F359092

General Info

Members Datasets Scaffolds Average Seq Length
247 160 247 274

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10286615|Ga0207648_102866152
Length 317
Sequence VKCGRRGVAFWLSPQINESVCREPPRPPALLQNVKRYDSIKTMRVHFRCAVWTVIACLGASLSVRAQWLNQPMAGAPRTPDGKINMTAPVPMLNGKPDLSGIWQVQAEPRAPGGLFGLGESPNSRYFRDILSDFKPDERPLTPAGADLLRRHSQPGVFNPSLNCLPDGVPHGDLLPEPFKIIHSRGVIVMLYEVETTFRQIFMDGRKLPVDPSRTWQGYSVGRWEGDTLVVDTTGFNDLSWLDARGTGHSEEMRVEERFLRRDYGHLELTITVVDPKTFTRPITFTVVEELLPDTDLFEHYCLENEKDAAHQPLKGR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10073797 3300005327 Bacteria 2798
2 Ga0070683_100308004 3300005329 Unclassified 1507
3 Ga0070670_100033138 3300005331 Bacteria 4449
4 Ga0068869_100136634 3300005334 Bacteria 1889
5 Ga0070666_10143512 3300005335 Bacteria 1663
6 Ga0070689_100522430 3300005340 Bacteria 1019
7 Ga0070661_100034142 3300005344 Bacteria 3689
8 Ga0070661_100109998 3300005344 Bacteria 2057
9 Ga0070692_10037049 3300005345 Unclassified 2478
10 Ga0070669_100023869 3300005353 Unclassified 4382
11 Ga0070669_100147423 3300005353 Bacteria 1819
12 Ga0070675_100001559 3300005354 Bacteria 16935
13 Ga0070675_100241201 3300005354 Bacteria 1579
14 Ga0070674_100007122 3300005356 Bacteria 6578
15 Ga0070673_100074297 3300005364 Bacteria 2739
16 Ga0070673_100185519 3300005364 Bacteria 1783
17 Ga0070688_100003798 3300005365 Bacteria 7828
18 Ga0070688_100225171 3300005365 Bacteria 1324
19 Ga0070667_100232063 3300005367 Bacteria 1646
20 Ga0070709_10212524 3300005434 Bacteria 1376
21 Ga0070711_100236234 3300005439 Bacteria 1427
22 Ga0070700_100042526 3300005441 Unclassified 2790
23 Ga0070708_100014817 3300005445 Bacteria 6426
24 Ga0070678_100020502 3300005456 Bacteria 4338
25 Ga0070681_10039981 3300005458 Bacteria 4702
26 Ga0068867_100048561 3300005459 Bacteria 3123
27 Ga0068867_100150739 3300005459 Bacteria 1826
28 Ga0070685_10198613 3300005466 Unclassified 1302
29 Ga0070699_100049198 3300005518 Bacteria 3649
30 Ga0070672_100150815 3300005543 Bacteria 1923
31 Ga0070686_100219360 3300005544 Bacteria 1373
32 Ga0070704_100205459 3300005549 Unclassified 1593
33 Ga0068855_100012829 3300005563 Bacteria 10110
34 Ga0068855_100435600 3300005563 Unclassified 1432
35 Ga0070664_100011610 3300005564 Bacteria 7146
36 Ga0070664_100356473 3300005564 Bacteria 1331
37 Ga0068857_100015444 3300005577 Bacteria 6669
38 Ga0068852_100380915 3300005616 Bacteria 1384
39 Ga0068859_100514199 3300005617 Bacteria 1292
40 Ga0068864_100041365 3300005618 Bacteria 3942
41 Ga0068861_100036220 3300005719 Bacteria 3660
42 Ga0068870_10060079 3300005840 Bacteria 2040
43 Ga0068858_100029215 3300005842 Bacteria 5118
44 Ga0068860_100020778 3300005843 Bacteria 6360
45 Ga0068862_100021674 3300005844 Bacteria 5373
46 Ga0081539_10000285 3300005985 Bacteria 114370
47 Ga0081539_10008879 3300005985 Bacteria 8586
48 Ga0070717_10027930 3300006028 Unclassified 4512
49 Ga0070717_10051841 3300006028 Bacteria 3378
50 Ga0068871_100011018 3300006358 Bacteria 6626
51 Ga0068871_100141229 3300006358 Unclassified 2048
52 Ga0075428_100007944 3300006844 Bacteria 11766
53 Ga0075430_100080721 3300006846 Bacteria 2724
54 Ga0075431_100000646 3300006847 Bacteria 29552
55 Ga0075431_100191146 3300006847 Bacteria 2097
56 Ga0075433_10001205 3300006852 Bacteria 18840
57 Ga0075433_10014476 3300006852 Bacteria 6444
58 Ga0075433_10399469 3300006852 Unclassified 1213
59 Ga0075434_100000561 3300006871 Bacteria 28555
60 Ga0075429_100001853 3300006880 Bacteria 17516
61 Ga0068865_100076088 3300006881 Bacteria 2395
62 Ga0097620_100514173 3300006931 Bacteria 1292
63 Ga0075435_100026299 3300007076 Unclassified 4538
64 Ga0105240_10025370 3300009093 Bacteria 7790
65 Ga0105240_10079637 3300009093 Bacteria 4031
66 Ga0111539_10001859 3300009094 Bacteria 28033
67 Ga0111539_10075015 3300009094 Bacteria 3985
68 Ga0111539_10260659 3300009094 Bacteria 2018
69 Ga0111539_10946899 3300009094 Bacteria 1001
70 Ga0105245_10016786 3300009098 Bacteria 6392
71 Ga0105245_10033480 3300009098 Bacteria 4556
72 Ga0105245_10666729 3300009098 Bacteria 1071
73 Ga0105247_10016956 3300009101 Unclassified 4369
74 Ga0114129_10070863 3300009147 Unclassified 4860
75 Ga0114129_10094418 3300009147 Unclassified 4142
76 Ga0105242_10018990 3300009176 Bacteria 5384
77 Ga0105242_10025213 3300009176 Bacteria 4703
78 Ga0105242_10286948 3300009176 Unclassified 1497
79 Ga0105248_10018613 3300009177 Bacteria 7678
80 Ga0105248_10023579 3300009177 Bacteria 6836
81 Ga0105248_10258168 3300009177 Bacteria 1962
82 Ga0105248_10298231 3300009177 Bacteria 1815
83 Ga0105248_10392777 3300009177 Bacteria 1562
84 Ga0105237_10011447 3300009545 Bacteria 9384
85 Ga0105237_10906951 3300009545 Bacteria 888
86 Ga0105238_10154660 3300009551 Unclassified 2268
87 Ga0105249_10029251 3300009553 Unclassified 4975
88 Ga0105249_10031356 3300009553 Bacteria 4807
89 Ga0105239_10010768 3300010375 Bacteria 10217
90 Ga0105246_10038869 3300011119 Bacteria 3202
91 Ga0105246_10057601 3300011119 Bacteria 2689
92 Ga0105246_10238385 3300011119 Unclassified 1437
93 Ga0157370_10001504 3300013104 Bacteria 28790
94 Ga0157370_10002991 3300013104 Bacteria 20085
95 Ga0157374_10015689 3300013296 Bacteria 6650
96 Ga0157374_10145927 3300013296 Unclassified 2298
97 Ga0163162_10010669 3300013306 Bacteria 8934
98 Ga0163162_10044253 3300013306 Bacteria 4458
99 Ga0163162_10076114 3300013306 Bacteria 3418
100 Ga0163162_10103415 3300013306 Bacteria 2942
101 Ga0157372_10018269 3300013307 Bacteria 7536
102 Ga0157375_10031235 3300013308 Bacteria 5030
103 Ga0157375_10069163 3300013308 Bacteria 3536
104 Ga0157375_10155516 3300013308 Bacteria 2425
105 Ga0157375_10158544 3300013308 Unclassified 2404
106 Ga0157375_10241587 3300013308 Bacteria 1966
107 Ga0157375_10359159 3300013308 Bacteria 1623
108 Ga0163163_10018223 3300014325 Bacteria 6567
109 Ga0163163_10058596 3300014325 Bacteria 3808
110 Ga0163163_10181053 3300014325 Bacteria 2155
111 Ga0157380_10018043 3300014326 Bacteria 5234
112 Ga0157379_10016206 3300014968 Bacteria 6557
113 Ga0157379_10045212 3300014968 Bacteria 3931
114 Ga0157376_10004354 3300014969 Bacteria 9846
115 Ga0157376_10034139 3300014969 Bacteria 4105
116 Ga0157376_10098692 3300014969 Bacteria 2546
117 Ga0157376_10478899 3300014969 Unclassified 1219
118 Ga0157376_10514622 3300014969 Bacteria 1178
119 Ga0163161_10206536 3300017792 Bacteria 1515
120 Ga0207673_1007317 3300025290 Bacteria 1382
121 Ga0207682_10009615 3300025893 Unclassified 3811
122 Ga0207682_10101309 3300025893 Bacteria 1259
123 Ga0207688_10061927 3300025901 Bacteria 2109
124 Ga0207688_10099355 3300025901 Bacteria 1679
125 Ga0207705_10074467 3300025909 Bacteria 2465
126 Ga0207707_10026825 3300025912 Bacteria 5034
127 Ga0207695_10014870 3300025913 Bacteria 9188
128 Ga0207649_10019938 3300025920 Bacteria 3839
129 Ga0207649_10101379 3300025920 Bacteria 1906
130 Ga0207652_10099941 3300025921 Bacteria 2560
131 Ga0207646_10202570 3300025922 Bacteria 1793
132 Ga0207681_10113982 3300025923 Bacteria 1971
133 Ga0207681_10146763 3300025923 Bacteria 1763
134 Ga0207694_10020239 3300025924 Bacteria 5031
135 Ga0207694_10082139 3300025924 Bacteria 2532
136 Ga0207694_10285155 3300025924 Unclassified 1357
137 Ga0207650_10127190 3300025925 Bacteria 1990
138 Ga0207650_10341485 3300025925 Unclassified 1230
139 Ga0207659_10007448 3300025926 Bacteria 6730
140 Ga0207687_10005396 3300025927 Bacteria 8454
141 Ga0207687_10014462 3300025927 Bacteria 5164
142 Ga0207687_10447802 3300025927 Unclassified 1070
143 Ga0207706_10040847 3300025933 Bacteria 4112
144 Ga0207686_10008561 3300025934 Bacteria 5528
145 Ga0207686_10063723 3300025934 Bacteria 2345
146 Ga0207670_10083015 3300025936 Bacteria 2246
147 Ga0207669_10083213 3300025937 Bacteria 2057
148 Ga0207704_10062396 3300025938 Bacteria 2317
149 Ga0207665_10514260 3300025939 Unclassified 926
150 Ga0207691_10057887 3300025940 Bacteria 3526
151 Ga0207691_10084788 3300025940 Bacteria 2844
152 Ga0207689_10054674 3300025942 Unclassified 3287
153 Ga0207661_10168633 3300025944 Bacteria 1904
154 Ga0207679_10007752 3300025945 Bacteria 6822
155 Ga0207679_10076987 3300025945 Bacteria 2536
156 Ga0207667_10843080 3300025949 Unclassified 911
157 Ga0207651_10007553 3300025960 Bacteria 5799
158 Ga0207651_10030560 3300025960 Bacteria 3432
159 Ga0207712_10014099 3300025961 Bacteria 5130
160 Ga0207712_10347602 3300025961 Bacteria 1232
161 Ga0207668_10100065 3300025972 Bacteria 2152
162 Ga0207658_10360430 3300025986 Bacteria 1268
163 Ga0207677_10025811 3300026023 Bacteria 3672
164 Ga0207703_10037907 3300026035 Unclassified 3843
165 Ga0207678_10021218 3300026067 Bacteria 5694
166 Ga0207708_10068773 3300026075 Bacteria 2710
167 Ga0207702_10649051 3300026078 Unclassified 1038
168 Ga0207641_10076209 3300026088 Bacteria 2899
169 Ga0207648_10286615 3300026089 Bacteria 1474
170 Ga0207648_10514320 3300026089 Bacteria 1096
171 Ga0207648_10681460 3300026089 Bacteria 952
172 Ga0207676_10091459 3300026095 Unclassified 2500
173 Ga0207676_10663998 3300026095 Unclassified 1007
174 Ga0207674_10057457 3300026116 Bacteria 3944
175 Ga0207675_100103613 3300026118 Bacteria 2681
176 Ga0207675_100125297 3300026118 Bacteria 2433
177 Ga0207683_10006350 3300026121 Bacteria 10124
178 Ga0207428_10000893 3300027907 Bacteria 33463
179 Ga0207428_10030612 3300027907 Bacteria 4448
180 Ga0268266_10051518 3300028379 Bacteria 3534
181 Ga0268266_10085852 3300028379 Bacteria 2751
182 Ga0268264_10416282 3300028381 Bacteria 1295
183 Ga0373944_0023163 3300035089 Bacteria 1810
184 Ga0373952_0061041 3300035092 Bacteria 922
185 Ga0373923_0062149 3300035111 Bacteria 1588
186 Ga0373932_0039102 3300035112 Bacteria 1359
187 Ga0373956_0052039 3300035119 Bacteria 1841
188 Ga0373943_0016041 3300035170 Bacteria 3411
189 Ga0373946_0001093 3300035171 Bacteria 9369
190 Ga0373955_0031171 3300035172 Unclassified 2792
191 Ga0373955_0055184 3300035172 Bacteria 2175
192 Ga0373924_0038479 3300035410 Bacteria 1951
193 Ga0373935_0005770 3300035692 Bacteria 7319
194 Ga0373927_0102672 3300035695 Bacteria 1860
195 Ga0373947_0004804 3300035725 Bacteria 7910
196 Ga0373937_0094792 3300036401 Bacteria 2768
197 Ga0373925_0002391 3300037068 Bacteria 15049
198 Ga0373925_0245800 3300037068 Bacteria 1434
199 Ga0451576_0214426 3300045051 Bacteria 2010
200 Ga0451576_0340647 3300045051 Bacteria 1570
201 Ga0451576_0923849 3300045051 Bacteria 915
202 Ga0495592_0066607 3300046454 Bacteria 2635
203 Ga0495651_0134734 3300046462 Unclassified 1799
204 Ga0495580_0053458 3300046472 Bacteria 2850
205 Ga0495582_0143799 3300046473 Bacteria 1352
206 Ga0495594_0131216 3300046499 Unclassified 1419
207 Ga0495608_0023997 3300046511 Bacteria 4173
208 Ga0495628_0278589 3300046516 Unclassified 1242
209 Ga0495630_0001346 3300046517 Bacteria 16892
210 Ga0495640_0166310 3300046533 Bacteria 1411
211 Ga0495586_0042621 3300046535 Bacteria 2444
212 Ga0495586_0111500 3300046535 Bacteria 1523
213 Ga0495645_0162121 3300046543 Bacteria 1545
214 Ga0495667_0042746 3300046559 Bacteria 3005
215 Ga0495634_0025925 3300046642 Bacteria 4095
216 Ga0495613_0000186 3300046689 Bacteria 60855
217 Ga0495600_0081535 3300046809 Bacteria 2111
218 Ga0495604_0014100 3300047317 Bacteria 6372
219 Ga0495674_0096057 3300047319 Bacteria 2526
220 Ga0495684_0000188 3300047471 Bacteria 47553
221 Ga0496100_0204994 3300048903 Bacteria 1439
222 Ga0496108_0390097 3300048911 Bacteria 1216
223 Ga0496114_0001427 3300048917 Bacteria 18129
224 nmdc:mga05p37_228500_c1 3300050507 Bacteria 2243
225 nmdc:mga05p37_325392_c1 3300050507 Bacteria 1818
226 nmdc:mga05p37_55862_c1 3300050507 Unclassified 4860
227 nmdc:mga09592_72068_c1 3300050508 Bacteria 2933
228 nmdc:mga09592_967_c1 3300050508 Bacteria 22695
229 nmdc:mga0qj67_38848_c1 3300050509 Unclassified 3736
230 nmdc:mga0qj67_4796_c1 3300050509 Bacteria 9836
231 nmdc:mga06r32_177854_c1 3300050510 Bacteria 2113
232 nmdc:mga06r32_2983_c1 3300050510 Bacteria 15160
233 nmdc:mga08y16_282335_c1 3300050511 Bacteria 1712
234 nmdc:mga08y16_30185_c1 3300050511 Bacteria 5707
235 nmdc:mga08y16_320650_c1 3300050511 Bacteria 1595
236 nmdc:mga08y16_53928_c1 3300050511 Unclassified 4202
237 nmdc:mga08y16_67159_c1 3300050511 Bacteria 3741
238 nmdc:mga0n895_17965_c1 3300050512 Bacteria 6536
239 nmdc:mga0n895_34645_c1 3300050512 Bacteria 4862
240 nmdc:mga0rr50_34722_c1 3300050513 Unclassified 3614
241 nmdc:mga0a205_140147_c1 3300050515 Unclassified 2319
242 nmdc:mga0a205_18104_c1 3300050515 Bacteria 6619
243 nmdc:mga0a205_3717_c1 3300050515 Bacteria 13662
244 nmdc:mga0a205_461159_c1 3300050515 Unclassified 1130
245 nmdc:mga0a205_46580_c1 3300050515 Bacteria 4182
246 Ga0495601_0005809 3300053077 Bacteria 7194
247 Ga0495619_0012258 3300053085 Bacteria 5393

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10025370 Ga0105240_100253704 252
2 3300005459 Ga0068867_100150739 Ga0068867_1001507392 253
3 3300046533 Ga0495640_0166310 Ga0495640_0166310_72_839 253
4 3300005563 Ga0068855_100012829 Ga0068855_1000128296 254
5 3300005843 Ga0068860_100020778 Ga0068860_1000207785 254
6 3300013104 Ga0157370_10002991 Ga0157370_1000299120 254
7 3300025927 Ga0207687_10014462 Ga0207687_100144625 254
8 3300025934 Ga0207686_10063723 Ga0207686_100637232 254
9 3300025949 Ga0207667_10843080 Ga0207667_108430801 254
10 3300009176 Ga0105242_10025213 Ga0105242_100252134 255
11 3300013306 Ga0163162_10044253 Ga0163162_100442533 255
12 3300026089 Ga0207648_10514320 Ga0207648_105143202 255
13 3300028379 Ga0268266_10051518 Ga0268266_100515182 255
14 3300026078 Ga0207702_10649051 Ga0207702_106490512 256
15 3300006028 Ga0070717_10027930 Ga0070717_100279303 258
16 3300025924 Ga0207694_10020239 Ga0207694_100202392 258
17 3300005563 Ga0068855_100435600 Ga0068855_1004356002 259
18 3300025925 Ga0207650_10341485 Ga0207650_103414852 259
19 3300050515 nmdc:mga0a205_461159_c1 nmdc:mga0a205_461159_c1_159_950 261
20 3300005434 Ga0070709_10212524 Ga0070709_102125241 263
21 3300025939 Ga0207665_10514260 Ga0207665_105142601 263
22 3300013308 Ga0157375_10031235 Ga0157375_100312352 265
23 3300026067 Ga0207678_10021218 Ga0207678_100212182 265
24 3300035172 Ga0373955_0031171 Ga0373955_0031171_1568_2383 265
25 3300048903 Ga0496100_0204994 Ga0496100_0204994_605_1420 265
26 3300048917 Ga0496114_0001427 Ga0496114_0001427_4481_5296 265
27 3300050511 nmdc:mga08y16_282335_c1 nmdc:mga08y16_282335_c1_660_1463 265
28 3300006358 Ga0068871_100011018 Ga0068871_1000110183 266
29 3300006358 Ga0068871_100141229 Ga0068871_1001412292 266
30 3300014325 Ga0163163_10058596 Ga0163163_100585962 266
31 3300014969 Ga0157376_10034139 Ga0157376_100341392 266
32 3300035089 Ga0373944_0023163 Ga0373944_0023163_799_1605 266
33 3300035111 Ga0373923_0062149 Ga0373923_0062149_569_1375 266
34 3300035119 Ga0373956_0052039 Ga0373956_0052039_93_899 266
35 3300035170 Ga0373943_0016041 Ga0373943_0016041_1761_2567 266
36 3300035171 Ga0373946_0001093 Ga0373946_0001093_409_1215 266
37 3300035172 Ga0373955_0055184 Ga0373955_0055184_673_1479 266
38 3300035410 Ga0373924_0038479 Ga0373924_0038479_724_1530 266
39 3300035692 Ga0373935_0005770 Ga0373935_0005770_4937_5743 266
40 3300035695 Ga0373927_0102672 Ga0373927_0102672_411_1217 266
41 3300035725 Ga0373947_0004804 Ga0373947_0004804_6112_6918 266
42 3300037068 Ga0373925_0002391 Ga0373925_0002391_8143_8949 266
43 3300045051 Ga0451576_0923849 Ga0451576_0923849_83_889 266
44 3300046472 Ga0495580_0053458 Ga0495580_0053458_2010_2816 266
45 3300013308 Ga0157375_10241587 Ga0157375_102415873 267
46 3300026095 Ga0207676_10663998 Ga0207676_106639981 267
47 3300009098 Ga0105245_10016786 Ga0105245_100167866 268
48 3300009098 Ga0105245_10666729 Ga0105245_106667291 268
49 3300009177 Ga0105248_10018613 Ga0105248_100186138 268
50 3300009551 Ga0105238_10154660 Ga0105238_101546602 268
51 3300009553 Ga0105249_10029251 Ga0105249_100292514 268
52 3300011119 Ga0105246_10057601 Ga0105246_100576012 268
53 3300013307 Ga0157372_10018269 Ga0157372_100182694 268
54 3300025924 Ga0207694_10082139 Ga0207694_100821392 268
55 3300025927 Ga0207687_10005396 Ga0207687_100053962 268
56 3300025944 Ga0207661_10168633 Ga0207661_101686332 268
57 3300025961 Ga0207712_10014099 Ga0207712_100140994 268
58 3300026035 Ga0207703_10037907 Ga0207703_100379074 268
59 3300037068 Ga0373925_0245800 Ga0373925_0245800_597_1409 268
60 3300005329 Ga0070683_100308004 Ga0070683_1003080041 269
61 3300005344 Ga0070661_100109998 Ga0070661_1001099982 269
62 3300005458 Ga0070681_10039981 Ga0070681_100399812 269
63 3300005459 Ga0068867_100048561 Ga0068867_1000485612 269
64 3300005564 Ga0070664_100356473 Ga0070664_1003564732 269
65 3300005577 Ga0068857_100015444 Ga0068857_1000154446 269
66 3300005616 Ga0068852_100380915 Ga0068852_1003809152 269
67 3300006881 Ga0068865_100076088 Ga0068865_1000760882 269
68 3300009093 Ga0105240_10079637 Ga0105240_100796373 269
69 3300009098 Ga0105245_10033480 Ga0105245_100334802 269
70 3300009176 Ga0105242_10018990 Ga0105242_100189905 269
71 3300009545 Ga0105237_10011447 Ga0105237_100114477 269
72 3300009545 Ga0105237_10906951 Ga0105237_109069511 269
73 3300010375 Ga0105239_10010768 Ga0105239_100107682 269
74 3300011119 Ga0105246_10238385 Ga0105246_102383852 269
75 3300013104 Ga0157370_10001504 Ga0157370_1000150422 269
76 3300013296 Ga0157374_10015689 Ga0157374_100156892 269
77 3300013296 Ga0157374_10145927 Ga0157374_101459272 269
78 3300013306 Ga0163162_10103415 Ga0163162_101034152 269
79 3300013308 Ga0157375_10158544 Ga0157375_101585442 269
80 3300014325 Ga0163163_10018223 Ga0163163_100182236 269
81 3300014325 Ga0163163_10181053 Ga0163163_101810532 269
82 3300014968 Ga0157379_10045212 Ga0157379_100452123 269
83 3300014969 Ga0157376_10098692 Ga0157376_100986922 269
84 3300014969 Ga0157376_10478899 Ga0157376_104788992 269
85 3300025912 Ga0207707_10026825 Ga0207707_100268255 269
86 3300025913 Ga0207695_10014870 Ga0207695_100148705 269
87 3300025920 Ga0207649_10101379 Ga0207649_101013792 269
88 3300025921 Ga0207652_10099941 Ga0207652_100999412 269
89 3300025924 Ga0207694_10285155 Ga0207694_102851551 269
90 3300025927 Ga0207687_10447802 Ga0207687_104478021 269
91 3300025934 Ga0207686_10008561 Ga0207686_100085612 269
92 3300025945 Ga0207679_10076987 Ga0207679_100769872 269
93 3300026116 Ga0207674_10057457 Ga0207674_100574573 269
94 3300045051 Ga0451576_0340647 Ga0451576_0340647_547_1383 269
95 3300048911 Ga0496108_0390097 Ga0496108_0390097_157_972 269
96 3300050515 nmdc:mga0a205_46580_c1 nmdc:mga0a205_46580_c1_568_1383 269
97 3300005618 Ga0068864_100041365 Ga0068864_1000413651 270
98 3300006847 Ga0075431_100191146 Ga0075431_1001911463 270
99 3300006852 Ga0075433_10399469 Ga0075433_103994692 270
100 3300009101 Ga0105247_10016956 Ga0105247_100169562 270
101 3300014968 Ga0157379_10016206 Ga0157379_100162062 270
102 3300026118 Ga0207675_100103613 Ga0207675_1001036132 270
103 3300050507 nmdc:mga05p37_228500_c1 nmdc:mga05p37_228500_c1_476_1294 270
104 3300005466 Ga0070685_10198613 Ga0070685_101986131 271
105 3300005543 Ga0070672_100150815 Ga0070672_1001508152 271
106 3300025940 Ga0207691_10084788 Ga0207691_100847882 271
107 3300026088 Ga0207641_10076209 Ga0207641_100762093 271
108 3300006846 Ga0075430_100080721 Ga0075430_1000807213 272
109 3300009094 Ga0111539_10001859 Ga0111539_1000185911 272
110 3300009147 Ga0114129_10094418 Ga0114129_100944184 272
111 3300027907 Ga0207428_10000893 Ga0207428_1000089319 272
112 3300050509 nmdc:mga0qj67_38848_c1 nmdc:mga0qj67_38848_c1_2453_3286 272
113 3300050510 nmdc:mga06r32_177854_c1 nmdc:mga06r32_177854_c1_72_905 272
114 3300050511 nmdc:mga08y16_30185_c1 nmdc:mga08y16_30185_c1_252_1085 272
115 3300006028 Ga0070717_10051841 Ga0070717_100518413 273
116 3300006852 Ga0075433_10001205 Ga0075433_100012058 273
117 3300026089 Ga0207648_10286615 Ga0207648_102866152 273
118 3300046535 Ga0495586_0042621 Ga0495586_0042621_1547_2374 273
119 3300050512 nmdc:mga0n895_34645_c1 nmdc:mga0n895_34645_c1_1544_2371 273
120 3300050515 nmdc:mga0a205_3717_c1 nmdc:mga0a205_3717_c1_7036_7863 273
121 3300005331 Ga0070670_100033138 Ga0070670_1000331384 274
122 3300005334 Ga0068869_100136634 Ga0068869_1001366342 274
123 3300005335 Ga0070666_10143512 Ga0070666_101435122 274
124 3300005340 Ga0070689_100522430 Ga0070689_1005224301 274
125 3300005344 Ga0070661_100034142 Ga0070661_1000341422 274
126 3300005345 Ga0070692_10037049 Ga0070692_100370493 274
127 3300005353 Ga0070669_100023869 Ga0070669_1000238692 274
128 3300005354 Ga0070675_100241201 Ga0070675_1002412012 274
129 3300005364 Ga0070673_100074297 Ga0070673_1000742972 274
130 3300005365 Ga0070688_100003798 Ga0070688_1000037982 274
131 3300005365 Ga0070688_100225171 Ga0070688_1002251712 274
132 3300005367 Ga0070667_100232063 Ga0070667_1002320632 274
133 3300005439 Ga0070711_100236234 Ga0070711_1002362342 274
134 3300005441 Ga0070700_100042526 Ga0070700_1000425262 274
135 3300005445 Ga0070708_100014817 Ga0070708_1000148175 274
136 3300005456 Ga0070678_100020502 Ga0070678_1000205021 274
137 3300005518 Ga0070699_100049198 Ga0070699_1000491982 274
138 3300005544 Ga0070686_100219360 Ga0070686_1002193601 274
139 3300005549 Ga0070704_100205459 Ga0070704_1002054592 274
140 3300005564 Ga0070664_100011610 Ga0070664_1000116103 274
141 3300005617 Ga0068859_100514199 Ga0068859_1005141991 274
142 3300005719 Ga0068861_100036220 Ga0068861_1000362203 274
143 3300005840 Ga0068870_10060079 Ga0068870_100600793 274
144 3300005842 Ga0068858_100029215 Ga0068858_1000292152 274
145 3300005844 Ga0068862_100021674 Ga0068862_1000216743 274
146 3300005985 Ga0081539_10000285 Ga0081539_100002859 274
147 3300005985 Ga0081539_10008879 Ga0081539_100088795 274
148 3300006844 Ga0075428_100007944 Ga0075428_1000079448 274
149 3300006847 Ga0075431_100000646 Ga0075431_1000006464 274
150 3300006852 Ga0075433_10014476 Ga0075433_100144764 274
151 3300006871 Ga0075434_100000561 Ga0075434_10000056120 274
152 3300006880 Ga0075429_100001853 Ga0075429_10000185316 274
153 3300006931 Ga0097620_100514173 Ga0097620_1005141731 274
154 3300007076 Ga0075435_100026299 Ga0075435_1000262994 274
155 3300009094 Ga0111539_10075015 Ga0111539_100750156 274
156 3300009094 Ga0111539_10260659 Ga0111539_102606592 274
157 3300009147 Ga0114129_10070863 Ga0114129_100708634 274
158 3300009176 Ga0105242_10286948 Ga0105242_102869482 274
159 3300009177 Ga0105248_10023579 Ga0105248_100235794 274
160 3300009177 Ga0105248_10258168 Ga0105248_102581682 274
161 3300009177 Ga0105248_10392777 Ga0105248_103927772 274
162 3300009553 Ga0105249_10031356 Ga0105249_100313563 274
163 3300011119 Ga0105246_10038869 Ga0105246_100388691 274
164 3300013306 Ga0163162_10010669 Ga0163162_100106692 274
165 3300013306 Ga0163162_10076114 Ga0163162_100761142 274
166 3300013308 Ga0157375_10069163 Ga0157375_100691634 274
167 3300013308 Ga0157375_10155516 Ga0157375_101555162 274
168 3300013308 Ga0157375_10359159 Ga0157375_103591592 274
169 3300014969 Ga0157376_10004354 Ga0157376_100043543 274
170 3300014969 Ga0157376_10514622 Ga0157376_105146222 274
171 3300017792 Ga0163161_10206536 Ga0163161_102065362 274
172 3300025290 Ga0207673_1007317 Ga0207673_10073172 274
173 3300025893 Ga0207682_10009615 Ga0207682_100096152 274
174 3300025893 Ga0207682_10101309 Ga0207682_101013091 274
175 3300025901 Ga0207688_10061927 Ga0207688_100619272 274
176 3300025901 Ga0207688_10099355 Ga0207688_100993552 274
177 3300025920 Ga0207649_10019938 Ga0207649_100199382 274
178 3300025922 Ga0207646_10202570 Ga0207646_102025702 274
179 3300025923 Ga0207681_10113982 Ga0207681_101139823 274
180 3300025925 Ga0207650_10127190 Ga0207650_101271903 274
181 3300025933 Ga0207706_10040847 Ga0207706_100408472 274
182 3300025936 Ga0207670_10083015 Ga0207670_100830151 274
183 3300025938 Ga0207704_10062396 Ga0207704_100623962 274
184 3300025940 Ga0207691_10057887 Ga0207691_100578875 274
185 3300025942 Ga0207689_10054674 Ga0207689_100546742 274
186 3300025945 Ga0207679_10007752 Ga0207679_100077522 274
187 3300025960 Ga0207651_10007553 Ga0207651_100075535 274
188 3300025960 Ga0207651_10030560 Ga0207651_100305602 274
189 3300025961 Ga0207712_10347602 Ga0207712_103476021 274
190 3300025972 Ga0207668_10100065 Ga0207668_101000651 274
191 3300025986 Ga0207658_10360430 Ga0207658_103604302 274
192 3300026023 Ga0207677_10025811 Ga0207677_100258112 274
193 3300026075 Ga0207708_10068773 Ga0207708_100687731 274
194 3300026089 Ga0207648_10681460 Ga0207648_106814601 274
195 3300026095 Ga0207676_10091459 Ga0207676_100914593 274
196 3300026118 Ga0207675_100125297 Ga0207675_1001252972 274
197 3300026121 Ga0207683_10006350 Ga0207683_100063508 274
198 3300027907 Ga0207428_10030612 Ga0207428_100306122 274
199 3300028379 Ga0268266_10085852 Ga0268266_100858521 274
200 3300028381 Ga0268264_10416282 Ga0268264_104162822 274
201 3300035092 Ga0373952_0061041 Ga0373952_0061041_20_850 274
202 3300035112 Ga0373932_0039102 Ga0373932_0039102_55_885 274
203 3300036401 Ga0373937_0094792 Ga0373937_0094792_1012_1851 274
204 3300045051 Ga0451576_0214426 Ga0451576_0214426_1144_1974 274
205 3300046454 Ga0495592_0066607 Ga0495592_0066607_392_1231 274
206 3300046462 Ga0495651_0134734 Ga0495651_0134734_101_940 274
207 3300046473 Ga0495582_0143799 Ga0495582_0143799_480_1319 274
208 3300046499 Ga0495594_0131216 Ga0495594_0131216_54_893 274
209 3300046511 Ga0495608_0023997 Ga0495608_0023997_1167_2006 274
210 3300046516 Ga0495628_0278589 Ga0495628_0278589_141_980 274
211 3300046517 Ga0495630_0001346 Ga0495630_0001346_9343_10182 274
212 3300046535 Ga0495586_0111500 Ga0495586_0111500_664_1503 274
213 3300046543 Ga0495645_0162121 Ga0495645_0162121_313_1152 274
214 3300046559 Ga0495667_0042746 Ga0495667_0042746_899_1738 274
215 3300046642 Ga0495634_0025925 Ga0495634_0025925_521_1360 274
216 3300046689 Ga0495613_0000186 Ga0495613_0000186_5870_6709 274
217 3300046809 Ga0495600_0081535 Ga0495600_0081535_734_1573 274
218 3300047317 Ga0495604_0014100 Ga0495604_0014100_3424_4263 274
219 3300047319 Ga0495674_0096057 Ga0495674_0096057_1021_1860 274
220 3300047471 Ga0495684_0000188 Ga0495684_0000188_38800_39639 274
221 3300050507 nmdc:mga05p37_325392_c1 nmdc:mga05p37_325392_c1_130_969 274
222 3300050507 nmdc:mga05p37_55862_c1 nmdc:mga05p37_55862_c1_2523_3404 274
223 3300050508 nmdc:mga09592_72068_c1 nmdc:mga09592_72068_c1_1272_2102 274
224 3300050508 nmdc:mga09592_967_c1 nmdc:mga09592_967_c1_18921_19802 274
225 3300050509 nmdc:mga0qj67_4796_c1 nmdc:mga0qj67_4796_c1_798_1679 274
226 3300050510 nmdc:mga06r32_2983_c1 nmdc:mga06r32_2983_c1_6529_7410 274
227 3300050511 nmdc:mga08y16_53928_c1 nmdc:mga08y16_53928_c1_902_1732 274
228 3300050511 nmdc:mga08y16_67159_c1 nmdc:mga08y16_67159_c1_2540_3370 274
229 3300050512 nmdc:mga0n895_17965_c1 nmdc:mga0n895_17965_c1_3498_4337 274
230 3300050513 nmdc:mga0rr50_34722_c1 nmdc:mga0rr50_34722_c1_2061_2891 274
231 3300050515 nmdc:mga0a205_140147_c1 nmdc:mga0a205_140147_c1_158_988 274
232 3300050515 nmdc:mga0a205_18104_c1 nmdc:mga0a205_18104_c1_3351_4181 274
233 3300053077 Ga0495601_0005809 Ga0495601_0005809_2536_3375 274
234 3300053085 Ga0495619_0012258 Ga0495619_0012258_889_1728 274
235 3300005353 Ga0070669_100147423 Ga0070669_1001474232 275
236 3300005354 Ga0070675_100001559 Ga0070675_1000015597 275
237 3300005356 Ga0070674_100007122 Ga0070674_1000071225 275
238 3300005364 Ga0070673_100185519 Ga0070673_1001855192 275
239 3300009094 Ga0111539_10946899 Ga0111539_109468992 275
240 3300014326 Ga0157380_10018043 Ga0157380_100180432 275
241 3300025923 Ga0207681_10146763 Ga0207681_101467632 275
242 3300025926 Ga0207659_10007448 Ga0207659_100074483 275
243 3300025937 Ga0207669_10083213 Ga0207669_100832132 275
244 3300050511 nmdc:mga08y16_320650_c1 nmdc:mga08y16_320650_c1_300_1133 275
245 3300009177 Ga0105248_10298231 Ga0105248_102982312 279
246 3300005327 Ga0070658_10073797 Ga0070658_100737973 283
247 3300025909 Ga0207705_10074467 Ga0207705_100744673 283

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.8572 218 257
2oiw-assembly1.cif.gz_C the structure of a predicted thioesterase from bacillus stearothermophilus 0.6753 217 262
4hjq-assembly1.cif.gz_A shp-1 catalytic domain wpd loop closed 0.67 218 253
1z54-assembly1.cif.gz_B crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.6597 218 256
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.6588 211 259
ID Description Score Start End Superfamily
af_D3ZTI3_371_476_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7381 230 261 2.60.40.60
af_Q5NUI3_363_465_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7356 230 261 2.60.40.60
af_Q9P7J2_2_131_2.170.210.10 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal 0.7342 220 258 2.170.210.10
1o8vA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6997 145 258 2.40.128.20
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.6963 192 240 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A2V8I9H5-F1-model_v4 Uncharacterized protein 0.9741 145 261
AF-A0A1F2S5M9-F1-model_v4 Uncharacterized protein 0.9709 145 261
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9687 147 262
AF-A0A2V8I653-F1-model_v4 Uncharacterized protein 0.9657 145 259
AF-A0A7X4JET5-F1-model_v4 Uncharacterized protein 0.9644 168 261

Feature Viewer

pLDDT pTM Quality
72.84 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map