F358428

General Info

Members Datasets Scaffolds Average Seq Length
246 147 492 344

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0144832|Ga0495580_0144832_243_1355
Length 370
Sequence MELRGTKSEFRSRRIEGEEDKLGTIWFCLVAVMLTVYVLLDGFDLGAGAIHLLIAKTDEERRQILASIGPVWDGNEVWLLAAGGTLYFAFPALYASGFSGFYLPLMMVLWLLILRGSSIEFRNHVKSAVWDPLWDFLFCASSLLLAVFYGAALANVVRGVPLDASGYFFEPLWTNFRLGEETGILDWYTIMVGVLALLALVMHGALWVHLKTTGAVNDRAKKLAGHVWWGVVALTALVTAVTFQVQPQIKENFVTWPLGFVLPLLAVAGLAGVAFELRKHNEQKAFFASCAYLVGMLTSVVFGVYPMVLPARNPVFSLTVDAAKAGAYGLKVGIIWWIVGMILAAGYFTFVYRSFAGKVEANGDSNGHGS

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0144832 3300046472 Unclassified 1647
2 rootH1_10051316 3300003323 Bacteria 4112
3 Ga0070658_10000773 3300005327 Bacteria 27492
4 Ga0068868_100039427 3300005338 Bacteria 3670
5 Ga0070660_100051229 3300005339 Bacteria 3178
6 Ga0070689_100000004 3300005340 Bacteria 497771
7 Ga0070674_100301217 3300005356 Bacteria 1278
8 Ga0070688_100009946 3300005365 Bacteria 5225
9 Ga0070709_10001096 3300005434 Bacteria 14944
10 Ga0070709_10065234 3300005434 Bacteria 2331
11 Ga0070709_10083660 3300005434 Bacteria 2088
12 Ga0070709_10223401 3300005434 Bacteria 1344
13 Ga0070713_100030501 3300005436 Bacteria 4283
14 Ga0070713_100188028 3300005436 Bacteria 1859
15 Ga0070705_100278511 3300005440 Unclassified 1188
16 Ga0070700_100077439 3300005441 Bacteria 2138
17 Ga0070694_100130608 3300005444 Bacteria 1814
18 Ga0070708_100009011 3300005445 Bacteria 8043
19 Ga0070708_100019866 3300005445 Bacteria 5652
20 Ga0070708_100035096 3300005445 Bacteria 4367
21 Ga0070708_100076863 3300005445 Bacteria 3016
22 Ga0070708_100165645 3300005445 Unclassified 2062
23 Ga0070708_100241861 3300005445 Bacteria 1694
24 Ga0070685_10065789 3300005466 Bacteria 2134
25 Ga0070706_100003813 3300005467 Bacteria 14729
26 Ga0070706_100098807 3300005467 Bacteria 2712
27 Ga0070706_100155924 3300005467 Bacteria 2131
28 Ga0070706_100196546 3300005467 Bacteria 1884
29 Ga0070707_100000674 3300005468 Bacteria 33906
30 Ga0070707_100001679 3300005468 Bacteria 21374
31 Ga0070707_100008061 3300005468 Bacteria 9779
32 Ga0070707_100071304 3300005468 Bacteria 3347
33 Ga0070698_100005849 3300005471 Bacteria 13441
34 Ga0070698_100009881 3300005471 Bacteria 10202
35 Ga0070698_100177092 3300005471 Bacteria 2072
36 Ga0070699_100034609 3300005518 Bacteria 4366
37 Ga0070699_100039069 3300005518 Bacteria 4109
38 Ga0070699_100132033 3300005518 Bacteria 2201
39 Ga0070699_100144372 3300005518 Bacteria 2103
40 Ga0070699_100264990 3300005518 Bacteria 1537
41 Ga0070679_100017887 3300005530 Bacteria 6866
42 Ga0070697_100001223 3300005536 Bacteria 19381
43 Ga0070697_100055359 3300005536 Bacteria 3225
44 Ga0070697_100168321 3300005536 Bacteria 1854
45 Ga0070686_100064225 3300005544 Bacteria 2381
46 Ga0070695_100124232 3300005545 Bacteria 1770
47 Ga0070693_100034608 3300005547 Bacteria 2796
48 Ga0070665_100005312 3300005548 Bacteria 13304
49 Ga0070665_100231770 3300005548 Bacteria 1847
50 Ga0068859_100012162 3300005617 Bacteria 8650
51 Ga0068864_100158911 3300005618 Unclassified 2053
52 Ga0068863_100002345 3300005841 Bacteria 18827
53 Ga0068863_100264572 3300005841 Bacteria 1663
54 Ga0068858_100004817 3300005842 Bacteria 13220
55 Ga0070717_10029676 3300006028 Bacteria 4390
56 Ga0070717_10270142 3300006028 Bacteria 1506
57 Ga0070716_100000036 3300006173 Bacteria 56048
58 Ga0070716_100017290 3300006173 Bacteria 3735
59 Ga0070716_100035974 3300006173 Bacteria 2727
60 Ga0070716_100124341 3300006173 Bacteria 1620
61 Ga0070712_100175961 3300006175 Bacteria 1664
62 Ga0097621_100002876 3300006237 Bacteria 11810
63 Ga0075428_100016274 3300006844 Bacteria 8221
64 Ga0075428_100081606 3300006844 Bacteria 3529
65 Ga0075431_100081028 3300006847 Bacteria 3351
66 Ga0075436_100050247 3300006914 Bacteria 2877
67 Ga0075436_100097159 3300006914 Unclassified 2049
68 Ga0097620_100012162 3300006931 Bacteria 8650
69 Ga0075435_100152132 3300007076 Unclassified 1946
70 Ga0075435_100185594 3300007076 Bacteria 1759
71 Ga0099794_10002197 3300007265 Bacteria 7125
72 Ga0099794_10005995 3300007265 Bacteria 4906
73 Ga0099794_10010921 3300007265 Unclassified 3872
74 Ga0099794_10018390 3300007265 Bacteria 3133
75 Ga0099794_10023716 3300007265 Bacteria 2810
76 Ga0099794_10026671 3300007265 Bacteria 2673
77 Ga0099794_10046378 3300007265 Bacteria 2082
78 Ga0111539_10000976 3300009094 Bacteria 37564
79 Ga0111539_10029496 3300009094 Bacteria 6681
80 Ga0105247_10112781 3300009101 Bacteria 1752
81 Ga0105247_10229635 3300009101 Bacteria 1259
82 Ga0114129_10414733 3300009147 Bacteria 1772
83 Ga0105242_10122678 3300009176 Bacteria 2232
84 Ga0105242_10358918 3300009176 Bacteria 1348
85 Ga0105248_10016279 3300009177 Bacteria 8186
86 Ga0105248_10079534 3300009177 Bacteria 3685
87 Ga0105248_10115009 3300009177 Bacteria 3034
88 Ga0105237_10000515 3300009545 Bacteria 54641
89 Ga0105249_10166058 3300009553 Bacteria 2137
90 Ga0099796_10013733 3300010159 Unclassified 2321
91 Ga0099796_10024137 3300010159 Bacteria 1906
92 Ga0157374_10254193 3300013296 Unclassified 1730
93 Ga0163162_10102228 3300013306 Bacteria 2959
94 Ga0157375_10526602 3300013308 Unclassified 1345
95 Ga0163163_10034407 3300014325 Bacteria 4906
96 Ga0163163_10123131 3300014325 Bacteria 2629
97 Ga0157380_10108315 3300014326 Bacteria 2329
98 Ga0157379_10011293 3300014968 Bacteria 7784
99 Ga0157376_10000023 3300014969 Bacteria 223978
100 Ga0157376_10204225 3300014969 Bacteria 1820
101 Ga0213876_10009662 3300021384 Bacteria 5192
102 Ga0228598_1010702 3300024227 Bacteria 1826
103 Ga0207656_10033804 3300025321 Bacteria 2132
104 Ga0207699_10013429 3300025906 Bacteria 4192
105 Ga0207699_10100214 3300025906 Bacteria 1837
106 Ga0207705_10004225 3300025909 Bacteria 10879
107 Ga0207684_10139516 3300025910 Bacteria 2083
108 Ga0207684_10242755 3300025910 Bacteria 1554
109 Ga0207707_10189296 3300025912 Bacteria 1795
110 Ga0207671_10000040 3300025914 Bacteria 216380
111 Ga0207693_10039637 3300025915 Bacteria 3710
112 Ga0207693_10193108 3300025915 Bacteria 1602
113 Ga0207663_10203140 3300025916 Unclassified 1431
114 Ga0207660_10017823 3300025917 Bacteria 4725
115 Ga0207657_10028415 3300025919 Bacteria 5101
116 Ga0207652_10001329 3300025921 Bacteria 21947
117 Ga0207646_10000165 3300025922 Bacteria 89540
118 Ga0207646_10000598 3300025922 Bacteria 46947
119 Ga0207646_10009201 3300025922 Bacteria 9793
120 Ga0207646_10076016 3300025922 Bacteria 3001
121 Ga0207646_10166966 3300025922 Bacteria 1987
122 Ga0207646_10342501 3300025922 Bacteria 1351
123 Ga0207700_10094136 3300025928 Bacteria 2373
124 Ga0207700_10114263 3300025928 Unclassified 2178
125 Ga0207700_10150738 3300025928 Bacteria 1921
126 Ga0207686_10073669 3300025934 Bacteria 2204
127 Ga0207670_10000007 3300025936 Bacteria 376171
128 Ga0207670_10159016 3300025936 Bacteria 1684
129 Ga0207665_10000024 3300025939 Bacteria 101596
130 Ga0207665_10010038 3300025939 Bacteria 6217
131 Ga0207665_10027204 3300025939 Bacteria 3779
132 Ga0207665_10109193 3300025939 Bacteria 1941
133 Ga0207665_10163353 3300025939 Bacteria 1603
134 Ga0207691_10441818 3300025940 Unclassified 1107
135 Ga0207711_10010305 3300025941 Bacteria 7763
136 Ga0207711_10070659 3300025941 Bacteria 3028
137 Ga0207679_10303305 3300025945 Bacteria 1377
138 Ga0207677_10031836 3300026023 Bacteria 3382
139 Ga0207677_10435904 3300026023 Bacteria 1120
140 Ga0207703_10003923 3300026035 Bacteria 12354
141 Ga0207708_10053997 3300026075 Bacteria 3062
142 Ga0207641_10006841 3300026088 Bacteria 9547
143 Ga0207698_10169922 3300026142 Bacteria 1918
144 Ga0209588_1000922 3300027671 Bacteria 7491
145 Ga0209588_1012164 3300027671 Bacteria 2610
146 Ga0209588_1016639 3300027671 Bacteria 2272
147 Ga0207428_10006836 3300027907 Bacteria 10457
148 Ga0207428_10012346 3300027907 Bacteria 7509
149 Ga0268266_10000276 3300028379 Bacteria 84981
150 Ga0265338_10009141 3300028800 Bacteria 11897
151 Ga0265325_10047840 3300031241 Unclassified 2213
152 Ga0316575_10007500 3300031665 Bacteria 3951
153 Ga0373934_0008567 3300035086 Bacteria 3814
154 Ga0373940_0011295 3300035088 Bacteria 2119
155 Ga0373923_0086097 3300035111 Unclassified 1369
156 Ga0373945_0055432 3300035116 Bacteria 1468
157 Ga0373953_0025075 3300035117 Bacteria 2274
158 Ga0373953_0028390 3300035117 Bacteria 2157
159 Ga0373954_0003566 3300035118 Bacteria 6614
160 Ga0373954_0021115 3300035118 Bacteria 2947
161 Ga0373956_0006157 3300035119 Bacteria 4798
162 Ga0373956_0053006 3300035119 Bacteria 1825
163 Ga0373955_0006404 3300035172 Bacteria 5365
164 Ga0373935_0176296 3300035692 Bacteria 1465
165 Ga0373927_0002363 3300035695 Bacteria 13745
166 Ga0373927_0004703 3300035695 Bacteria 9513
167 Ga0373927_0086569 3300035695 Bacteria 2034
168 Ga0373933_0004142 3300035724 Bacteria 7986
169 Ga0373947_0019155 3300035725 Bacteria 3945
170 Ga0373947_0038416 3300035725 Bacteria 2844
171 Ga0373937_0000020 3300036401 Bacteria 131263
172 Ga0373937_0037505 3300036401 Bacteria 4417
173 Ga0373937_0097638 3300036401 Bacteria 2725
174 Ga0373925_0001716 3300037068 Bacteria 18475
175 Ga0395900_0003956 3300037418 Bacteria 15819
176 Ga0395898_0079821 3300037466 Bacteria 3156
177 Ga0436364_1307853 3300037853 Bacteria 1507
178 Ga0436365_0849428 3300039437 Bacteria 2878
179 Ga0451577_0053152 3300042876 Bacteria 3617
180 Ga0451577_0100516 3300042876 Unclassified 2583
181 Ga0451577_0258062 3300042876 Bacteria 1578
182 Ga0453683_0004968 3300044673 Bacteria 9344
183 Ga0453683_0010739 3300044673 Bacteria 6064
184 Ga0453683_0020402 3300044673 Bacteria 4234
185 Ga0453683_0100183 3300044673 Bacteria 1819
186 Ga0453684_0018874 3300044712 Bacteria 10549
187 Ga0453684_0229023 3300044712 Bacteria 2147
188 Ga0453684_0523168 3300044712 Bacteria 1310
189 Ga0451576_0095124 3300045051 Bacteria 3098
190 Ga0451576_0240163 3300045051 Bacteria 1892
191 Ga0451576_0334963 3300045051 Bacteria 1584
192 Ga0451576_0387836 3300045051 Bacteria 1464
193 Ga0495592_0048747 3300046454 Bacteria 3150
194 Ga0495603_0044081 3300046455 Bacteria 2662
195 Ga0495629_0004192 3300046459 Bacteria 10823
196 Ga0495651_0073417 3300046462 Bacteria 2597
197 Ga0495651_0077524 3300046462 Bacteria 2516
198 Ga0495653_0220579 3300046463 Bacteria 1275
199 Ga0495580_0001960 3300046472 Bacteria 18074
200 Ga0495580_0083677 3300046472 Bacteria 2223
201 Ga0495582_0000232 3300046473 Bacteria 30900
202 Ga0495639_0003056 3300046475 Bacteria 7286
203 Ga0495664_0047303 3300046477 Bacteria 2553
204 Ga0495594_0055757 3300046499 Bacteria 2179
205 Ga0495608_0006844 3300046511 Bacteria 8080
206 Ga0495640_0041367 3300046533 Bacteria 3221
207 Ga0495586_0055222 3300046535 Bacteria 2152
208 Ga0495587_0001958 3300046536 Bacteria 13726
209 Ga0495587_0003252 3300046536 Bacteria 10857
210 Ga0495645_0057420 3300046543 Bacteria 2825
211 Ga0495667_0198231 3300046559 Bacteria 1285
212 Ga0495634_0027526 3300046642 Unclassified 3955
213 Ga0495635_0127172 3300046663 Bacteria 1738
214 Ga0495623_0010041 3300046679 Bacteria 6129
215 Ga0495623_0164657 3300046679 Bacteria 1300
216 Ga0495647_0000482 3300046681 Bacteria 11596
217 Ga0495658_0062040 3300046683 Bacteria 2148
218 Ga0495613_0048671 3300046689 Unclassified 3130
219 Ga0495624_0097612 3300046690 Bacteria 1810
220 Ga0495600_0063625 3300046809 Bacteria 2411
221 Ga0495600_0080633 3300046809 Bacteria 2125
222 Ga0495604_0046454 3300047317 Bacteria 3385
223 Ga0495604_0079197 3300047317 Bacteria 2464
224 Ga0495674_0092639 3300047319 Bacteria 2579
225 Ga0495676_0156641 3300047321 Bacteria 1615
226 Ga0495675_0010041 3300047444 Bacteria 5906
227 Ga0495684_0107417 3300047471 Bacteria 2108
228 Ga0495602_0000417 3300048088 Bacteria 39873
229 Ga0495602_0005048 3300048088 Bacteria 13819
230 Ga0496104_0335466 3300048907 Bacteria 1425
231 Ga0496114_0062298 3300048917 Bacteria 3122
232 Ga0496115_0144246 3300048918 Bacteria 1965
233 Ga0501073_0212696 3300049589 Unclassified 1336
234 nmdc:mga08y16_202_c1 3300050511 Bacteria 53486
235 nmdc:mga08y16_4288_c1 3300050511 Bacteria 14886
236 nmdc:mga08y16_70011_c1 3300050511 Bacteria 3657
237 nmdc:mga0n895_114884_c1 3300050512 Bacteria 2710
238 nmdc:mga0n895_22652_c1 3300050512 Bacteria 5891
239 nmdc:mga0rr50_304826_c1 3300050513 Unclassified 1333
240 nmdc:mga0rr50_90642_c1 3300050513 Unclassified 2379
241 nmdc:mga08x19_6906_c1 3300050514 Bacteria 6743
242 nmdc:mga08x19_83656_c1 3300050514 Unclassified 2098
243 nmdc:mga0a205_2099_c1 3300050515 Bacteria 17471
244 nmdc:mga0a205_37364_c1 3300050515 Bacteria 4670
245 Ga0495619_0030022 3300053085 Unclassified 3517
246 Ga0495619_0205730 3300053085 Bacteria 1363
247 Ga0495580_0144832
248 rootH1_10051316
249 Ga0070658_10000773
250 Ga0068868_100039427
251 Ga0070660_100051229
252 Ga0070689_100000004
253 Ga0070674_100301217
254 Ga0070688_100009946
255 Ga0070709_10001096
256 Ga0070709_10065234
257 Ga0070709_10083660
258 Ga0070709_10223401
259 Ga0070713_100030501
260 Ga0070713_100188028
261 Ga0070705_100278511
262 Ga0070700_100077439
263 Ga0070694_100130608
264 Ga0070708_100009011
265 Ga0070708_100019866
266 Ga0070708_100035096
267 Ga0070708_100076863
268 Ga0070708_100165645
269 Ga0070708_100241861
270 Ga0070685_10065789
271 Ga0070706_100003813
272 Ga0070706_100098807
273 Ga0070706_100155924
274 Ga0070706_100196546
275 Ga0070707_100000674
276 Ga0070707_100001679
277 Ga0070707_100008061
278 Ga0070707_100071304
279 Ga0070698_100005849
280 Ga0070698_100009881
281 Ga0070698_100177092
282 Ga0070699_100034609
283 Ga0070699_100039069
284 Ga0070699_100132033
285 Ga0070699_100144372
286 Ga0070699_100264990
287 Ga0070679_100017887
288 Ga0070697_100001223
289 Ga0070697_100055359
290 Ga0070697_100168321
291 Ga0070686_100064225
292 Ga0070695_100124232
293 Ga0070693_100034608
294 Ga0070665_100005312
295 Ga0070665_100231770
296 Ga0068859_100012162
297 Ga0068864_100158911
298 Ga0068863_100002345
299 Ga0068863_100264572
300 Ga0068858_100004817
301 Ga0070717_10029676
302 Ga0070717_10270142
303 Ga0070716_100000036
304 Ga0070716_100017290
305 Ga0070716_100035974
306 Ga0070716_100124341
307 Ga0070712_100175961
308 Ga0097621_100002876
309 Ga0075428_100016274
310 Ga0075428_100081606
311 Ga0075431_100081028
312 Ga0075436_100050247
313 Ga0075436_100097159
314 Ga0097620_100012162
315 Ga0075435_100152132
316 Ga0075435_100185594
317 Ga0099794_10002197
318 Ga0099794_10005995
319 Ga0099794_10010921
320 Ga0099794_10018390
321 Ga0099794_10023716
322 Ga0099794_10026671
323 Ga0099794_10046378
324 Ga0111539_10000976
325 Ga0111539_10029496
326 Ga0105247_10112781
327 Ga0105247_10229635
328 Ga0114129_10414733
329 Ga0105242_10122678
330 Ga0105242_10358918
331 Ga0105248_10016279
332 Ga0105248_10079534
333 Ga0105248_10115009
334 Ga0105237_10000515
335 Ga0105249_10166058
336 Ga0099796_10013733
337 Ga0099796_10024137
338 Ga0157374_10254193
339 Ga0163162_10102228
340 Ga0157375_10526602
341 Ga0163163_10034407
342 Ga0163163_10123131
343 Ga0157380_10108315
344 Ga0157379_10011293
345 Ga0157376_10000023
346 Ga0157376_10204225
347 Ga0213876_10009662
348 Ga0228598_1010702
349 Ga0207656_10033804
350 Ga0207699_10013429
351 Ga0207699_10100214
352 Ga0207705_10004225
353 Ga0207684_10139516
354 Ga0207684_10242755
355 Ga0207707_10189296
356 Ga0207671_10000040
357 Ga0207693_10039637
358 Ga0207693_10193108
359 Ga0207663_10203140
360 Ga0207660_10017823
361 Ga0207657_10028415
362 Ga0207652_10001329
363 Ga0207646_10000165
364 Ga0207646_10000598
365 Ga0207646_10009201
366 Ga0207646_10076016
367 Ga0207646_10166966
368 Ga0207646_10342501
369 Ga0207700_10094136
370 Ga0207700_10114263
371 Ga0207700_10150738
372 Ga0207686_10073669
373 Ga0207670_10000007
374 Ga0207670_10159016
375 Ga0207665_10000024
376 Ga0207665_10010038
377 Ga0207665_10027204
378 Ga0207665_10109193
379 Ga0207665_10163353
380 Ga0207691_10441818
381 Ga0207711_10010305
382 Ga0207711_10070659
383 Ga0207679_10303305
384 Ga0207677_10031836
385 Ga0207677_10435904
386 Ga0207703_10003923
387 Ga0207708_10053997
388 Ga0207641_10006841
389 Ga0207698_10169922
390 Ga0209588_1000922
391 Ga0209588_1012164
392 Ga0209588_1016639
393 Ga0207428_10006836
394 Ga0207428_10012346
395 Ga0268266_10000276
396 Ga0265338_10009141
397 Ga0265325_10047840
398 Ga0316575_10007500
399 Ga0373934_0008567
400 Ga0373940_0011295
401 Ga0373923_0086097
402 Ga0373945_0055432
403 Ga0373953_0025075
404 Ga0373953_0028390
405 Ga0373954_0003566
406 Ga0373954_0021115
407 Ga0373956_0006157
408 Ga0373956_0053006
409 Ga0373955_0006404
410 Ga0373935_0176296
411 Ga0373927_0002363
412 Ga0373927_0004703
413 Ga0373927_0086569
414 Ga0373933_0004142
415 Ga0373947_0019155
416 Ga0373947_0038416
417 Ga0373937_0000020
418 Ga0373937_0037505
419 Ga0373937_0097638
420 Ga0373925_0001716
421 Ga0395900_0003956
422 Ga0395898_0079821
423 Ga0436364_1307853
424 Ga0436365_0849428
425 Ga0451577_0053152
426 Ga0451577_0100516
427 Ga0451577_0258062
428 Ga0453683_0004968
429 Ga0453683_0010739
430 Ga0453683_0020402
431 Ga0453683_0100183
432 Ga0453684_0018874
433 Ga0453684_0229023
434 Ga0453684_0523168
435 Ga0451576_0095124
436 Ga0451576_0240163
437 Ga0451576_0334963
438 Ga0451576_0387836
439 Ga0495592_0048747
440 Ga0495603_0044081
441 Ga0495629_0004192
442 Ga0495651_0073417
443 Ga0495651_0077524
444 Ga0495653_0220579
445 Ga0495580_0001960
446 Ga0495580_0083677
447 Ga0495582_0000232
448 Ga0495639_0003056
449 Ga0495664_0047303
450 Ga0495594_0055757
451 Ga0495608_0006844
452 Ga0495640_0041367
453 Ga0495586_0055222
454 Ga0495587_0001958
455 Ga0495587_0003252
456 Ga0495645_0057420
457 Ga0495667_0198231
458 Ga0495634_0027526
459 Ga0495635_0127172
460 Ga0495623_0010041
461 Ga0495623_0164657
462 Ga0495647_0000482
463 Ga0495658_0062040
464 Ga0495613_0048671
465 Ga0495624_0097612
466 Ga0495600_0063625
467 Ga0495600_0080633
468 Ga0495604_0046454
469 Ga0495604_0079197
470 Ga0495674_0092639
471 Ga0495676_0156641
472 Ga0495675_0010041
473 Ga0495684_0107417
474 Ga0495602_0000417
475 Ga0495602_0005048
476 Ga0496104_0335466
477 Ga0496114_0062298
478 Ga0496115_0144246
479 Ga0501073_0212696
480 nmdc:mga08y16_202_c1
481 nmdc:mga08y16_4288_c1
482 nmdc:mga08y16_70011_c1
483 nmdc:mga0n895_114884_c1
484 nmdc:mga0n895_22652_c1
485 nmdc:mga0rr50_304826_c1
486 nmdc:mga0rr50_90642_c1
487 nmdc:mga08x19_6906_c1
488 nmdc:mga08x19_83656_c1
489 nmdc:mga0a205_2099_c1
490 nmdc:mga0a205_37364_c1
491 Ga0495619_0030022
492 Ga0495619_0205730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

22

355

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9441 7 352
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9225 7 352
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9108 5 348
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.9083 7 350
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.903 7 350
ID Description Score Start End Superfamily
af_Q9XI73_53_190_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7566 181 282 1.20.120.290
2xm0A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7295 173 282 1.20.120.10
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7249 174 288 1.20.120.290
af_I1KJL7_87_236_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7173 181 286 1.20.120.290
af_A0A1D6E5W5_56_186_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7047 173 282 1.20.120.290
ID Description Score Start End GO Terms
AF-D8PGC8-F1-model_v4 Cytochrome bd oxidase, subunit II (EC 1.10.3.-) 0.9915 9 345 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A7R6W877-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.14) 0.9903 9 346 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A841JT05-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) 0.9899 9 354 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A535U4Q1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9879 9 340 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A3C1Z149-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9879 9 345 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069

Map