria | 3411 |
| 189 | Ga0373946_0001093 | 3300035171 | Bacteria | 9369 |
| 190 | Ga0373955_0031171 | 3300035172 | Unclassified | 2792 |
| 191 | Ga0373955_0055184 | 3300035172 | Bacteria | 2175 |
| 192 | Ga0373924_0038479 | 3300035410 | Bacteria | 1951 |
| 193 | Ga0373935_0005770 | 3300035692 | Bacteria | 7319 |
| 194 | Ga0373927_0102672 | 3300035695 | Bacteria | 1860 |
| 195 | Ga0373947_0004804 | 3300035725 | Bacteria | 7910 |
| 196 | Ga0373937_0094792 | 3300036401 | Bacteria | 2768 |
| 197 | Ga0373925_0002391 | 3300037068 | Bacteria | 15049 |
| 198 | Ga0373925_0245800 | 3300037068 | Bacteria | 1434 |
| 199 | Ga0451576_0214426 | 3300045051 | Bacteria | 2010 |
| 200 | Ga0451576_0340647 | 3300045051 | Bacteria | 1570 |
| 201 | Ga0451576_0923849 | 3300045051 | Bacteria | 915 |
| 202 | Ga0495592_0066607 | 3300046454 | Bacteria | 2635 |
| 203 | Ga0495651_0134734 | 3300046462 | Unclassified | 1799 |
| 204 | Ga0495580_0053458 | 3300046472 | Bacteria | 2850 |
| 205 | Ga0495582_0143799 | 3300046473 | Bacteria | 1352 |
| 206 | Ga0495594_0131216 | 3300046499 | Unclassified | 1419 |
| 207 | Ga0495608_0023997 | 3300046511 | Bacteria | 4173 |
| 208 | Ga0495628_0278589 | 3300046516 | Unclassified | 1242 |
| 209 | Ga0495630_0001346 | 3300046517 | Bacteria | 16892 |
| 210 | Ga0495640_0166310 | 3300046533 | Bacteria | 1411 |
| 211 | Ga0495586_0042621 | 3300046535 | Bacteria | 2444 |
| 212 | Ga0495586_0111500 | 3300046535 | Bacteria | 1523 |
| 213 | Ga0495645_0162121 | 3300046543 | Bacteria | 1545 |
| 214 | Ga0495667_0042746 | 3300046559 | Bacteria | 3005 |
| 215 | Ga0495634_0025925 | 3300046642 | Bacteria | 4095 |
| 216 | Ga0495613_0000186 | 3300046689 | Bacteria | 60855 |
| 217 | Ga0495600_0081535 | 3300046809 | Bacteria | 2111 |
| 218 | Ga0495604_0014100 | 3300047317 | Bacteria | 6372 |
| 219 | Ga0495674_0096057 | 3300047319 | Bacteria | 2526 |
| 220 | Ga0495684_0000188 | 3300047471 | Bacteria | 47553 |
| 221 | Ga0496100_0204994 | 3300048903 | Bacteria | 1439 |
| 222 | Ga0496108_0390097 | 3300048911 | Bacteria | 1216 |
| 223 | Ga0496114_0001427 | 3300048917 | Bacteria | 18129 |
| 224 | nmdc:mga05p37_228500_c1 | 3300050507 | Bacteria | 2243 |
| 225 | nmdc:mga05p37_325392_c1 | 3300050507 | Bacteria | 1818 |
| 226 | nmdc:mga05p37_55862_c1 | 3300050507 | Unclassified | 4860 |
| 227 | nmdc:mga09592_72068_c1 | 3300050508 | Bacteria | 2933 |
| 228 | nmdc:mga09592_967_c1 | 3300050508 | Bacteria | 22695 |
| 229 | nmdc:mga0qj67_38848_c1 | 3300050509 | Unclassified | 3736 |
| 230 | nmdc:mga0qj67_4796_c1 | 3300050509 | Bacteria | 9836 |
| 231 | nmdc:mga06r32_177854_c1 | 3300050510 | Bacteria | 2113 |
| 232 | nmdc:mga06r32_2983_c1 | 3300050510 | Bacteria | 15160 |
| 233 | nmdc:mga08y16_282335_c1 | 3300050511 | Bacteria | 1712 |
| 234 | nmdc:mga08y16_30185_c1 | 3300050511 | Bacteria | 5707 |
| 235 | nmdc:mga08y16_320650_c1 | 3300050511 | Bacteria | 1595 |
| 236 | nmdc:mga08y16_53928_c1 | 3300050511 | Unclassified | 4202 |
| 237 | nmdc:mga08y16_67159_c1 | 3300050511 | Bacteria | 3741 |
| 238 | nmdc:mga0n895_17965_c1 | 3300050512 | Bacteria | 6536 |
| 239 | nmdc:mga0n895_34645_c1 | 3300050512 | Bacteria | 4862 |
| 240 | nmdc:mga0rr50_34722_c1 | 3300050513 | Unclassified | 3614 |
| 241 | nmdc:mga0a205_140147_c1 | 3300050515 | Unclassified | 2319 |
| 242 | nmdc:mga0a205_18104_c1 | 3300050515 | Bacteria | 6619 |
| 243 | nmdc:mga0a205_3717_c1 | 3300050515 | Bacteria | 13662 |
| 244 | nmdc:mga0a205_461159_c1 | 3300050515 | Unclassified | 1130 |
| 245 | nmdc:mga0a205_46580_c1 | 3300050515 | Bacteria | 4182 |
| 246 | Ga0495601_0005809 | 3300053077 | Bacteria | 7194 |
| 247 | Ga0495619_0012258 | 3300053085 | Bacteria | 5393 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10025370 | Ga0105240_100253704 | 252 |
| 2 | 3300005459 | Ga0068867_100150739 | Ga0068867_1001507392 | 253 |
| 3 | 3300046533 | Ga0495640_0166310 | Ga0495640_0166310_72_839 | 253 |
| 4 | 3300005563 | Ga0068855_100012829 | Ga0068855_1000128296 | 254 |
| 5 | 3300005843 | Ga0068860_100020778 | Ga0068860_1000207785 | 254 |
| 6 | 3300013104 | Ga0157370_10002991 | Ga0157370_1000299120 | 254 |
| 7 | 3300025927 | Ga0207687_10014462 | Ga0207687_100144625 | 254 |
| 8 | 3300025934 | Ga0207686_10063723 | Ga0207686_100637232 | 254 |
| 9 | 3300025949 | Ga0207667_10843080 | Ga0207667_108430801 | 254 |
| 10 | 3300009176 | Ga0105242_10025213 | Ga0105242_100252134 | 255 |
| 11 | 3300013306 | Ga0163162_10044253 | Ga0163162_100442533 | 255 |
| 12 | 3300026089 | Ga0207648_10514320 | Ga0207648_105143202 | 255 |
| 13 | 3300028379 | Ga0268266_10051518 | Ga0268266_100515182 | 255 |
| 14 | 3300026078 | Ga0207702_10649051 | Ga0207702_106490512 | 256 |
| 15 | 3300006028 | Ga0070717_10027930 | Ga0070717_100279303 | 258 |
| 16 | 3300025924 | Ga0207694_10020239 | Ga0207694_100202392 | 258 |
| 17 | 3300005563 | Ga0068855_100435600 | Ga0068855_1004356002 | 259 |
| 18 | 3300025925 | Ga0207650_10341485 | Ga0207650_103414852 | 259 |
| 19 | 3300050515 | nmdc:mga0a205_461159_c1 | nmdc:mga0a205_461159_c1_159_950 | 261 |
| 20 | 3300005434 | Ga0070709_10212524 | Ga0070709_102125241 | 263 |
| 21 | 3300025939 | Ga0207665_10514260 | Ga0207665_105142601 | 263 |
| 22 | 3300013308 | Ga0157375_10031235 | Ga0157375_100312352 | 265 |
| 23 | 3300026067 | Ga0207678_10021218 | Ga0207678_100212182 | 265 |
| 24 | 3300035172 | Ga0373955_0031171 | Ga0373955_0031171_1568_2383 | 265 |
| 25 | 3300048903 | Ga0496100_0204994 | Ga0496100_0204994_605_1420 | 265 |
| 26 | 3300048917 | Ga0496114_0001427 | Ga0496114_0001427_4481_5296 | 265 |
| 27 | 3300050511 | nmdc:mga08y16_282335_c1 | nmdc:mga08y16_282335_c1_660_1463 | 265 |
| 28 | 3300006358 | Ga0068871_100011018 | Ga0068871_1000110183 | 266 |
| 29 | 3300006358 | Ga0068871_100141229 | Ga0068871_1001412292 | 266 |
| 30 | 3300014325 | Ga0163163_10058596 | Ga0163163_100585962 | 266 |
| 31 | 3300014969 | Ga0157376_10034139 | Ga0157376_100341392 | 266 |
| 32 | 3300035089 | Ga0373944_0023163 | Ga0373944_0023163_799_1605 | 266 |
| 33 | 3300035111 | Ga0373923_0062149 | Ga0373923_0062149_569_1375 | 266 |
| 34 | 3300035119 | Ga0373956_0052039 | Ga0373956_0052039_93_899 | 266 |
| 35 | 3300035170 | Ga0373943_0016041 | Ga0373943_0016041_1761_2567 | 266 |
| 36 | 3300035171 | Ga0373946_0001093 | Ga0373946_0001093_409_1215 | 266 |
| 37 | 3300035172 | Ga0373955_0055184 | Ga0373955_0055184_673_1479 | 266 |
| 38 | 3300035410 | Ga0373924_0038479 | Ga0373924_0038479_724_1530 | 266 |
| 39 | 3300035692 | Ga0373935_0005770 | Ga0373935_0005770_4937_5743 | 266 |
| 40 | 3300035695 | Ga0373927_0102672 | Ga0373927_0102672_411_1217 | 266 |
| 41 | 3300035725 | Ga0373947_0004804 | Ga0373947_0004804_6112_6918 | 266 |
| 42 | 3300037068 | Ga0373925_0002391 | Ga0373925_0002391_8143_8949 | 266 |
| 43 | 3300045051 | Ga0451576_0923849 | Ga0451576_0923849_83_889 | 266 |
| 44 | 3300046472 | Ga0495580_0053458 | Ga0495580_0053458_2010_2816 | 266 |
| 45 | 3300013308 | Ga0157375_10241587 | Ga0157375_102415873 | 267 |
| 46 | 3300026095 | Ga0207676_10663998 | Ga0207676_106639981 | 267 |
| 47 | 3300009098 | Ga0105245_10016786 | Ga0105245_100167866 | 268 |
| 48 | 3300009098 | Ga0105245_10666729 | Ga0105245_106667291 | 268 |
| 49 | 3300009177 | Ga0105248_10018613 | Ga0105248_100186138 | 268 |
| 50 | 3300009551 | Ga0105238_10154660 | Ga0105238_101546602 | 268 |
| 51 | 3300009553 | Ga0105249_10029251 | Ga0105249_100292514 | 268 |
| 52 | 3300011119 | Ga0105246_10057601 | Ga0105246_100576012 | 268 |
| 53 | 3300013307 | Ga0157372_10018269 | Ga0157372_100182694 | 268 |
| 54 | 3300025924 | Ga0207694_10082139 | Ga0207694_100821392 | 268 |
| 55 | 3300025927 | Ga0207687_10005396 | Ga0207687_100053962 | 268 |
| 56 | 3300025944 | Ga0207661_10168633 | Ga0207661_101686332 | 268 |
| 57 | 3300025961 | Ga0207712_10014099 | Ga0207712_100140994 | 268 |
| 58 | 3300026035 | Ga0207703_10037907 | Ga0207703_100379074 | 268 |
| 59 | 3300037068 | Ga0373925_0245800 | Ga0373925_0245800_597_1409 | 268 |
| 60 | 3300005329 | Ga0070683_100308004 | Ga0070683_1003080041 | 269 |
| 61 | 3300005344 | Ga0070661_100109998 | Ga0070661_1001099982 | 269 |
| 62 | 3300005458 | Ga0070681_10039981 | Ga0070681_100399812 | 269 |
| 63 | 3300005459 | Ga0068867_100048561 | Ga0068867_1000485612 | 269 |
| 64 | 3300005564 | Ga0070664_100356473 | Ga0070664_1003564732 | 269 |
| 65 | 3300005577 | Ga0068857_100015444 | Ga0068857_1000154446 | 269 |
| 66 | 3300005616 | Ga0068852_100380915 | Ga0068852_1003809152 | 269 |
| 67 | 3300006881 | Ga0068865_100076088 | Ga0068865_1000760882 | 269 |
| 68 | 3300009093 | Ga0105240_10079637 | Ga0105240_100796373 | 269 |
| 69 | 3300009098 | Ga0105245_10033480 | Ga0105245_100334802 | 269 |
| 70 | 3300009176 | Ga0105242_10018990 | Ga0105242_100189905 | 269 |
| 71 | 3300009545 | Ga0105237_10011447 | Ga0105237_100114477 | 269 |
| 72 | 3300009545 | Ga0105237_10906951 | Ga0105237_109069511 | 269 |
| 73 | 3300010375 | Ga0105239_10010768 | Ga0105239_100107682 | 269 |
| 74 | 3300011119 | Ga0105246_10238385 | Ga0105246_102383852 | 269 |
| 75 | 3300013104 | Ga0157370_10001504 | Ga0157370_1000150422 | 269 |
| 76 | 3300013296 | Ga0157374_10015689 | Ga0157374_100156892 | 269 |
| 77 | 3300013296 | Ga0157374_10145927 | Ga0157374_101459272 | 269 |
| 78 | 3300013306 | Ga0163162_10103415 | Ga0163162_101034152 | 269 |
| 79 | 3300013308 | Ga0157375_10158544 | Ga0157375_101585442 | 269 |
| 80 | 3300014325 | Ga0163163_10018223 | Ga0163163_100182236 | 269 |
| 81 | 3300014325 | Ga0163163_10181053 | Ga0163163_101810532 | 269 |
| 82 | 3300014968 | Ga0157379_10045212 | Ga0157379_100452123 | 269 |
| 83 | 3300014969 | Ga0157376_10098692 | Ga0157376_100986922 | 269 |
| 84 | 3300014969 | Ga0157376_10478899 | Ga0157376_104788992 | 269 |
| 85 | 3300025912 | Ga0207707_10026825 | Ga0207707_100268255 | 269 |
| 86 | 3300025913 | Ga0207695_10014870 | Ga0207695_100148705 | 269 |
| 87 | 3300025920 | Ga0207649_10101379 | Ga0207649_101013792 | 269 |
| 88 | 3300025921 | Ga0207652_10099941 | Ga0207652_100999412 | 269 |
| 89 | 3300025924 | Ga0207694_10285155 | Ga0207694_102851551 | 269 |
| 90 | 3300025927 | Ga0207687_10447802 | Ga0207687_104478021 | 269 |
| 91 | 3300025934 | Ga0207686_10008561 | Ga0207686_100085612 | 269 |
| 92 | 3300025945 | Ga0207679_10076987 | Ga0207679_100769872 | 269 |
| 93 | 3300026116 | Ga0207674_10057457 | Ga0207674_100574573 | 269 |
| 94 | 3300045051 | Ga0451576_0340647 | Ga0451576_0340647_547_1383 | 269 |
| 95 | 3300048911 | Ga0496108_0390097 | Ga0496108_0390097_157_972 | 269 |
| 96 | 3300050515 | nmdc:mga0a205_46580_c1 | nmdc:mga0a205_46580_c1_568_1383 | 269 |
| 97 | 3300005618 | Ga0068864_100041365 | Ga0068864_1000413651 | 270 |
| 98 | 3300006847 | Ga0075431_100191146 | Ga0075431_1001911463 | 270 |
| 99 | 3300006852 | Ga0075433_10399469 | Ga0075433_103994692 | 270 |
| 100 | 3300009101 | Ga0105247_10016956 | Ga0105247_100169562 | 270 |
| 101 | 3300014968 | Ga0157379_10016206 | Ga0157379_100162062 | 270 |
| 102 | 3300026118 | Ga0207675_100103613 | Ga0207675_1001036132 | 270 |
| 103 | 3300050507 | nmdc:mga05p37_228500_c1 | nmdc:mga05p37_228500_c1_476_1294 | 270 |
| 104 | 3300005466 | Ga0070685_10198613 | Ga0070685_101986131 | 271 |
| 105 | 3300005543 | Ga0070672_100150815 | Ga0070672_1001508152 | 271 |
| 106 | 3300025940 | Ga0207691_10084788 | Ga0207691_100847882 | 271 |
| 107 | 3300026088 | Ga0207641_10076209 | Ga0207641_100762093 | 271 |
| 108 | 3300006846 | Ga0075430_100080721 | Ga0075430_1000807213 | 272 |
| 109 | 3300009094 | Ga0111539_10001859 | Ga0111539_1000185911 | 272 |
| 110 | 3300009147 | Ga0114129_10094418 | Ga0114129_100944184 | 272 |
| 111 | 3300027907 | Ga0207428_10000893 | Ga0207428_1000089319 | 272 |
| 112 | 3300050509 | nmdc:mga0qj67_38848_c1 | nmdc:mga0qj67_38848_c1_2453_3286 | 272 |
| 113 | 3300050510 | nmdc:mga06r32_177854_c1 | nmdc:mga06r32_177854_c1_72_905 | 272 |
| 114 | 3300050511 | nmdc:mga08y16_30185_c1 | nmdc:mga08y16_30185_c1_252_1085 | 272 |
| 115 | 3300006028 | Ga0070717_10051841 | Ga0070717_100518413 | 273 |
| 116 | 3300006852 | Ga0075433_10001205 | Ga0075433_100012058 | 273 |
| 117 | 3300026089 | Ga0207648_10286615 | Ga0207648_102866152 | 273 |
| 118 | 3300046535 | Ga0495586_0042621 | Ga0495586_0042621_1547_2374 | 273 |
| 119 | 3300050512 | nmdc:mga0n895_34645_c1 | nmdc:mga0n895_34645_c1_1544_2371 | 273 |
| 120 | 3300050515 | nmdc:mga0a205_3717_c1 | nmdc:mga0a205_3717_c1_7036_7863 | 273 |
| 121 | 3300005331 | Ga0070670_100033138 | Ga0070670_1000331384 | 274 |
| 122 | 3300005334 | Ga0068869_100136634 | Ga0068869_1001366342 | 274 |
| 123 | 3300005335 | Ga0070666_10143512 | Ga0070666_101435122 | 274 |
| 124 | 3300005340 | Ga0070689_100522430 | Ga0070689_1005224301 | 274 |
| 125 | 3300005344 | Ga0070661_100034142 | Ga0070661_1000341422 | 274 |
| 126 | 3300005345 | Ga0070692_10037049 | Ga0070692_100370493 | 274 |
| 127 | 3300005353 | Ga0070669_100023869 | Ga0070669_1000238692 | 274 |
| 128 | 3300005354 | Ga0070675_100241201 | Ga0070675_1002412012 | 274 |
| 129 | 3300005364 | Ga0070673_100074297 | Ga0070673_1000742972 | 274 |
| 130 | 3300005365 | Ga0070688_100003798 | Ga0070688_1000037982 | 274 |
| 131 | 3300005365 | Ga0070688_100225171 | Ga0070688_1002251712 | 274 |
| 132 | 3300005367 | Ga0070667_100232063 | Ga0070667_1002320632 | 274 |
| 133 | 3300005439 | Ga0070711_100236234 | Ga0070711_1002362342 | 274 |
| 134 | 3300005441 | Ga0070700_100042526 | Ga0070700_1000425262 | 274 |
| 135 | 3300005445 | Ga0070708_100014817 | Ga0070708_1000148175 | 274 |
| 136 | 3300005456 | Ga0070678_100020502 | Ga0070678_1000205021 | 274 |
| 137 | 3300005518 | Ga0070699_100049198 | Ga0070699_1000491982 | 274 |
| 138 | 3300005544 | Ga0070686_100219360 | Ga0070686_1002193601 | 274 |
| 139 | 3300005549 | Ga0070704_100205459 | Ga0070704_1002054592 | 274 |
| 140 | 3300005564 | Ga0070664_100011610 | Ga0070664_1000116103 | 274 |
| 141 | 3300005617 | Ga0068859_100514199 | Ga0068859_1005141991 | 274 |
| 142 | 3300005719 | Ga0068861_100036220 | Ga0068861_1000362203 | 274 |
| 143 | 3300005840 | Ga0068870_10060079 | Ga0068870_100600793 | 274 |
| 144 | 3300005842 | Ga0068858_100029215 | Ga0068858_1000292152 | 274 |
| 145 | 3300005844 | Ga0068862_100021674 | Ga0068862_1000216743 | 274 |
| 146 | 3300005985 | Ga0081539_10000285 | Ga0081539_100002859 | 274 |
| 147 | 3300005985 | Ga0081539_10008879 | Ga0081539_100088795 | 274 |
| 148 | 3300006844 | Ga0075428_100007944 | Ga0075428_1000079448 | 274 |
| 149 | 3300006847 | Ga0075431_100000646 | Ga0075431_1000006464 | 274 |
| 150 | 3300006852 | Ga0075433_10014476 | Ga0075433_100144764 | 274 |
| 151 | 3300006871 | Ga0075434_100000561 | Ga0075434_10000056120 | 274 |
| 152 | 3300006880 | Ga0075429_100001853 | Ga0075429_10000185316 | 274 |
| 153 | 3300006931 | Ga0097620_100514173 | Ga0097620_1005141731 | 274 |
| 154 | 3300007076 | Ga0075435_100026299 | Ga0075435_1000262994 | 274 |
| 155 | 3300009094 | Ga0111539_10075015 | Ga0111539_100750156 | 274 |
| 156 | 3300009094 | Ga0111539_10260659 | Ga0111539_102606592 | 274 |
| 157 | 3300009147 | Ga0114129_10070863 | Ga0114129_100708634 | 274 |
| 158 | 3300009176 | Ga0105242_10286948 | Ga0105242_102869482 | 274 |
| 159 | 3300009177 | Ga0105248_10023579 | Ga0105248_100235794 | 274 |
| 160 | 3300009177 | Ga0105248_10258168 | Ga0105248_102581682 | 274 |
| 161 | 3300009177 | Ga0105248_10392777 | Ga0105248_103927772 | 274 |
| 162 | 3300009553 | Ga0105249_10031356 | Ga0105249_100313563 | 274 |
| 163 | 3300011119 | Ga0105246_10038869 | Ga0105246_100388691 | 274 |
| 164 | 3300013306 | Ga0163162_10010669 | Ga0163162_100106692 | 274 |
| 165 | 3300013306 | Ga0163162_10076114 | Ga0163162_100761142 | 274 |
| 166 | 3300013308 | Ga0157375_10069163 | Ga0157375_100691634 | 274 |
| 167 | 3300013308 | Ga0157375_10155516 | Ga0157375_101555162 | 274 |
| 168 | 3300013308 | Ga0157375_10359159 | Ga0157375_103591592 | 274 |
| 169 | 3300014969 | Ga0157376_10004354 | Ga0157376_100043543 | 274 |
| 170 | 3300014969 | Ga0157376_10514622 | Ga0157376_105146222 | 274 |
| 171 | 3300017792 | Ga0163161_10206536 | Ga0163161_102065362 | 274 |
| 172 | 3300025290 | Ga0207673_1007317 | Ga0207673_10073172 | 274 |
| 173 | 3300025893 | Ga0207682_10009615 | Ga0207682_100096152 | 274 |
| 174 | 3300025893 | Ga0207682_10101309 | Ga0207682_101013091 | 274 |
| 175 | 3300025901 | Ga0207688_10061927 | Ga0207688_100619272 | 274 |
| 176 | 3300025901 | Ga0207688_10099355 | Ga0207688_100993552 | 274 |
| 177 | 3300025920 | Ga0207649_10019938 | Ga0207649_100199382 | 274 |
| 178 | 3300025922 | Ga0207646_10202570 | Ga0207646_102025702 | 274 |
| 179 | 3300025923 | Ga0207681_10113982 | Ga0207681_101139823 | 274 |
| 180 | 3300025925 | Ga0207650_10127190 | Ga0207650_101271903 | 274 |
| 181 | 3300025933 | Ga0207706_10040847 | Ga0207706_100408472 | 274 |
| 182 | 3300025936 | Ga0207670_10083015 | Ga0207670_100830151 | 274 |
| 183 | 3300025938 | Ga0207704_10062396 | Ga0207704_100623962 | 274 |
| 184 | 3300025940 | Ga0207691_10057887 | Ga0207691_100578875 | 274 |
| 185 | 3300025942 | Ga0207689_10054674 | Ga0207689_100546742 | 274 |
| 186 | 3300025945 | Ga0207679_10007752 | Ga0207679_100077522 | 274 |
| 187 | 3300025960 | Ga0207651_10007553 | Ga0207651_100075535 | 274 |
| 188 | 3300025960 | Ga0207651_10030560 | Ga0207651_100305602 | 274 |
| 189 | 3300025961 | Ga0207712_10347602 | Ga0207712_103476021 | 274 |
| 190 | 3300025972 | Ga0207668_10100065 | Ga0207668_101000651 | 274 |
| 191 | 3300025986 | Ga0207658_10360430 | Ga0207658_103604302 | 274 |
| 192 | 3300026023 | Ga0207677_10025811 | Ga0207677_100258112 | 274 |
| 193 | 3300026075 | Ga0207708_10068773 | Ga0207708_100687731 | 274 |
| 194 | 3300026089 | Ga0207648_10681460 | Ga0207648_106814601 | 274 |
| 195 | 3300026095 | Ga0207676_10091459 | Ga0207676_100914593 | 274 |
| 196 | 3300026118 | Ga0207675_100125297 | Ga0207675_1001252972 | 274 |
| 197 | 3300026121 | Ga0207683_10006350 | Ga0207683_100063508 | 274 |
| 198 | 3300027907 | Ga0207428_10030612 | Ga0207428_100306122 | 274 |
| 199 | 3300028379 | Ga0268266_10085852 | Ga0268266_100858521 | 274 |
| 200 | 3300028381 | Ga0268264_10416282 | Ga0268264_104162822 | 274 |
| 201 | 3300035092 | Ga0373952_0061041 | Ga0373952_0061041_20_850 | 274 |
| 202 | 3300035112 | Ga0373932_0039102 | Ga0373932_0039102_55_885 | 274 |
| 203 | 3300036401 | Ga0373937_0094792 | Ga0373937_0094792_1012_1851 | 274 |
| 204 | 3300045051 | Ga0451576_0214426 | Ga0451576_0214426_1144_1974 | 274 |
| 205 | 3300046454 | Ga0495592_0066607 | Ga0495592_0066607_392_1231 | 274 |
| 206 | 3300046462 | Ga0495651_0134734 | Ga0495651_0134734_101_940 | 274 |
| 207 | 3300046473 | Ga0495582_0143799 | Ga0495582_0143799_480_1319 | 274 |
| 208 | 3300046499 | Ga0495594_0131216 | Ga0495594_0131216_54_893 | 274 |
| 209 | 3300046511 | Ga0495608_0023997 | Ga0495608_0023997_1167_2006 | 274 |
| 210 | 3300046516 | Ga0495628_0278589 | Ga0495628_0278589_141_980 | 274 |
| 211 | 3300046517 | Ga0495630_0001346 | Ga0495630_0001346_9343_10182 | 274 |
| 212 | 3300046535 | Ga0495586_0111500 | Ga0495586_0111500_664_1503 | 274 |
| 213 | 3300046543 | Ga0495645_0162121 | Ga0495645_0162121_313_1152 | 274 |
| 214 | 3300046559 | Ga0495667_0042746 | Ga0495667_0042746_899_1738 | 274 |
| 215 | 3300046642 | Ga0495634_0025925 | Ga0495634_0025925_521_1360 | 274 |
| 216 | 3300046689 | Ga0495613_0000186 | Ga0495613_0000186_5870_6709 | 274 |
| 217 | 3300046809 | Ga0495600_0081535 | Ga0495600_0081535_734_1573 | 274 |
| 218 | 3300047317 | Ga0495604_0014100 | Ga0495604_0014100_3424_4263 | 274 |
| 219 | 3300047319 | Ga0495674_0096057 | Ga0495674_0096057_1021_1860 | 274 |
| 220 | 3300047471 | Ga0495684_0000188 | Ga0495684_0000188_38800_39639 | 274 |
| 221 | 3300050507 | nmdc:mga05p37_325392_c1 | nmdc:mga05p37_325392_c1_130_969 | 274 |
| 222 | 3300050507 | nmdc:mga05p37_55862_c1 | nmdc:mga05p37_55862_c1_2523_3404 | 274 |
| 223 | 3300050508 | nmdc:mga09592_72068_c1 | nmdc:mga09592_72068_c1_1272_2102 | 274 |
| 224 | 3300050508 | nmdc:mga09592_967_c1 | nmdc:mga09592_967_c1_18921_19802 | 274 |
| 225 | 3300050509 | nmdc:mga0qj67_4796_c1 | nmdc:mga0qj67_4796_c1_798_1679 | 274 |
| 226 | 3300050510 | nmdc:mga06r32_2983_c1 | nmdc:mga06r32_2983_c1_6529_7410 | 274 |
| 227 | 3300050511 | nmdc:mga08y16_53928_c1 | nmdc:mga08y16_53928_c1_902_1732 | 274 |
| 228 | 3300050511 | nmdc:mga08y16_67159_c1 | nmdc:mga08y16_67159_c1_2540_3370 | 274 |
| 229 | 3300050512 | nmdc:mga0n895_17965_c1 | nmdc:mga0n895_17965_c1_3498_4337 | 274 |
| 230 | 3300050513 | nmdc:mga0rr50_34722_c1 | nmdc:mga0rr50_34722_c1_2061_2891 | 274 |
| 231 | 3300050515 | nmdc:mga0a205_140147_c1 | nmdc:mga0a205_140147_c1_158_988 | 274 |
| 232 | 3300050515 | nmdc:mga0a205_18104_c1 | nmdc:mga0a205_18104_c1_3351_4181 | 274 |
| 233 | 3300053077 | Ga0495601_0005809 | Ga0495601_0005809_2536_3375 | 274 |
| 234 | 3300053085 | Ga0495619_0012258 | Ga0495619_0012258_889_1728 | 274 |
| 235 | 3300005353 | Ga0070669_100147423 | Ga0070669_1001474232 | 275 |
| 236 | 3300005354 | Ga0070675_100001559 | Ga0070675_1000015597 | 275 |
| 237 | 3300005356 | Ga0070674_100007122 | Ga0070674_1000071225 | 275 |
| 238 | 3300005364 | Ga0070673_100185519 | Ga0070673_1001855192 | 275 |
| 239 | 3300009094 | Ga0111539_10946899 | Ga0111539_109468992 | 275 |
| 240 | 3300014326 | Ga0157380_10018043 | Ga0157380_100180432 | 275 |
| 241 | 3300025923 | Ga0207681_10146763 | Ga0207681_101467632 | 275 |
| 242 | 3300025926 | Ga0207659_10007448 | Ga0207659_100074483 | 275 |
| 243 | 3300025937 | Ga0207669_10083213 | Ga0207669_100832132 | 275 |
| 244 | 3300050511 | nmdc:mga08y16_320650_c1 | nmdc:mga08y16_320650_c1_300_1133 | 275 |
| 245 | 3300009177 | Ga0105248_10298231 | Ga0105248_102982312 | 279 |
| 246 | 3300005327 | Ga0070658_10073797 | Ga0070658_100737973 | 283 |
| 247 | 3300025909 | Ga0207705_10074467 | Ga0207705_100744673 | 283 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wzf-assembly1.cif.gz_A | structural and mechanism analysis of yunm | 0.8572 | 218 | 257 |
| 2oiw-assembly1.cif.gz_C | the structure of a predicted thioesterase from bacillus stearothermophilus | 0.6753 | 217 | 262 |
| 4hjq-assembly1.cif.gz_A | shp-1 catalytic domain wpd loop closed | 0.67 | 218 | 253 |
| 1z54-assembly1.cif.gz_B | crystal structure of a hypothetical protein tt1821 from thermus thermophilus | 0.6597 | 218 | 256 |
| 2egi-assembly1.cif.gz_H | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.6588 | 211 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZTI3_371_476_2.60.40.60 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.7381 | 230 | 261 | 2.60.40.60 |
| af_Q5NUI3_363_465_2.60.40.60 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.7356 | 230 | 261 | 2.60.40.60 |
| af_Q9P7J2_2_131_2.170.210.10 | Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal | 0.7342 | 220 | 258 | 2.170.210.10 |
| 1o8vA00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.6997 | 145 | 258 | 2.40.128.20 |
| af_Q33AZ5_28_362_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.6963 | 192 | 240 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8I9H5-F1-model_v4 | Uncharacterized protein | 0.9741 | 145 | 261 |
|
| AF-A0A1F2S5M9-F1-model_v4 | Uncharacterized protein | 0.9709 | 145 | 261 |
|
| AF-A0A2V8N442-F1-model_v4 | Uncharacterized protein | 0.9687 | 147 | 262 |
|
| AF-A0A2V8I653-F1-model_v4 | Uncharacterized protein | 0.9657 | 145 | 259 |
|
| AF-A0A7X4JET5-F1-model_v4 | Uncharacterized protein | 0.9644 | 168 | 261 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar