F358276

General Info

Members Datasets Scaffolds Average Seq Length
246 144 246 71

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10004612|Ga0265327_100046122
Length 86
Sequence LRVANPYLLAYNFANMIQVTKKDSKESVENLLRRFNRKVQQSGVIAVAKQGQYFEKPISKTERRKKAIVRRERKAIKVKKLKLGQK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
140 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.11
Nodule 0
Rhizoplane 1.22
Rhizosphere 78.05
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10057818 3300003323 Bacteria 17352
2 Ga0070658_10001494 3300005327 Bacteria 19829
3 Ga0070658_10034624 3300005327 Bacteria 4064
4 Ga0070658_10329601 3300005327 Unclassified 1304
5 Ga0070658_10720312 3300005327 Bacteria 866
6 Ga0070666_10006299 3300005335 Bacteria 7299
7 Ga0070666_10067112 3300005335 Bacteria 2435
8 Ga0070666_10086547 3300005335 Bacteria 2147
9 Ga0070680_100037856 3300005336 Unclassified 3899
10 Ga0068868_100042729 3300005338 Bacteria 3539
11 Ga0070689_101695126 3300005340 Unclassified 575
12 Ga0070668_100247653 3300005347 Bacteria 1478
13 Ga0070668_100326589 3300005347 Bacteria 1293
14 Ga0070669_100151350 3300005353 Unclassified 1796
15 Ga0070671_100000001 3300005355 Bacteria 1228151
16 Ga0070671_100025012 3300005355 Bacteria 4894
17 Ga0070673_100139727 3300005364 Bacteria 2042
18 Ga0070673_102064554 3300005364 Unclassified 541
19 Ga0070667_100000001 3300005367 Bacteria 1108638
20 Ga0070667_100186005 3300005367 Unclassified 1838
21 Ga0070681_10090567 3300005458 Unclassified 3009
22 Ga0068867_101459656 3300005459 Unclassified 636
23 Ga0068867_102198817 3300005459 Bacteria 523
24 Ga0070685_11310026 3300005466 Unclassified 553
25 Ga0070679_100040804 3300005530 Unclassified 4618
26 Ga0070679_100309872 3300005530 Bacteria 1528
27 Ga0070686_100030131 3300005544 Bacteria 3307
28 Ga0068855_100000364 3300005563 Bacteria 56128
29 Ga0068855_100045868 3300005563 Bacteria 5167
30 Ga0068855_100142157 3300005563 Bacteria 2734
31 Ga0068857_100023129 3300005577 Bacteria 5467
32 Ga0068854_101189902 3300005578 Unclassified 682
33 Ga0068856_102054774 3300005614 Unclassified 581
34 Ga0068852_100017766 3300005616 Bacteria 5589
35 Ga0068859_100424506 3300005617 Bacteria 1426
36 Ga0068859_101518371 3300005617 Bacteria 739
37 Ga0068859_102973054 3300005617 Unclassified 518
38 Ga0068861_100049349 3300005719 Bacteria 3186
39 Ga0068863_100109813 3300005841 Bacteria 2626
40 Ga0068863_100130684 3300005841 Bacteria 2398
41 Ga0068863_100814878 3300005841 Bacteria 931
42 Ga0068863_101209359 3300005841 Bacteria 762
43 Ga0068858_100012467 3300005842 Bacteria 8017
44 Ga0068858_100040081 3300005842 Bacteria 4343
45 Ga0068860_100005914 3300005843 Bacteria 12311
46 Ga0068860_100133560 3300005843 Bacteria 2383
47 Ga0068860_100359402 3300005843 Bacteria 1434
48 Ga0068862_100074601 3300005844 Bacteria 2932
49 Ga0075365_10000151 3300006038 Bacteria 22036
50 Ga0075364_10000496 3300006051 Bacteria 19996
51 Ga0075364_10270332 3300006051 Bacteria 1156
52 Ga0075364_11002446 3300006051 Unclassified 568
53 Ga0075362_10444032 3300006177 Bacteria 658
54 Ga0075369_10000021 3300006186 Bacteria 44895
55 Ga0075369_10135693 3300006186 Bacteria 1120
56 Ga0075366_10711039 3300006195 Unclassified 624
57 Ga0068871_100000001 3300006358 Bacteria 215987
58 Ga0097620_100424476 3300006931 Bacteria 1426
59 Ga0097620_101518537 3300006931 Bacteria 739
60 Ga0097620_102970565 3300006931 Unclassified 518
61 Ga0105240_10000118 3300009093 Bacteria 163934
62 Ga0105240_10002095 3300009093 Bacteria 32628
63 Ga0105240_10009553 3300009093 Bacteria 13730
64 Ga0105240_11118382 3300009093 Bacteria 837
65 Ga0105240_12594329 3300009093 Unclassified 524
66 Ga0111539_11239744 3300009094 Bacteria 866
67 Ga0105245_10153490 3300009098 Bacteria 2179
68 Ga0105245_10232779 3300009098 Unclassified 1782
69 Ga0105245_10908219 3300009098 Unclassified 922
70 Ga0105247_10040171 3300009101 Bacteria 2859
71 Ga0105247_10184673 3300009101 Unclassified 1393
72 Ga0105247_10205588 3300009101 Unclassified 1325
73 Ga0105241_10000917 3300009174 Bacteria 22309
74 Ga0105241_10601191 3300009174 Bacteria 994
75 Ga0105242_10223353 3300009176 Bacteria 1684
76 Ga0105242_13147619 3300009176 Bacteria 512
77 Ga0105248_10028875 3300009177 Bacteria 6183
78 Ga0105237_10310938 3300009545 Bacteria 1579
79 Ga0105238_10141121 3300009551 Bacteria 2386
80 Ga0105238_10375669 3300009551 Bacteria 1412
81 Ga0105249_11415137 3300009553 Bacteria 767
82 Ga0105249_11627792 3300009553 Bacteria 718
83 Ga0105028_103411 3300009993 Bacteria 1662
84 Ga0105239_11962475 3300010375 Bacteria 679
85 Ga0105246_10015223 3300011119 Bacteria 4853
86 Ga0157371_10023238 3300013102 Unclassified 4533
87 Ga0157369_10136895 3300013105 Bacteria 2592
88 Ga0157374_10044566 3300013296 Unclassified 4100
89 Ga0157374_10047401 3300013296 Unclassified 3985
90 Ga0157374_10991638 3300013296 Unclassified 859
91 Ga0157374_12420769 3300013296 Unclassified 552
92 Ga0157378_10055211 3300013297 Bacteria 3538
93 Ga0157378_11106041 3300013297 Unclassified 830
94 Ga0157378_13152970 3300013297 Unclassified 512
95 Ga0163162_10288765 3300013306 Bacteria 1772
96 Ga0163162_12504899 3300013306 Bacteria 593
97 Ga0157372_10017916 3300013307 Bacteria 7611
98 Ga0157372_10020217 3300013307 Bacteria 7179
99 Ga0157372_10198815 3300013307 Bacteria 2322
100 Ga0157372_12896102 3300013307 Bacteria 549
101 Ga0157375_11377602 3300013308 Bacteria 830
102 Ga0163163_10026687 3300014325 Bacteria 5525
103 Ga0163163_10291391 3300014325 Bacteria 1684
104 Ga0163163_11160069 3300014325 Unclassified 835
105 Ga0157377_10026744 3300014745 Bacteria 3091
106 Ga0157379_10118313 3300014968 Unclassified 2383
107 Ga0207710_10110237 3300025900 Unclassified 1306
108 Ga0207710_10364375 3300025900 Bacteria 738
109 Ga0207680_10040297 3300025903 Bacteria 2717
110 Ga0207680_10052309 3300025903 Bacteria 2447
111 Ga0207680_10128758 3300025903 Bacteria 1665
112 Ga0207680_11107003 3300025903 Bacteria 566
113 Ga0207705_10007842 3300025909 Bacteria 7840
114 Ga0207654_10000905 3300025911 Bacteria 16385
115 Ga0207695_10001907 3300025913 Bacteria 32545
116 Ga0207695_10001983 3300025913 Bacteria 31603
117 Ga0207695_10003048 3300025913 Bacteria 24011
118 Ga0207695_10379625 3300025913 Bacteria 1299
119 Ga0207671_10579723 3300025914 Bacteria 894
120 Ga0207660_10015677 3300025917 Unclassified 5006
121 Ga0207660_10182364 3300025917 Bacteria 1631
122 Ga0207649_11124950 3300025920 Bacteria 620
123 Ga0207652_10003529 3300025921 Bacteria 12903
124 Ga0207652_10357062 3300025921 Unclassified 1319
125 Ga0207652_11069106 3300025921 Bacteria 707
126 Ga0207681_10135081 3300025923 Unclassified 1829
127 Ga0207681_11362346 3300025923 Bacteria 596
128 Ga0207694_10123272 3300025924 Bacteria 2071
129 Ga0207687_10120614 3300025927 Bacteria 1960
130 Ga0207687_10470955 3300025927 Unclassified 1044
131 Ga0207664_10116609 3300025929 Bacteria 2228
132 Ga0207644_10000001 3300025931 Bacteria 1243214
133 Ga0207644_10016264 3300025931 Bacteria 5005
134 Ga0207644_11199081 3300025931 Bacteria 638
135 Ga0207686_10400330 3300025934 Bacteria 1046
136 Ga0207667_10000434 3300025949 Bacteria 56114
137 Ga0207667_10035276 3300025949 Bacteria 5366
138 Ga0207667_10074552 3300025949 Bacteria 3525
139 Ga0207667_12264170 3300025949 Bacteria 500
140 Ga0207651_10304071 3300025960 Bacteria 1327
141 Ga0207712_10692690 3300025961 Bacteria 889
142 Ga0207712_11642413 3300025961 Bacteria 576
143 Ga0207668_10193133 3300025972 Bacteria 1615
144 Ga0207668_10223959 3300025972 Bacteria 1512
145 Ga0207658_10000003 3300025986 Bacteria 1151934
146 Ga0207658_10091228 3300025986 Bacteria 2363
147 Ga0207677_10061453 3300026023 Bacteria 2602
148 Ga0207703_10001658 3300026035 Bacteria 20007
149 Ga0207703_10029258 3300026035 Bacteria 4345
150 Ga0207703_10254739 3300026035 Bacteria 1584
151 Ga0207702_11450761 3300026078 Unclassified 680
152 Ga0207641_10112305 3300026088 Bacteria 2418
153 Ga0207641_10172963 3300026088 Bacteria 1973
154 Ga0207641_10918958 3300026088 Bacteria 869
155 Ga0207648_10034958 3300026089 Bacteria 4430
156 Ga0207676_11565678 3300026095 Unclassified 657
157 Ga0207674_10017029 3300026116 Bacteria 7936
158 Ga0207698_10012285 3300026142 Bacteria 5597
159 Ga0210002_1005398 3300027617 Bacteria 1918
160 Ga0209998_10011583 3300027717 Unclassified 1826
161 Ga0268265_10077495 3300028380 Bacteria 2611
162 Ga0268264_10007278 3300028381 Bacteria 9261
163 Ga0268264_10319429 3300028381 Bacteria 1468
164 Ga0268264_10728717 3300028381 Bacteria 986
165 Ga0265337_1008585 3300028556 Bacteria 3700
166 Ga0265326_10109756 3300028558 Unclassified 783
167 Ga0265338_10070790 3300028800 Bacteria 2988
168 Ga0265338_11073695 3300028800 Bacteria 543
169 Ga0265327_10001541 3300031251 Bacteria 28417
170 Ga0265327_10004612 3300031251 Bacteria 12109
171 Ga0265327_10136629 3300031251 Bacteria 1149
172 Ga0307509_10023020 3300031507 Bacteria 7005
173 Ga0307407_11433627 3300031903 Bacteria 545
174 Ga0307407_11664763 3300031903 Bacteria 507
175 Ga0373962_0042102 3300035242 Bacteria 1290
176 Ga0373925_0126490 3300037068 Bacteria 1989
177 Ga0395899_0001513 3300037312 Bacteria 19701
178 Ga0395899_0031150 3300037312 Unclassified 4009
179 Ga0395900_0037003 3300037418 Bacteria 5031
180 Ga0395900_0056463 3300037418 Unclassified 4041
181 Ga0395900_0103815 3300037418 Bacteria 2919
182 Ga0395898_0001854 3300037466 Bacteria 27100
183 Ga0395898_0016480 3300037466 Bacteria 7559
184 Ga0395905_0000682 3300037471 Bacteria 45023
185 Ga0395905_0076224 3300037471 Unclassified 3143
186 Ga0395901_0002934 3300038443 Bacteria 17207
187 Ga0395901_0003747 3300038443 Bacteria 15315
188 Ga0395901_0053367 3300038443 Bacteria 4200
189 Ga0451789_0704842 3300041443 Unclassified 695
190 Ga0451800_1538542 3300041459 Unclassified 521
191 Ga0451807_2720857 3300041486 Unclassified 2085
192 Ga0451833_0079502 3300041491 Unclassified 639
193 Ga0439431_0057281 3300041997 Unclassified 1020
194 Ga0439442_032135 3300042002 Unclassified 1097
195 Ga0466958_0808976 3300045836 Unclassified 611
196 Ga0466967_0266214 3300045976 Bacteria 1641
197 Ga0495590_0092501 3300046457 Bacteria 1071
198 Ga0495583_0048413 3300046506 Bacteria 1951
199 Ga0495671_0386560 3300046692 Bacteria 670
200 Ga0495660_0001416 3300046810 Bacteria 16447
201 Ga0495672_0000016 3300047320 Bacteria 500601
202 Ga0495672_0021288 3300047320 Unclassified 4231
203 Ga0495672_0050808 3300047320 Bacteria 2445
204 Ga0496125_0233991 3300048928 Bacteria 1172
205 Ga0501034_1158256 3300049571 Unclassified 653
206 Ga0501073_0022183 3300049589 Bacteria 4575
207 Ga0501080_0000252 3300049742 Bacteria 40432
208 nmdc:mga03683_698614_c1 3300050489 Unclassified 502
209 nmdc:mga03683_89854_c2 3300050489 Bacteria 658
210 nmdc:mga00v17_247493_c1 3300050491 Bacteria 1156
211 nmdc:mga00v17_585_c1 3300050491 Bacteria 20310
212 nmdc:mga00v17_882589_c1 3300050491 Unclassified 567
213 nmdc:mga0yw44_182_c1 3300050492 Bacteria 22055
214 nmdc:mga0k408_748791_c1 3300050493 Unclassified 571
215 nmdc:mga0sz30_165339_c1 3300050516 Unclassified 620
216 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
217 nmdc:mga0sz30_52796_c1 3300050516 Bacteria 1726
218 Ga0500610_0002552 3300053079 Bacteria 6756
219 Ga0500643_000011 3300053087 Bacteria 385630
220 Ga0500643_000428 3300053087 Bacteria 31998
221 Ga0500644_0000397 3300053088 Bacteria 20681
222 Ga0500644_0028941 3300053088 Bacteria 1737
223 Ga0500644_0318677 3300053088 Bacteria 668
224 Ga0500646_0016433 3300053090 Bacteria 1932
225 Ga0500583_0000146 3300053092 Bacteria 30082
226 Ga0500583_0028716 3300053092 Bacteria 2417
227 Ga0500651_0000246 3300053093 Bacteria 33131
228 Ga0500651_0138576 3300053093 Bacteria 1468
229 Ga0500554_061291 3300053102 Bacteria 1207
230 Ga0500555_000001 3300053103 Bacteria 1353713
231 Ga0500555_114251 3300053103 Unclassified 678
232 Ga0500562_000001 3300053108 Bacteria 1178987
233 Ga0500621_013026 3300053126 Bacteria 2983
234 Ga0500642_0001929 3300053130 Bacteria 6008
235 Ga0500655_045935 3300053133 Bacteria 863
236 Ga0500568_0096001 3300053139 Unclassified 1115
237 Ga0500577_0000369 3300053142 Bacteria 11488
238 Ga0500588_0089170 3300053146 Unclassified 1045
239 Ga0500589_000002 3300053147 Bacteria 245055
240 Ga0500589_291819 3300053147 Unclassified 580
241 Ga0500604_0059359 3300053151 Unclassified 1198
242 Ga0500604_0286238 3300053151 Unclassified 571
243 Ga0500616_0000005 3300053153 Bacteria 961725
244 Ga0500627_0382696 3300053158 Unclassified 602
245 Ga0500611_000193 3300053727 Bacteria 7906
246 Ga0500611_004473 3300053727 Bacteria 1888

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10001494 Ga0070658_1000149411 69
2 3300005327 Ga0070658_10329601 Ga0070658_103296012 69
3 3300005335 Ga0070666_10086547 Ga0070666_100865472 69
4 3300005338 Ga0068868_100042729 Ga0068868_1000427296 69
5 3300005364 Ga0070673_100139727 Ga0070673_1001397273 69
6 3300005459 Ga0068867_101459656 Ga0068867_1014596562 69
7 3300005466 Ga0070685_11310026 Ga0070685_113100261 69
8 3300005719 Ga0068861_100049349 Ga0068861_1000493495 69
9 3300005841 Ga0068863_100814878 Ga0068863_1008148783 69
10 3300005842 Ga0068858_100040081 Ga0068858_1000400816 69
11 3300005843 Ga0068860_100359402 Ga0068860_1003594022 69
12 3300009093 Ga0105240_12594329 Ga0105240_125943291 69
13 3300013296 Ga0157374_10047401 Ga0157374_100474013 69
14 3300013296 Ga0157374_10991638 Ga0157374_109916381 69
15 3300013297 Ga0157378_10055211 Ga0157378_100552112 69
16 3300013297 Ga0157378_13152970 Ga0157378_131529701 69
17 3300013306 Ga0163162_10288765 Ga0163162_102887651 69
18 3300013308 Ga0157375_11377602 Ga0157375_113776022 69
19 3300025903 Ga0207680_10128758 Ga0207680_101287582 69
20 3300025909 Ga0207705_10007842 Ga0207705_100078422 69
21 3300025913 Ga0207695_10379625 Ga0207695_103796252 69
22 3300025921 Ga0207652_10357062 Ga0207652_103570622 69
23 3300025929 Ga0207664_10116609 Ga0207664_101166093 69
24 3300025949 Ga0207667_12264170 Ga0207667_122641702 69
25 3300025960 Ga0207651_10304071 Ga0207651_103040712 69
26 3300026023 Ga0207677_10061453 Ga0207677_100614533 69
27 3300026035 Ga0207703_10029258 Ga0207703_100292586 69
28 3300026088 Ga0207641_10172963 Ga0207641_101729634 69
29 3300026089 Ga0207648_10034958 Ga0207648_100349585 69
30 3300028381 Ga0268264_10319429 Ga0268264_103194292 69
31 3300028800 Ga0265338_11073695 Ga0265338_110736952 69
32 3300035242 Ga0373962_0042102 Ga0373962_0042102_1019_1228 69
33 3300041459 Ga0451800_1538542 Ga0451800_1538542_102_311 69
34 3300050516 nmdc:mga0sz30_165339_c1 nmdc:mga0sz30_165339_c1_21_230 69
35 3300053158 Ga0500627_0382696 Ga0500627_0382696_376_585 69
36 3300005336 Ga0070680_100037856 Ga0070680_1000378564 70
37 3300005355 Ga0070671_100025012 Ga0070671_1000250127 70
38 3300005364 Ga0070673_102064554 Ga0070673_1020645542 70
39 3300005458 Ga0070681_10090567 Ga0070681_100905675 70
40 3300005530 Ga0070679_100040804 Ga0070679_1000408043 70
41 3300005614 Ga0068856_102054774 Ga0068856_1020547741 70
42 3300005617 Ga0068859_100424506 Ga0068859_1004245063 70
43 3300005841 Ga0068863_100130684 Ga0068863_1001306843 70
44 3300005841 Ga0068863_101209359 Ga0068863_1012093592 70
45 3300006931 Ga0097620_100424476 Ga0097620_1004244761 70
46 3300009093 Ga0105240_10000118 Ga0105240_1000011817 70
47 3300009094 Ga0111539_11239744 Ga0111539_112397441 70
48 3300009101 Ga0105247_10205588 Ga0105247_102055882 70
49 3300009176 Ga0105242_13147619 Ga0105242_131476192 70
50 3300009545 Ga0105237_10310938 Ga0105237_103109383 70
51 3300013105 Ga0157369_10136895 Ga0157369_101368953 70
52 3300013306 Ga0163162_12504899 Ga0163162_125048992 70
53 3300013307 Ga0157372_10020217 Ga0157372_100202174 70
54 3300014968 Ga0157379_10118313 Ga0157379_101183133 70
55 3300025900 Ga0207710_10364375 Ga0207710_103643752 70
56 3300025913 Ga0207695_10003048 Ga0207695_1000304825 70
57 3300025914 Ga0207671_10579723 Ga0207671_105797232 70
58 3300025917 Ga0207660_10015677 Ga0207660_100156774 70
59 3300025921 Ga0207652_10003529 Ga0207652_1000352911 70
60 3300025931 Ga0207644_10016264 Ga0207644_100162643 70
61 3300026078 Ga0207702_11450761 Ga0207702_114507612 70
62 3300026088 Ga0207641_10918958 Ga0207641_109189582 70
63 3300028556 Ga0265337_1008585 Ga0265337_10085855 70
64 3300003323 rootH1_10057818 rootH1_100578186 71
65 3300005327 Ga0070658_10034624 Ga0070658_100346244 71
66 3300005327 Ga0070658_10720312 Ga0070658_107203122 71
67 3300005335 Ga0070666_10006299 Ga0070666_100062995 71
68 3300005335 Ga0070666_10067112 Ga0070666_100671122 71
69 3300005340 Ga0070689_101695126 Ga0070689_1016951261 71
70 3300005347 Ga0070668_100247653 Ga0070668_1002476532 71
71 3300005347 Ga0070668_100326589 Ga0070668_1003265892 71
72 3300005353 Ga0070669_100151350 Ga0070669_1001513504 71
73 3300005355 Ga0070671_100000001 Ga0070671_10000000118 71
74 3300005367 Ga0070667_100000001 Ga0070667_1000000011165 71
75 3300005367 Ga0070667_100186005 Ga0070667_1001860051 71
76 3300005459 Ga0068867_102198817 Ga0068867_1021988172 71
77 3300005530 Ga0070679_100309872 Ga0070679_1003098723 71
78 3300005544 Ga0070686_100030131 Ga0070686_1000301314 71
79 3300005563 Ga0068855_100000364 Ga0068855_10000036454 71
80 3300005563 Ga0068855_100045868 Ga0068855_1000458687 71
81 3300005563 Ga0068855_100142157 Ga0068855_1001421574 71
82 3300005577 Ga0068857_100023129 Ga0068857_1000231295 71
83 3300005578 Ga0068854_101189902 Ga0068854_1011899022 71
84 3300005616 Ga0068852_100017766 Ga0068852_1000177667 71
85 3300005617 Ga0068859_101518371 Ga0068859_1015183712 71
86 3300005617 Ga0068859_102973054 Ga0068859_1029730542 71
87 3300005841 Ga0068863_100109813 Ga0068863_1001098133 71
88 3300005842 Ga0068858_100012467 Ga0068858_1000124674 71
89 3300005843 Ga0068860_100005914 Ga0068860_10000591411 71
90 3300005843 Ga0068860_100133560 Ga0068860_1001335602 71
91 3300005844 Ga0068862_100074601 Ga0068862_1000746015 71
92 3300006038 Ga0075365_10000151 Ga0075365_1000015114 71
93 3300006051 Ga0075364_10000496 Ga0075364_100004966 71
94 3300006051 Ga0075364_10270332 Ga0075364_102703322 71
95 3300006051 Ga0075364_11002446 Ga0075364_110024462 71
96 3300006177 Ga0075362_10444032 Ga0075362_104440322 71
97 3300006186 Ga0075369_10000021 Ga0075369_1000002116 71
98 3300006186 Ga0075369_10135693 Ga0075369_101356932 71
99 3300006195 Ga0075366_10711039 Ga0075366_107110392 71
100 3300006358 Ga0068871_100000001 Ga0068871_1000000015 71
101 3300006931 Ga0097620_101518537 Ga0097620_1015185372 71
102 3300006931 Ga0097620_102970565 Ga0097620_1029705652 71
103 3300009093 Ga0105240_10002095 Ga0105240_1000209522 71
104 3300009093 Ga0105240_10009553 Ga0105240_1000955311 71
105 3300009093 Ga0105240_11118382 Ga0105240_111183822 71
106 3300009098 Ga0105245_10153490 Ga0105245_101534903 71
107 3300009098 Ga0105245_10232779 Ga0105245_102327793 71
108 3300009098 Ga0105245_10908219 Ga0105245_109082192 71
109 3300009101 Ga0105247_10040171 Ga0105247_100401715 71
110 3300009101 Ga0105247_10184673 Ga0105247_101846732 71
111 3300009174 Ga0105241_10000917 Ga0105241_1000091714 71
112 3300009174 Ga0105241_10601191 Ga0105241_106011911 71
113 3300009176 Ga0105242_10223353 Ga0105242_102233534 71
114 3300009177 Ga0105248_10028875 Ga0105248_100288759 71
115 3300009551 Ga0105238_10141121 Ga0105238_101411214 71
116 3300009551 Ga0105238_10375669 Ga0105238_103756691 71
117 3300009553 Ga0105249_11415137 Ga0105249_114151371 71
118 3300009553 Ga0105249_11627792 Ga0105249_116277922 71
119 3300009993 Ga0105028_103411 Ga0105028_1034114 71
120 3300010375 Ga0105239_11962475 Ga0105239_119624752 71
121 3300011119 Ga0105246_10015223 Ga0105246_100152235 71
122 3300013102 Ga0157371_10023238 Ga0157371_100232385 71
123 3300013296 Ga0157374_10044566 Ga0157374_100445661 71
124 3300013296 Ga0157374_12420769 Ga0157374_124207692 71
125 3300013297 Ga0157378_11106041 Ga0157378_111060412 71
126 3300013307 Ga0157372_10017916 Ga0157372_100179168 71
127 3300013307 Ga0157372_10198815 Ga0157372_101988152 71
128 3300013307 Ga0157372_12896102 Ga0157372_128961022 71
129 3300014325 Ga0163163_10026687 Ga0163163_1002668710 71
130 3300014325 Ga0163163_10291391 Ga0163163_102913913 71
131 3300014325 Ga0163163_11160069 Ga0163163_111600691 71
132 3300014745 Ga0157377_10026744 Ga0157377_100267445 71
133 3300025900 Ga0207710_10110237 Ga0207710_101102372 71
134 3300025903 Ga0207680_10040297 Ga0207680_100402975 71
135 3300025903 Ga0207680_10052309 Ga0207680_100523092 71
136 3300025903 Ga0207680_11107003 Ga0207680_111070032 71
137 3300025911 Ga0207654_10000905 Ga0207654_1000090511 71
138 3300025913 Ga0207695_10001907 Ga0207695_1000190718 71
139 3300025913 Ga0207695_10001983 Ga0207695_100019834 71
140 3300025917 Ga0207660_10182364 Ga0207660_101823641 71
141 3300025920 Ga0207649_11124950 Ga0207649_111249502 71
142 3300025921 Ga0207652_11069106 Ga0207652_110691062 71
143 3300025923 Ga0207681_10135081 Ga0207681_101350814 71
144 3300025923 Ga0207681_11362346 Ga0207681_113623462 71
145 3300025924 Ga0207694_10123272 Ga0207694_101232723 71
146 3300025927 Ga0207687_10120614 Ga0207687_101206142 71
147 3300025927 Ga0207687_10470955 Ga0207687_104709553 71
148 3300025931 Ga0207644_10000001 Ga0207644_1000000166 71
149 3300025931 Ga0207644_11199081 Ga0207644_111990811 71
150 3300025934 Ga0207686_10400330 Ga0207686_104003302 71
151 3300025949 Ga0207667_10000434 Ga0207667_1000043410 71
152 3300025949 Ga0207667_10035276 Ga0207667_100352767 71
153 3300025949 Ga0207667_10074552 Ga0207667_100745523 71
154 3300025961 Ga0207712_10692690 Ga0207712_106926901 71
155 3300025961 Ga0207712_11642413 Ga0207712_116424132 71
156 3300025972 Ga0207668_10193133 Ga0207668_101931333 71
157 3300025972 Ga0207668_10223959 Ga0207668_102239593 71
158 3300025986 Ga0207658_10000003 Ga0207658_10000003219 71
159 3300025986 Ga0207658_10091228 Ga0207658_100912283 71
160 3300026035 Ga0207703_10001658 Ga0207703_1000165810 71
161 3300026035 Ga0207703_10254739 Ga0207703_102547393 71
162 3300026088 Ga0207641_10112305 Ga0207641_101123053 71
163 3300026095 Ga0207676_11565678 Ga0207676_115656781 71
164 3300026116 Ga0207674_10017029 Ga0207674_100170294 71
165 3300026142 Ga0207698_10012285 Ga0207698_100122856 71
166 3300027617 Ga0210002_1005398 Ga0210002_10053982 71
167 3300027717 Ga0209998_10011583 Ga0209998_100115833 71
168 3300028380 Ga0268265_10077495 Ga0268265_100774955 71
169 3300028381 Ga0268264_10007278 Ga0268264_100072786 71
170 3300028381 Ga0268264_10728717 Ga0268264_107287172 71
171 3300028558 Ga0265326_10109756 Ga0265326_101097562 71
172 3300028800 Ga0265338_10070790 Ga0265338_100707903 71
173 3300031251 Ga0265327_10001541 Ga0265327_1000154116 71
174 3300031251 Ga0265327_10004612 Ga0265327_100046122 71
175 3300031251 Ga0265327_10136629 Ga0265327_101366292 71
176 3300031507 Ga0307509_10023020 Ga0307509_100230205 71
177 3300031903 Ga0307407_11433627 Ga0307407_114336272 71
178 3300031903 Ga0307407_11664763 Ga0307407_116647631 71
179 3300037068 Ga0373925_0126490 Ga0373925_0126490_1164_1379 71
180 3300037312 Ga0395899_0001513 Ga0395899_0001513_13137_13352 71
181 3300037312 Ga0395899_0031150 Ga0395899_0031150_2708_2923 71
182 3300037418 Ga0395900_0037003 Ga0395900_0037003_2771_2986 71
183 3300037418 Ga0395900_0056463 Ga0395900_0056463_3753_3968 71
184 3300037418 Ga0395900_0103815 Ga0395900_0103815_354_569 71
185 3300037466 Ga0395898_0001854 Ga0395898_0001854_16780_16995 71
186 3300037466 Ga0395898_0016480 Ga0395898_0016480_4566_4781 71
187 3300037471 Ga0395905_0000682 Ga0395905_0000682_39554_39769 71
188 3300037471 Ga0395905_0076224 Ga0395905_0076224_1210_1425 71
189 3300038443 Ga0395901_0002934 Ga0395901_0002934_6539_6754 71
190 3300038443 Ga0395901_0003747 Ga0395901_0003747_9846_10061 71
191 3300038443 Ga0395901_0053367 Ga0395901_0053367_502_717 71
192 3300041443 Ga0451789_0704842 Ga0451789_0704842_172_387 71
193 3300041486 Ga0451807_2720857 Ga0451807_2720857_606_821 71
194 3300041491 Ga0451833_0079502 Ga0451833_0079502_94_309 71
195 3300041997 Ga0439431_0057281 Ga0439431_0057281_375_593 71
196 3300042002 Ga0439442_032135 Ga0439442_032135_278_496 71
197 3300045836 Ga0466958_0808976 Ga0466958_0808976_147_365 71
198 3300045976 Ga0466967_0266214 Ga0466967_0266214_743_958 71
199 3300046457 Ga0495590_0092501 Ga0495590_0092501_352_567 71
200 3300046506 Ga0495583_0048413 Ga0495583_0048413_721_936 71
201 3300046692 Ga0495671_0386560 Ga0495671_0386560_199_414 71
202 3300046810 Ga0495660_0001416 Ga0495660_0001416_2647_2862 71
203 3300047320 Ga0495672_0000016 Ga0495672_0000016_439885_440100 71
204 3300047320 Ga0495672_0021288 Ga0495672_0021288_3441_3656 71
205 3300047320 Ga0495672_0050808 Ga0495672_0050808_612_830 71
206 3300048928 Ga0496125_0233991 Ga0496125_0233991_891_1106 71
207 3300049571 Ga0501034_1158256 Ga0501034_1158256_207_422 71
208 3300049589 Ga0501073_0022183 Ga0501073_0022183_336_551 71
209 3300049742 Ga0501080_0000252 Ga0501080_0000252_19423_19638 71
210 3300050489 nmdc:mga03683_698614_c1 nmdc:mga03683_698614_c1_99_314 71
211 3300050489 nmdc:mga03683_89854_c2 nmdc:mga03683_89854_c2_336_551 71
212 3300050491 nmdc:mga00v17_247493_c1 nmdc:mga00v17_247493_c1_705_920 71
213 3300050491 nmdc:mga00v17_585_c1 nmdc:mga00v17_585_c1_15726_15944 71
214 3300050491 nmdc:mga00v17_882589_c1 nmdc:mga00v17_882589_c1_126_341 71
215 3300050492 nmdc:mga0yw44_182_c1 nmdc:mga0yw44_182_c1_12602_12820 71
216 3300050493 nmdc:mga0k408_748791_c1 nmdc:mga0k408_748791_c1_175_390 71
217 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_42141_42356 71
218 3300050516 nmdc:mga0sz30_52796_c1 nmdc:mga0sz30_52796_c1_178_393 71
219 3300053079 Ga0500610_0002552 Ga0500610_0002552_1237_1452 71
220 3300053087 Ga0500643_000011 Ga0500643_000011_372821_373036 71
221 3300053087 Ga0500643_000428 Ga0500643_000428_13761_13976 71
222 3300053088 Ga0500644_0000397 Ga0500644_0000397_10134_10349 71
223 3300053088 Ga0500644_0028941 Ga0500644_0028941_449_667 71
224 3300053088 Ga0500644_0318677 Ga0500644_0318677_328_543 71
225 3300053090 Ga0500646_0016433 Ga0500646_0016433_291_509 71
226 3300053092 Ga0500583_0000146 Ga0500583_0000146_12743_12958 71
227 3300053092 Ga0500583_0028716 Ga0500583_0028716_536_751 71
228 3300053093 Ga0500651_0000246 Ga0500651_0000246_17911_18129 71
229 3300053093 Ga0500651_0138576 Ga0500651_0138576_369_584 71
230 3300053102 Ga0500554_061291 Ga0500554_061291_248_466 71
231 3300053103 Ga0500555_000001 Ga0500555_000001_1338439_1338654 71
232 3300053103 Ga0500555_114251 Ga0500555_114251_264_479 71
233 3300053108 Ga0500562_000001 Ga0500562_000001_682173_682388 71
234 3300053126 Ga0500621_013026 Ga0500621_013026_672_887 71
235 3300053130 Ga0500642_0001929 Ga0500642_0001929_2475_2690 71
236 3300053133 Ga0500655_045935 Ga0500655_045935_538_753 71
237 3300053139 Ga0500568_0096001 Ga0500568_0096001_414_629 71
238 3300053142 Ga0500577_0000369 Ga0500577_0000369_8234_8449 71
239 3300053146 Ga0500588_0089170 Ga0500588_0089170_775_990 71
240 3300053147 Ga0500589_000002 Ga0500589_000002_227670_227885 71
241 3300053147 Ga0500589_291819 Ga0500589_291819_75_293 71
242 3300053151 Ga0500604_0059359 Ga0500604_0059359_398_613 71
243 3300053151 Ga0500604_0286238 Ga0500604_0286238_16_231 71
244 3300053153 Ga0500616_0000005 Ga0500616_0000005_677126_677341 71
245 3300053727 Ga0500611_000193 Ga0500611_000193_7292_7507 71
246 3300053727 Ga0500611_004473 Ga0500611_004473_1491_1706 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01165

Ribosomal_S21

Ribosomal protein S21

21

80

0.95

Feature Viewer

pLDDT pTM Quality
88.55 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map