F359011

General Info

Members Datasets Scaffolds Average Seq Length
247 172 494 157

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11604288|Ga0157378_116042881
Length 182
Sequence MRRACRRGSCVFSIFEIQRLISSMAAKTSAGLLMFRRKAQNIEVLLVHPGGPFFRTKDAGAWTIPKGEVGEGEELLERAKIEFKEELGVDCTSDCIELGSIKQKGGKTVHAWAVESSLPDEFELKSNTFLLEWPPRSGRKQEFPEVDSAEFFPLAKARIKINQAQIPLLDRLVAIIGEQPND

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 1.21
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0.4
Rhizoplane 9.31
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_11604288 3300013297 Unclassified 696
2 Ga0070683_100184029 3300005329 Bacteria 1983
3 Ga0070670_101298728 3300005331 Bacteria 666
4 Ga0068869_100060911 3300005334 Bacteria 2767
5 Ga0070680_100000170 3300005336 Bacteria 41524
6 Ga0070680_100032474 3300005336 Bacteria 4202
7 Ga0070680_100087089 3300005336 Unclassified 2582
8 Ga0070682_100040838 3300005337 Bacteria 2856
9 Ga0068868_100013330 3300005338 Bacteria 6025
10 Ga0070689_100702508 3300005340 Bacteria 883
11 Ga0070687_100089019 3300005343 Bacteria 1703
12 Ga0070692_10098238 3300005345 Bacteria 1601
13 Ga0070671_100037304 3300005355 Bacteria 4030
14 Ga0070659_100034937 3300005366 Bacteria 3912
15 Ga0070703_10000021 3300005406 Bacteria 75160
16 Ga0070709_10199964 3300005434 Unclassified 1415
17 Ga0070714_100000010 3300005435 Bacteria 262871
18 Ga0070714_100050370 3300005435 Bacteria 3547
19 Ga0070713_100008304 3300005436 Bacteria 7364
20 Ga0070710_10353453 3300005437 Unclassified 973
21 Ga0070710_10601438 3300005437 Unclassified 765
22 Ga0070711_100190473 3300005439 Bacteria 1576
23 Ga0070694_100121204 3300005444 Bacteria 1877
24 Ga0070708_100006736 3300005445 Bacteria 9153
25 Ga0070708_100527776 3300005445 Bacteria 1114
26 Ga0070663_100489897 3300005455 Bacteria 1019
27 Ga0070678_100064928 3300005456 Bacteria 2708
28 Ga0070681_10027839 3300005458 Bacteria 5683
29 Ga0070681_10124339 3300005458 Bacteria 2512
30 Ga0068867_100083297 3300005459 Bacteria 2414
31 Ga0070685_10078903 3300005466 Bacteria 1969
32 Ga0070706_100067251 3300005467 Unclassified 3314
33 Ga0070707_100020787 3300005468 Bacteria 6196
34 Ga0070698_100009537 3300005471 Bacteria 10394
35 Ga0070698_100014011 3300005471 Bacteria 8479
36 Ga0070699_100332255 3300005518 Bacteria 1367
37 Ga0070679_100000758 3300005530 Bacteria 27984
38 Ga0070679_100041747 3300005530 Bacteria 4566
39 Ga0070679_100063411 3300005530 Bacteria 3683
40 Ga0070697_100440727 3300005536 Bacteria 1134
41 Ga0068853_100015424 3300005539 Bacteria 6277
42 Ga0068853_100081812 3300005539 Bacteria 2828
43 Ga0068853_100199204 3300005539 Bacteria 1822
44 Ga0070672_100747284 3300005543 Bacteria 858
45 Ga0070686_100055727 3300005544 Bacteria 2533
46 Ga0070695_100878182 3300005545 Bacteria 723
47 Ga0070693_100006505 3300005547 Bacteria 5665
48 Ga0070665_100187000 3300005548 Unclassified 2072
49 Ga0068855_100003758 3300005563 Bacteria 18557
50 Ga0068855_100037102 3300005563 Bacteria 5799
51 Ga0068855_100286878 3300005563 Bacteria 1826
52 Ga0070664_100506115 3300005564 Bacteria 1113
53 Ga0070664_101016721 3300005564 Bacteria 779
54 Ga0070664_101768565 3300005564 Bacteria 586
55 Ga0068857_100040391 3300005577 Bacteria 4137
56 Ga0068854_100110704 3300005578 Bacteria 2071
57 Ga0068854_100115867 3300005578 Bacteria 2027
58 Ga0068856_100137381 3300005614 Bacteria 2450
59 Ga0068856_100167483 3300005614 Bacteria 2209
60 Ga0068856_101120600 3300005614 Bacteria 804
61 Ga0070702_100018821 3300005615 Bacteria 3590
62 Ga0068852_100019041 3300005616 Bacteria 5424
63 Ga0068866_10012427 3300005718 Bacteria 3708
64 Ga0068851_10020963 3300005834 Bacteria 3170
65 Ga0068863_101579506 3300005841 Bacteria 665
66 Ga0068858_100268536 3300005842 Bacteria 1623
67 Ga0068860_100464815 3300005843 Bacteria 1259
68 Ga0068862_100134986 3300005844 Bacteria 2186
69 Ga0070717_10411861 3300006028 Unclassified 1215
70 Ga0075432_10147645 3300006058 Bacteria 901
71 Ga0070712_100364332 3300006175 Bacteria 1186
72 Ga0070712_100406865 3300006175 Unclassified 1125
73 Ga0068871_100367033 3300006358 Unclassified 1276
74 Ga0075428_100001331 3300006844 Bacteria 26188
75 Ga0075433_10164143 3300006852 Bacteria 1977
76 Ga0075434_100020615 3300006871 Bacteria 6397
77 Ga0075434_100064187 3300006871 Bacteria 3656
78 Ga0075434_100978796 3300006871 Unclassified 860
79 Ga0068865_100034360 3300006881 Bacteria 3401
80 Ga0075435_100157912 3300007076 Bacteria 1909
81 Ga0105240_10003178 3300009093 Bacteria 25815
82 Ga0105240_10015866 3300009093 Bacteria 10220
83 Ga0105240_10016068 3300009093 Bacteria 10144
84 Ga0111539_10786697 3300009094 Bacteria 1107
85 Ga0105245_10011136 3300009098 Bacteria 7827
86 Ga0105245_10291787 3300009098 Bacteria 1598
87 Ga0105247_11213101 3300009101 Bacteria 601
88 Ga0114129_10004479 3300009147 Bacteria 19696
89 Ga0105243_10014508 3300009148 Bacteria 5961
90 Ga0105248_10061981 3300009177 Bacteria 4200
91 Ga0105237_10111223 3300009545 Bacteria 2731
92 Ga0105238_10007218 3300009551 Bacteria 11121
93 Ga0105238_10016141 3300009551 Bacteria 7555
94 Ga0105238_10293945 3300009551 Unclassified 1607
95 Ga0105249_10198689 3300009553 Bacteria 1961
96 Ga0105239_10062380 3300010375 Bacteria 4091
97 Ga0105239_10205564 3300010375 Bacteria 2207
98 Ga0157371_10195089 3300013102 Bacteria 1450
99 Ga0157371_10310182 3300013102 Unclassified 1143
100 Ga0157370_10002871 3300013104 Bacteria 20536
101 Ga0157370_10028113 3300013104 Bacteria 5537
102 Ga0157369_10010707 3300013105 Bacteria 10436
103 Ga0157374_10054826 3300013296 Bacteria 3720
104 Ga0157374_10540649 3300013296 Bacteria 1172
105 Ga0163162_10067031 3300013306 Bacteria 3639
106 Ga0157375_10073983 3300013308 Bacteria 3427
107 Ga0157380_10304423 3300014326 Bacteria 1470
108 Ga0157377_10117273 3300014745 Bacteria 1609
109 Ga0157376_10113767 3300014969 Bacteria 2386
110 Ga0206353_11436307 3300020082 Bacteria 1015
111 Ga0213872_10007918 3300021361 Bacteria 5184
112 Ga0213872_10079659 3300021361 Unclassified 1472
113 Ga0213876_10002322 3300021384 Bacteria 11223
114 Ga0213871_10011490 3300021441 Unclassified 2035
115 Ga0213871_10034307 3300021441 Bacteria 1337
116 Ga0207656_10163056 3300025321 Bacteria 1062
117 Ga0207653_10000234 3300025885 Bacteria 36780
118 Ga0207642_10109529 3300025899 Bacteria 1403
119 Ga0207688_10513478 3300025901 Bacteria 751
120 Ga0207699_10835746 3300025906 Unclassified 678
121 Ga0207684_10000265 3300025910 Bacteria 77583
122 Ga0207654_10254739 3300025911 Bacteria 1178
123 Ga0207707_10002390 3300025912 Bacteria 16893
124 Ga0207707_10020114 3300025912 Bacteria 5826
125 Ga0207695_10006425 3300025913 Bacteria 15265
126 Ga0207695_10012246 3300025913 Bacteria 10302
127 Ga0207671_10621240 3300025914 Bacteria 861
128 Ga0207693_10262819 3300025915 Unclassified 1353
129 Ga0207660_10004178 3300025917 Bacteria 9396
130 Ga0207660_10032007 3300025917 Bacteria 3626
131 Ga0207660_10620478 3300025917 Bacteria 881
132 Ga0207662_10149549 3300025918 Bacteria 1484
133 Ga0207649_10400180 3300025920 Bacteria 1027
134 Ga0207649_10434667 3300025920 Bacteria 988
135 Ga0207652_10009887 3300025921 Bacteria 7676
136 Ga0207646_10045592 3300025922 Unclassified 3936
137 Ga0207694_10018721 3300025924 Bacteria 5234
138 Ga0207694_10040191 3300025924 Bacteria 3600
139 Ga0207694_10354447 3300025924 Unclassified 1215
140 Ga0207650_10450408 3300025925 Bacteria 1071
141 Ga0207659_10591119 3300025926 Bacteria 946
142 Ga0207687_10221510 3300025927 Bacteria 1490
143 Ga0207687_10668671 3300025927 Unclassified 880
144 Ga0207700_10021175 3300025928 Bacteria 4433
145 Ga0207664_10000009 3300025929 Bacteria 299246
146 Ga0207664_10308103 3300025929 Unclassified 1395
147 Ga0207664_10435944 3300025929 Bacteria 1168
148 Ga0207690_10325375 3300025932 Bacteria 1209
149 Ga0207686_10149456 3300025934 Bacteria 1624
150 Ga0207709_10074593 3300025935 Bacteria 2165
151 Ga0207670_10334881 3300025936 Bacteria 1194
152 Ga0207669_10045870 3300025937 Bacteria 2579
153 Ga0207704_10239676 3300025938 Bacteria 1354
154 Ga0207691_10032047 3300025940 Bacteria 4903
155 Ga0207711_10606735 3300025941 Bacteria 1021
156 Ga0207679_11649703 3300025945 Bacteria 587
157 Ga0207667_10711115 3300025949 Bacteria 1006
158 Ga0207651_11502153 3300025960 Bacteria 607
159 Ga0207712_10337195 3300025961 Bacteria 1249
160 Ga0207640_10115562 3300025981 Bacteria 1911
161 Ga0207640_10124370 3300025981 Bacteria 1854
162 Ga0207677_10073138 3300026023 Bacteria 2426
163 Ga0207677_10155012 3300026023 Bacteria 1772
164 Ga0207703_10238078 3300026035 Bacteria 1635
165 Ga0207639_10156098 3300026041 Bacteria 1917
166 Ga0207639_10201983 3300026041 Bacteria 1705
167 Ga0207708_10013043 3300026075 Bacteria 6201
168 Ga0207702_10137832 3300026078 Unclassified 2204
169 Ga0207702_10261865 3300026078 Bacteria 1628
170 Ga0207702_10358965 3300026078 Bacteria 1396
171 Ga0207676_11578960 3300026095 Bacteria 654
172 Ga0207674_10040585 3300026116 Bacteria 4820
173 Ga0207675_101109296 3300026118 Unclassified 811
174 Ga0207683_10090306 3300026121 Bacteria 2728
175 Ga0268266_10142889 3300028379 Bacteria 2149
176 Ga0268265_11005802 3300028380 Bacteria 824
177 Ga0307511_10199807 3300030521 Bacteria 1040
178 Ga0316578_10029786 3300031728 Bacteria 3100
179 Ga0307412_10867127 3300031911 Bacteria 789
180 Ga0307416_101096996 3300032002 Bacteria 900
181 Ga0316574_0014552 3300035398 Unclassified 4548
182 Ga0395900_0057668 3300037418 Bacteria 3998
183 Ga0395900_0607190 3300037418 Bacteria 1034
184 Ga0395898_0024841 3300037466 Bacteria 6041
185 Ga0395898_0173387 3300037466 Bacteria 2062
186 Ga0395898_0766379 3300037466 Bacteria 906
187 Ga0436364_1386443 3300037853 Unclassified 1864
188 Ga0436365_1583419 3300039437 Bacteria 23084
189 Ga0436360_0069430 3300039438 Bacteria 915
190 Ga0436360_0335075 3300039438 Bacteria 9886
191 Ga0436360_0437203 3300039438 Bacteria 3899
192 Ga0436360_0830789 3300039438 Bacteria 681
193 Ga0436360_1260191 3300039438 Unclassified 2242
194 Ga0436361_0001946 3300039447 Bacteria 10116
195 Ga0436361_0013614 3300039447 Bacteria 3104
196 Ga0436361_0296280 3300039447 Plasmid 3711
197 Ga0436361_0831058 3300039447 Bacteria 4794
198 Ga0436361_1016014 3300039447 Bacteria 1384
199 Ga0436362_0497094 3300039453 Bacteria 2472
200 Ga0451853_2444083 3300041512 Bacteria 2646
201 Ga0439462_0137018 3300042015 Bacteria 685
202 Ga0451577_0004944 3300042876 Bacteria 13865
203 Ga0466972_0009021 3300044658 Bacteria 5005
204 Ga0466963_0318564 3300044694 Bacteria 1094
205 Ga0466959_0293733 3300045049 Bacteria 1114
206 Ga0451576_0025895 3300045051 Bacteria 6317
207 Ga0451576_0043365 3300045051 Bacteria 4747
208 Ga0451576_0419001 3300045051 Bacteria 1405
209 Ga0466967_0197291 3300045976 Unclassified 1905
210 Ga0466967_0265261 3300045976 Bacteria 1644
211 Ga0466967_0335194 3300045976 Bacteria 1461
212 Ga0466967_0507925 3300045976 Bacteria 1183
213 Ga0496100_0257447 3300048903 Bacteria 1293
214 Ga0496101_0091721 3300048904 Bacteria 2261
215 Ga0496101_0194955 3300048904 Bacteria 1564
216 Ga0496101_0589743 3300048904 Bacteria 879
217 Ga0496102_0084487 3300048905 Bacteria 2930
218 Ga0496104_0888662 3300048907 Bacteria 796
219 Ga0496105_0287124 3300048908 Bacteria 1325
220 Ga0496105_1154552 3300048908 Bacteria 572
221 Ga0496107_0147254 3300048910 Bacteria 1741
222 Ga0496108_0008794 3300048911 Bacteria 8185
223 Ga0496108_0257810 3300048911 Bacteria 1517
224 Ga0496108_0275661 3300048911 Bacteria 1464
225 Ga0496109_0283487 3300048912 Bacteria 1561
226 Ga0496109_0944035 3300048912 Bacteria 800
227 Ga0496110_0126560 3300048913 Bacteria 2305
228 Ga0496110_0316760 3300048913 Bacteria 1421
229 Ga0496111_0068221 3300048914 Bacteria 2584
230 Ga0496112_0232380 3300048915 Bacteria 1798
231 Ga0496112_0514354 3300048915 Bacteria 1132
232 Ga0496113_0006551 3300048916 Bacteria 7392
233 Ga0496113_0070411 3300048916 Bacteria 2659
234 Ga0496113_0090509 3300048916 Bacteria 2357
235 Ga0496114_0019883 3300048917 Bacteria 5445
236 Ga0501299_098180 3300049522 Unclassified 676
237 Ga0501313_020752 3300049529 Bacteria 811
238 Ga0501315_030181 3300049531 Unclassified 777
239 Ga0501266_015724 3300049763 Unclassified 1002
240 nmdc:mga07m45_360872_c1 3300050496 Unclassified 844
241 nmdc:mga0n895_102306_c1 3300050512 Bacteria 2875
242 nmdc:mga0n895_288875_c1 3300050512 Bacteria 1663
243 nmdc:mga0a205_992202_c1 3300050515 Bacteria 687
244 nmdc:mga0a205_999886_c1 3300050515 Bacteria 683
245 Ga0500556_0000110 3300053104 Bacteria 73102
246 Ga0500645_050710 3300053730 Bacteria 1211
247 2509147963 2508501128 Bacteria 8613869
248 Ga0157378_11604288
249 Ga0070683_100184029
250 Ga0070670_101298728
251 Ga0068869_100060911
252 Ga0070680_100000170
253 Ga0070680_100032474
254 Ga0070680_100087089
255 Ga0070682_100040838
256 Ga0068868_100013330
257 Ga0070689_100702508
258 Ga0070687_100089019
259 Ga0070692_10098238
260 Ga0070671_100037304
261 Ga0070659_100034937
262 Ga0070703_10000021
263 Ga0070709_10199964
264 Ga0070714_100000010
265 Ga0070714_100050370
266 Ga0070713_100008304
267 Ga0070710_10353453
268 Ga0070710_10601438
269 Ga0070711_100190473
270 Ga0070694_100121204
271 Ga0070708_100006736
272 Ga0070708_100527776
273 Ga0070663_100489897
274 Ga0070678_100064928
275 Ga0070681_10027839
276 Ga0070681_10124339
277 Ga0068867_100083297
278 Ga0070685_10078903
279 Ga0070706_100067251
280 Ga0070707_100020787
281 Ga0070698_100009537
282 Ga0070698_100014011
283 Ga0070699_100332255
284 Ga0070679_100000758
285 Ga0070679_100041747
286 Ga0070679_100063411
287 Ga0070697_100440727
288 Ga0068853_100015424
289 Ga0068853_100081812
290 Ga0068853_100199204
291 Ga0070672_100747284
292 Ga0070686_100055727
293 Ga0070695_100878182
294 Ga0070693_100006505
295 Ga0070665_100187000
296 Ga0068855_100003758
297 Ga0068855_100037102
298 Ga0068855_100286878
299 Ga0070664_100506115
300 Ga0070664_101016721
301 Ga0070664_101768565
302 Ga0068857_100040391
303 Ga0068854_100110704
304 Ga0068854_100115867
305 Ga0068856_100137381
306 Ga0068856_100167483
307 Ga0068856_101120600
308 Ga0070702_100018821
309 Ga0068852_100019041
310 Ga0068866_10012427
311 Ga0068851_10020963
312 Ga0068863_101579506
313 Ga0068858_100268536
314 Ga0068860_100464815
315 Ga0068862_100134986
316 Ga0070717_10411861
317 Ga0075432_10147645
318 Ga0070712_100364332
319 Ga0070712_100406865
320 Ga0068871_100367033
321 Ga0075428_100001331
322 Ga0075433_10164143
323 Ga0075434_100020615
324 Ga0075434_100064187
325 Ga0075434_100978796
326 Ga0068865_100034360
327 Ga0075435_100157912
328 Ga0105240_10003178
329 Ga0105240_10015866
330 Ga0105240_10016068
331 Ga0111539_10786697
332 Ga0105245_10011136
333 Ga0105245_10291787
334 Ga0105247_11213101
335 Ga0114129_10004479
336 Ga0105243_10014508
337 Ga0105248_10061981
338 Ga0105237_10111223
339 Ga0105238_10007218
340 Ga0105238_10016141
341 Ga0105238_10293945
342 Ga0105249_10198689
343 Ga0105239_10062380
344 Ga0105239_10205564
345 Ga0157371_10195089
346 Ga0157371_10310182
347 Ga0157370_10002871
348 Ga0157370_10028113
349 Ga0157369_10010707
350 Ga0157374_10054826
351 Ga0157374_10540649
352 Ga0163162_10067031
353 Ga0157375_10073983
354 Ga0157380_10304423
355 Ga0157377_10117273
356 Ga0157376_10113767
357 Ga0206353_11436307
358 Ga0213872_10007918
359 Ga0213872_10079659
360 Ga0213876_10002322
361 Ga0213871_10011490
362 Ga0213871_10034307
363 Ga0207656_10163056
364 Ga0207653_10000234
365 Ga0207642_10109529
366 Ga0207688_10513478
367 Ga0207699_10835746
368 Ga0207684_10000265
369 Ga0207654_10254739
370 Ga0207707_10002390
371 Ga0207707_10020114
372 Ga0207695_10006425
373 Ga0207695_10012246
374 Ga0207671_10621240
375 Ga0207693_10262819
376 Ga0207660_10004178
377 Ga0207660_10032007
378 Ga0207660_10620478
379 Ga0207662_10149549
380 Ga0207649_10400180
381 Ga0207649_10434667
382 Ga0207652_10009887
383 Ga0207646_10045592
384 Ga0207694_10018721
385 Ga0207694_10040191
386 Ga0207694_10354447
387 Ga0207650_10450408
388 Ga0207659_10591119
389 Ga0207687_10221510
390 Ga0207687_10668671
391 Ga0207700_10021175
392 Ga0207664_10000009
393 Ga0207664_10308103
394 Ga0207664_10435944
395 Ga0207690_10325375
396 Ga0207686_10149456
397 Ga0207709_10074593
398 Ga0207670_10334881
399 Ga0207669_10045870
400 Ga0207704_10239676
401 Ga0207691_10032047
402 Ga0207711_10606735
403 Ga0207679_11649703
404 Ga0207667_10711115
405 Ga0207651_11502153
406 Ga0207712_10337195
407 Ga0207640_10115562
408 Ga0207640_10124370
409 Ga0207677_10073138
410 Ga0207677_10155012
411 Ga0207703_10238078
412 Ga0207639_10156098
413 Ga0207639_10201983
414 Ga0207708_10013043
415 Ga0207702_10137832
416 Ga0207702_10261865
417 Ga0207702_10358965
418 Ga0207676_11578960
419 Ga0207674_10040585
420 Ga0207675_101109296
421 Ga0207683_10090306
422 Ga0268266_10142889
423 Ga0268265_11005802
424 Ga0307511_10199807
425 Ga0316578_10029786
426 Ga0307412_10867127
427 Ga0307416_101096996
428 Ga0316574_0014552
429 Ga0395900_0057668
430 Ga0395900_0607190
431 Ga0395898_0024841
432 Ga0395898_0173387
433 Ga0395898_0766379
434 Ga0436364_1386443
435 Ga0436365_1583419
436 Ga0436360_0069430
437 Ga0436360_0335075
438 Ga0436360_0437203
439 Ga0436360_0830789
440 Ga0436360_1260191
441 Ga0436361_0001946
442 Ga0436361_0013614
443 Ga0436361_0296280
444 Ga0436361_0831058
445 Ga0436361_1016014
446 Ga0436362_0497094
447 Ga0451853_2444083
448 Ga0439462_0137018
449 Ga0451577_0004944
450 Ga0466972_0009021
451 Ga0466963_0318564
452 Ga0466959_0293733
453 Ga0451576_0025895
454 Ga0451576_0043365
455 Ga0451576_0419001
456 Ga0466967_0197291
457 Ga0466967_0265261
458 Ga0466967_0335194
459 Ga0466967_0507925
460 Ga0496100_0257447
461 Ga0496101_0091721
462 Ga0496101_0194955
463 Ga0496101_0589743
464 Ga0496102_0084487
465 Ga0496104_0888662
466 Ga0496105_0287124
467 Ga0496105_1154552
468 Ga0496107_0147254
469 Ga0496108_0008794
470 Ga0496108_0257810
471 Ga0496108_0275661
472 Ga0496109_0283487
473 Ga0496109_0944035
474 Ga0496110_0126560
475 Ga0496110_0316760
476 Ga0496111_0068221
477 Ga0496112_0232380
478 Ga0496112_0514354
479 Ga0496113_0006551
480 Ga0496113_0070411
481 Ga0496113_0090509
482 Ga0496114_0019883
483 Ga0501299_098180
484 Ga0501313_020752
485 Ga0501315_030181
486 Ga0501266_015724
487 nmdc:mga07m45_360872_c1
488 nmdc:mga0n895_102306_c1
489 nmdc:mga0n895_288875_c1
490 nmdc:mga0a205_992202_c1
491 nmdc:mga0a205_999886_c1
492 Ga0500556_0000110
493 Ga0500645_050710
494 2509147963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

26

172

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.8145 12 162
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.8033 12 162
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.7909 9 157
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.7844 10 159
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.77 9 157
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9805 10 155 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9611 10 155 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7844 10 159 3.90.79.10
af_Q4V6M1_1_140_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7745 10 161 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7679 10 159 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A3C2A809-F1-model_v4 NUDIX hydrolase 0.9944 9 160 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.993 10 159 GO:0004081
GO:0006167
GO:0006754
AF-A0A1V4XNX3-F1-model_v4 NUDIX domain protein 0.9905 11 160 GO:0004081
GO:0006167
GO:0006754
AF-A0A2H5V557-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) 0.9904 10 161 GO:0004081
GO:0006167
GO:0006754
AF-A0A1F8L2Q9-F1-model_v4 Nudix hydrolase domain-containing protein 0.9901 9 162 GO:0004081
GO:0006167
GO:0006754

Map