F358276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 144 | 246 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10004612|Ga0265327_100046122 |
| Length | 86 |
| Sequence | LRVANPYLLAYNFANMIQVTKKDSKESVENLLRRFNRKVQQSGVIAVAKQGQYFEKPISKTERRKKAIVRRERKAIKVKKLKLGQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 31 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 107 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 108 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 109 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 117 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 121 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 122 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 123 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 124 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 126 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 127 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 129 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 130 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 131 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 132 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 134 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 135 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 136 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 137 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 138 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 139 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 140 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 141 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 142 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 143 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 144 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.11 |
| Nodule | 0 |
| Rhizoplane | 1.22 |
| Rhizosphere | 78.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10057818 | 3300003323 | Bacteria | 17352 |
| 2 | Ga0070658_10001494 | 3300005327 | Bacteria | 19829 |
| 3 | Ga0070658_10034624 | 3300005327 | Bacteria | 4064 |
| 4 | Ga0070658_10329601 | 3300005327 | Unclassified | 1304 |
| 5 | Ga0070658_10720312 | 3300005327 | Bacteria | 866 |
| 6 | Ga0070666_10006299 | 3300005335 | Bacteria | 7299 |
| 7 | Ga0070666_10067112 | 3300005335 | Bacteria | 2435 |
| 8 | Ga0070666_10086547 | 3300005335 | Bacteria | 2147 |
| 9 | Ga0070680_100037856 | 3300005336 | Unclassified | 3899 |
| 10 | Ga0068868_100042729 | 3300005338 | Bacteria | 3539 |
| 11 | Ga0070689_101695126 | 3300005340 | Unclassified | 575 |
| 12 | Ga0070668_100247653 | 3300005347 | Bacteria | 1478 |
| 13 | Ga0070668_100326589 | 3300005347 | Bacteria | 1293 |
| 14 | Ga0070669_100151350 | 3300005353 | Unclassified | 1796 |
| 15 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 16 | Ga0070671_100025012 | 3300005355 | Bacteria | 4894 |
| 17 | Ga0070673_100139727 | 3300005364 | Bacteria | 2042 |
| 18 | Ga0070673_102064554 | 3300005364 | Unclassified | 541 |
| 19 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 20 | Ga0070667_100186005 | 3300005367 | Unclassified | 1838 |
| 21 | Ga0070681_10090567 | 3300005458 | Unclassified | 3009 |
| 22 | Ga0068867_101459656 | 3300005459 | Unclassified | 636 |
| 23 | Ga0068867_102198817 | 3300005459 | Bacteria | 523 |
| 24 | Ga0070685_11310026 | 3300005466 | Unclassified | 553 |
| 25 | Ga0070679_100040804 | 3300005530 | Unclassified | 4618 |
| 26 | Ga0070679_100309872 | 3300005530 | Bacteria | 1528 |
| 27 | Ga0070686_100030131 | 3300005544 | Bacteria | 3307 |
| 28 | Ga0068855_100000364 | 3300005563 | Bacteria | 56128 |
| 29 | Ga0068855_100045868 | 3300005563 | Bacteria | 5167 |
| 30 | Ga0068855_100142157 | 3300005563 | Bacteria | 2734 |
| 31 | Ga0068857_100023129 | 3300005577 | Bacteria | 5467 |
| 32 | Ga0068854_101189902 | 3300005578 | Unclassified | 682 |
| 33 | Ga0068856_102054774 | 3300005614 | Unclassified | 581 |
| 34 | Ga0068852_100017766 | 3300005616 | Bacteria | 5589 |
| 35 | Ga0068859_100424506 | 3300005617 | Bacteria | 1426 |
| 36 | Ga0068859_101518371 | 3300005617 | Bacteria | 739 |
| 37 | Ga0068859_102973054 | 3300005617 | Unclassified | 518 |
| 38 | Ga0068861_100049349 | 3300005719 | Bacteria | 3186 |
| 39 | Ga0068863_100109813 | 3300005841 | Bacteria | 2626 |
| 40 | Ga0068863_100130684 | 3300005841 | Bacteria | 2398 |
| 41 | Ga0068863_100814878 | 3300005841 | Bacteria | 931 |
| 42 | Ga0068863_101209359 | 3300005841 | Bacteria | 762 |
| 43 | Ga0068858_100012467 | 3300005842 | Bacteria | 8017 |
| 44 | Ga0068858_100040081 | 3300005842 | Bacteria | 4343 |
| 45 | Ga0068860_100005914 | 3300005843 | Bacteria | 12311 |
| 46 | Ga0068860_100133560 | 3300005843 | Bacteria | 2383 |
| 47 | Ga0068860_100359402 | 3300005843 | Bacteria | 1434 |
| 48 | Ga0068862_100074601 | 3300005844 | Bacteria | 2932 |
| 49 | Ga0075365_10000151 | 3300006038 | Bacteria | 22036 |
| 50 | Ga0075364_10000496 | 3300006051 | Bacteria | 19996 |
| 51 | Ga0075364_10270332 | 3300006051 | Bacteria | 1156 |
| 52 | Ga0075364_11002446 | 3300006051 | Unclassified | 568 |
| 53 | Ga0075362_10444032 | 3300006177 | Bacteria | 658 |
| 54 | Ga0075369_10000021 | 3300006186 | Bacteria | 44895 |
| 55 | Ga0075369_10135693 | 3300006186 | Bacteria | 1120 |
| 56 | Ga0075366_10711039 | 3300006195 | Unclassified | 624 |
| 57 | Ga0068871_100000001 | 3300006358 | Bacteria | 215987 |
| 58 | Ga0097620_100424476 | 3300006931 | Bacteria | 1426 |
| 59 | Ga0097620_101518537 | 3300006931 | Bacteria | 739 |
| 60 | Ga0097620_102970565 | 3300006931 | Unclassified | 518 |
| 61 | Ga0105240_10000118 | 3300009093 | Bacteria | 163934 |
| 62 | Ga0105240_10002095 | 3300009093 | Bacteria | 32628 |
| 63 | Ga0105240_10009553 | 3300009093 | Bacteria | 13730 |
| 64 | Ga0105240_11118382 | 3300009093 | Bacteria | 837 |
| 65 | Ga0105240_12594329 | 3300009093 | Unclassified | 524 |
| 66 | Ga0111539_11239744 | 3300009094 | Bacteria | 866 |
| 67 | Ga0105245_10153490 | 3300009098 | Bacteria | 2179 |
| 68 | Ga0105245_10232779 | 3300009098 | Unclassified | 1782 |
| 69 | Ga0105245_10908219 | 3300009098 | Unclassified | 922 |
| 70 | Ga0105247_10040171 | 3300009101 | Bacteria | 2859 |
| 71 | Ga0105247_10184673 | 3300009101 | Unclassified | 1393 |
| 72 | Ga0105247_10205588 | 3300009101 | Unclassified | 1325 |
| 73 | Ga0105241_10000917 | 3300009174 | Bacteria | 22309 |
| 74 | Ga0105241_10601191 | 3300009174 | Bacteria | 994 |
| 75 | Ga0105242_10223353 | 3300009176 | Bacteria | 1684 |
| 76 | Ga0105242_13147619 | 3300009176 | Bacteria | 512 |
| 77 | Ga0105248_10028875 | 3300009177 | Bacteria | 6183 |
| 78 | Ga0105237_10310938 | 3300009545 | Bacteria | 1579 |
| 79 | Ga0105238_10141121 | 3300009551 | Bacteria | 2386 |
| 80 | Ga0105238_10375669 | 3300009551 | Bacteria | 1412 |
| 81 | Ga0105249_11415137 | 3300009553 | Bacteria | 767 |
| 82 | Ga0105249_11627792 | 3300009553 | Bacteria | 718 |
| 83 | Ga0105028_103411 | 3300009993 | Bacteria | 1662 |
| 84 | Ga0105239_11962475 | 3300010375 | Bacteria | 679 |
| 85 | Ga0105246_10015223 | 3300011119 | Bacteria | 4853 |
| 86 | Ga0157371_10023238 | 3300013102 | Unclassified | 4533 |
| 87 | Ga0157369_10136895 | 3300013105 | Bacteria | 2592 |
| 88 | Ga0157374_10044566 | 3300013296 | Unclassified | 4100 |
| 89 | Ga0157374_10047401 | 3300013296 | Unclassified | 3985 |
| 90 | Ga0157374_10991638 | 3300013296 | Unclassified | 859 |
| 91 | Ga0157374_12420769 | 3300013296 | Unclassified | 552 |
| 92 | Ga0157378_10055211 | 3300013297 | Bacteria | 3538 |
| 93 | Ga0157378_11106041 | 3300013297 | Unclassified | 830 |
| 94 | Ga0157378_13152970 | 3300013297 | Unclassified | 512 |
| 95 | Ga0163162_10288765 | 3300013306 | Bacteria | 1772 |
| 96 | Ga0163162_12504899 | 3300013306 | Bacteria | 593 |
| 97 | Ga0157372_10017916 | 3300013307 | Bacteria | 7611 |
| 98 | Ga0157372_10020217 | 3300013307 | Bacteria | 7179 |
| 99 | Ga0157372_10198815 | 3300013307 | Bacteria | 2322 |
| 100 | Ga0157372_12896102 | 3300013307 | Bacteria | 549 |
| 101 | Ga0157375_11377602 | 3300013308 | Bacteria | 830 |
| 102 | Ga0163163_10026687 | 3300014325 | Bacteria | 5525 |
| 103 | Ga0163163_10291391 | 3300014325 | Bacteria | 1684 |
| 104 | Ga0163163_11160069 | 3300014325 | Unclassified | 835 |
| 105 | Ga0157377_10026744 | 3300014745 | Bacteria | 3091 |
| 106 | Ga0157379_10118313 | 3300014968 | Unclassified | 2383 |
| 107 | Ga0207710_10110237 | 3300025900 | Unclassified | 1306 |
| 108 | Ga0207710_10364375 | 3300025900 | Bacteria | 738 |
| 109 | Ga0207680_10040297 | 3300025903 | Bacteria | 2717 |
| 110 | Ga0207680_10052309 | 3300025903 | Bacteria | 2447 |
| 111 | Ga0207680_10128758 | 3300025903 | Bacteria | 1665 |
| 112 | Ga0207680_11107003 | 3300025903 | Bacteria | 566 |
| 113 | Ga0207705_10007842 | 3300025909 | Bacteria | 7840 |
| 114 | Ga0207654_10000905 | 3300025911 | Bacteria | 16385 |
| 115 | Ga0207695_10001907 | 3300025913 | Bacteria | 32545 |
| 116 | Ga0207695_10001983 | 3300025913 | Bacteria | 31603 |
| 117 | Ga0207695_10003048 | 3300025913 | Bacteria | 24011 |
| 118 | Ga0207695_10379625 | 3300025913 | Bacteria | 1299 |
| 119 | Ga0207671_10579723 | 3300025914 | Bacteria | 894 |
| 120 | Ga0207660_10015677 | 3300025917 | Unclassified | 5006 |
| 121 | Ga0207660_10182364 | 3300025917 | Bacteria | 1631 |
| 122 | Ga0207649_11124950 | 3300025920 | Bacteria | 620 |
| 123 | Ga0207652_10003529 | 3300025921 | Bacteria | 12903 |
| 124 | Ga0207652_10357062 | 3300025921 | Unclassified | 1319 |
| 125 | Ga0207652_11069106 | 3300025921 | Bacteria | 707 |
| 126 | Ga0207681_10135081 | 3300025923 | Unclassified | 1829 |
| 127 | Ga0207681_11362346 | 3300025923 | Bacteria | 596 |
| 128 | Ga0207694_10123272 | 3300025924 | Bacteria | 2071 |
| 129 | Ga0207687_10120614 | 3300025927 | Bacteria | 1960 |
| 130 | Ga0207687_10470955 | 3300025927 | Unclassified | 1044 |
| 131 | Ga0207664_10116609 | 3300025929 | Bacteria | 2228 |
| 132 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 133 | Ga0207644_10016264 | 3300025931 | Bacteria | 5005 |
| 134 | Ga0207644_11199081 | 3300025931 | Bacteria | 638 |
| 135 | Ga0207686_10400330 | 3300025934 | Bacteria | 1046 |
| 136 | Ga0207667_10000434 | 3300025949 | Bacteria | 56114 |
| 137 | Ga0207667_10035276 | 3300025949 | Bacteria | 5366 |
| 138 | Ga0207667_10074552 | 3300025949 | Bacteria | 3525 |
| 139 | Ga0207667_12264170 | 3300025949 | Bacteria | 500 |
| 140 | Ga0207651_10304071 | 3300025960 | Bacteria | 1327 |
| 141 | Ga0207712_10692690 | 3300025961 | Bacteria | 889 |
| 142 | Ga0207712_11642413 | 3300025961 | Bacteria | 576 |
| 143 | Ga0207668_10193133 | 3300025972 | Bacteria | 1615 |
| 144 | Ga0207668_10223959 | 3300025972 | Bacteria | 1512 |
| 145 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 146 | Ga0207658_10091228 | 3300025986 | Bacteria | 2363 |
| 147 | Ga0207677_10061453 | 3300026023 | Bacteria | 2602 |
| 148 | Ga0207703_10001658 | 3300026035 | Bacteria | 20007 |
| 149 | Ga0207703_10029258 | 3300026035 | Bacteria | 4345 |
| 150 | Ga0207703_10254739 | 3300026035 | Bacteria | 1584 |
| 151 | Ga0207702_11450761 | 3300026078 | Unclassified | 680 |
| 152 | Ga0207641_10112305 | 3300026088 | Bacteria | 2418 |
| 153 | Ga0207641_10172963 | 3300026088 | Bacteria | 1973 |
| 154 | Ga0207641_10918958 | 3300026088 | Bacteria | 869 |
| 155 | Ga0207648_10034958 | 3300026089 | Bacteria | 4430 |
| 156 | Ga0207676_11565678 | 3300026095 | Unclassified | 657 |
| 157 | Ga0207674_10017029 | 3300026116 | Bacteria | 7936 |
| 158 | Ga0207698_10012285 | 3300026142 | Bacteria | 5597 |
| 159 | Ga0210002_1005398 | 3300027617 | Bacteria | 1918 |
| 160 | Ga0209998_10011583 | 3300027717 | Unclassified | 1826 |
| 161 | Ga0268265_10077495 | 3300028380 | Bacteria | 2611 |
| 162 | Ga0268264_10007278 | 3300028381 | Bacteria | 9261 |
| 163 | Ga0268264_10319429 | 3300028381 | Bacteria | 1468 |
| 164 | Ga0268264_10728717 | 3300028381 | Bacteria | 986 |
| 165 | Ga0265337_1008585 | 3300028556 | Bacteria | 3700 |
| 166 | Ga0265326_10109756 | 3300028558 | Unclassified | 783 |
| 167 | Ga0265338_10070790 | 3300028800 | Bacteria | 2988 |
| 168 | Ga0265338_11073695 | 3300028800 | Bacteria | 543 |
| 169 | Ga0265327_10001541 | 3300031251 | Bacteria | 28417 |
| 170 | Ga0265327_10004612 | 3300031251 | Bacteria | 12109 |
| 171 | Ga0265327_10136629 | 3300031251 | Bacteria | 1149 |
| 172 | Ga0307509_10023020 | 3300031507 | Bacteria | 7005 |
| 173 | Ga0307407_11433627 | 3300031903 | Bacteria | 545 |
| 174 | Ga0307407_11664763 | 3300031903 | Bacteria | 507 |
| 175 | Ga0373962_0042102 | 3300035242 | Bacteria | 1290 |
| 176 | Ga0373925_0126490 | 3300037068 | Bacteria | 1989 |
| 177 | Ga0395899_0001513 | 3300037312 | Bacteria | 19701 |
| 178 | Ga0395899_0031150 | 3300037312 | Unclassified | 4009 |
| 179 | Ga0395900_0037003 | 3300037418 | Bacteria | 5031 |
| 180 | Ga0395900_0056463 | 3300037418 | Unclassified | 4041 |
| 181 | Ga0395900_0103815 | 3300037418 | Bacteria | 2919 |
| 182 | Ga0395898_0001854 | 3300037466 | Bacteria | 27100 |
| 183 | Ga0395898_0016480 | 3300037466 | Bacteria | 7559 |
| 184 | Ga0395905_0000682 | 3300037471 | Bacteria | 45023 |
| 185 | Ga0395905_0076224 | 3300037471 | Unclassified | 3143 |
| 186 | Ga0395901_0002934 | 3300038443 | Bacteria | 17207 |
| 187 | Ga0395901_0003747 | 3300038443 | Bacteria | 15315 |
| 188 | Ga0395901_0053367 | 3300038443 | Bacteria | 4200 |
| 189 | Ga0451789_0704842 | 3300041443 | Unclassified | 695 |
| 190 | Ga0451800_1538542 | 3300041459 | Unclassified | 521 |
| 191 | Ga0451807_2720857 | 3300041486 | Unclassified | 2085 |
| 192 | Ga0451833_0079502 | 3300041491 | Unclassified | 639 |
| 193 | Ga0439431_0057281 | 3300041997 | Unclassified | 1020 |
| 194 | Ga0439442_032135 | 3300042002 | Unclassified | 1097 |
| 195 | Ga0466958_0808976 | 3300045836 | Unclassified | 611 |
| 196 | Ga0466967_0266214 | 3300045976 | Bacteria | 1641 |
| 197 | Ga0495590_0092501 | 3300046457 | Bacteria | 1071 |
| 198 | Ga0495583_0048413 | 3300046506 | Bacteria | 1951 |
| 199 | Ga0495671_0386560 | 3300046692 | Bacteria | 670 |
| 200 | Ga0495660_0001416 | 3300046810 | Bacteria | 16447 |
| 201 | Ga0495672_0000016 | 3300047320 | Bacteria | 500601 |
| 202 | Ga0495672_0021288 | 3300047320 | Unclassified | 4231 |
| 203 | Ga0495672_0050808 | 3300047320 | Bacteria | 2445 |
| 204 | Ga0496125_0233991 | 3300048928 | Bacteria | 1172 |
| 205 | Ga0501034_1158256 | 3300049571 | Unclassified | 653 |
| 206 | Ga0501073_0022183 | 3300049589 | Bacteria | 4575 |
| 207 | Ga0501080_0000252 | 3300049742 | Bacteria | 40432 |
| 208 | nmdc:mga03683_698614_c1 | 3300050489 | Unclassified | 502 |
| 209 | nmdc:mga03683_89854_c2 | 3300050489 | Bacteria | 658 |
| 210 | nmdc:mga00v17_247493_c1 | 3300050491 | Bacteria | 1156 |
| 211 | nmdc:mga00v17_585_c1 | 3300050491 | Bacteria | 20310 |
| 212 | nmdc:mga00v17_882589_c1 | 3300050491 | Unclassified | 567 |
| 213 | nmdc:mga0yw44_182_c1 | 3300050492 | Bacteria | 22055 |
| 214 | nmdc:mga0k408_748791_c1 | 3300050493 | Unclassified | 571 |
| 215 | nmdc:mga0sz30_165339_c1 | 3300050516 | Unclassified | 620 |
| 216 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 217 | nmdc:mga0sz30_52796_c1 | 3300050516 | Bacteria | 1726 |
| 218 | Ga0500610_0002552 | 3300053079 | Bacteria | 6756 |
| 219 | Ga0500643_000011 | 3300053087 | Bacteria | 385630 |
| 220 | Ga0500643_000428 | 3300053087 | Bacteria | 31998 |
| 221 | Ga0500644_0000397 | 3300053088 | Bacteria | 20681 |
| 222 | Ga0500644_0028941 | 3300053088 | Bacteria | 1737 |
| 223 | Ga0500644_0318677 | 3300053088 | Bacteria | 668 |
| 224 | Ga0500646_0016433 | 3300053090 | Bacteria | 1932 |
| 225 | Ga0500583_0000146 | 3300053092 | Bacteria | 30082 |
| 226 | Ga0500583_0028716 | 3300053092 | Bacteria | 2417 |
| 227 | Ga0500651_0000246 | 3300053093 | Bacteria | 33131 |
| 228 | Ga0500651_0138576 | 3300053093 | Bacteria | 1468 |
| 229 | Ga0500554_061291 | 3300053102 | Bacteria | 1207 |
| 230 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 231 | Ga0500555_114251 | 3300053103 | Unclassified | 678 |
| 232 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 233 | Ga0500621_013026 | 3300053126 | Bacteria | 2983 |
| 234 | Ga0500642_0001929 | 3300053130 | Bacteria | 6008 |
| 235 | Ga0500655_045935 | 3300053133 | Bacteria | 863 |
| 236 | Ga0500568_0096001 | 3300053139 | Unclassified | 1115 |
| 237 | Ga0500577_0000369 | 3300053142 | Bacteria | 11488 |
| 238 | Ga0500588_0089170 | 3300053146 | Unclassified | 1045 |
| 239 | Ga0500589_000002 | 3300053147 | Bacteria | 245055 |
| 240 | Ga0500589_291819 | 3300053147 | Unclassified | 580 |
| 241 | Ga0500604_0059359 | 3300053151 | Unclassified | 1198 |
| 242 | Ga0500604_0286238 | 3300053151 | Unclassified | 571 |
| 243 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 244 | Ga0500627_0382696 | 3300053158 | Unclassified | 602 |
| 245 | Ga0500611_000193 | 3300053727 | Bacteria | 7906 |
| 246 | Ga0500611_004473 | 3300053727 | Bacteria | 1888 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10001494 | Ga0070658_1000149411 | 69 |
| 2 | 3300005327 | Ga0070658_10329601 | Ga0070658_103296012 | 69 |
| 3 | 3300005335 | Ga0070666_10086547 | Ga0070666_100865472 | 69 |
| 4 | 3300005338 | Ga0068868_100042729 | Ga0068868_1000427296 | 69 |
| 5 | 3300005364 | Ga0070673_100139727 | Ga0070673_1001397273 | 69 |
| 6 | 3300005459 | Ga0068867_101459656 | Ga0068867_1014596562 | 69 |
| 7 | 3300005466 | Ga0070685_11310026 | Ga0070685_113100261 | 69 |
| 8 | 3300005719 | Ga0068861_100049349 | Ga0068861_1000493495 | 69 |
| 9 | 3300005841 | Ga0068863_100814878 | Ga0068863_1008148783 | 69 |
| 10 | 3300005842 | Ga0068858_100040081 | Ga0068858_1000400816 | 69 |
| 11 | 3300005843 | Ga0068860_100359402 | Ga0068860_1003594022 | 69 |
| 12 | 3300009093 | Ga0105240_12594329 | Ga0105240_125943291 | 69 |
| 13 | 3300013296 | Ga0157374_10047401 | Ga0157374_100474013 | 69 |
| 14 | 3300013296 | Ga0157374_10991638 | Ga0157374_109916381 | 69 |
| 15 | 3300013297 | Ga0157378_10055211 | Ga0157378_100552112 | 69 |
| 16 | 3300013297 | Ga0157378_13152970 | Ga0157378_131529701 | 69 |
| 17 | 3300013306 | Ga0163162_10288765 | Ga0163162_102887651 | 69 |
| 18 | 3300013308 | Ga0157375_11377602 | Ga0157375_113776022 | 69 |
| 19 | 3300025903 | Ga0207680_10128758 | Ga0207680_101287582 | 69 |
| 20 | 3300025909 | Ga0207705_10007842 | Ga0207705_100078422 | 69 |
| 21 | 3300025913 | Ga0207695_10379625 | Ga0207695_103796252 | 69 |
| 22 | 3300025921 | Ga0207652_10357062 | Ga0207652_103570622 | 69 |
| 23 | 3300025929 | Ga0207664_10116609 | Ga0207664_101166093 | 69 |
| 24 | 3300025949 | Ga0207667_12264170 | Ga0207667_122641702 | 69 |
| 25 | 3300025960 | Ga0207651_10304071 | Ga0207651_103040712 | 69 |
| 26 | 3300026023 | Ga0207677_10061453 | Ga0207677_100614533 | 69 |
| 27 | 3300026035 | Ga0207703_10029258 | Ga0207703_100292586 | 69 |
| 28 | 3300026088 | Ga0207641_10172963 | Ga0207641_101729634 | 69 |
| 29 | 3300026089 | Ga0207648_10034958 | Ga0207648_100349585 | 69 |
| 30 | 3300028381 | Ga0268264_10319429 | Ga0268264_103194292 | 69 |
| 31 | 3300028800 | Ga0265338_11073695 | Ga0265338_110736952 | 69 |
| 32 | 3300035242 | Ga0373962_0042102 | Ga0373962_0042102_1019_1228 | 69 |
| 33 | 3300041459 | Ga0451800_1538542 | Ga0451800_1538542_102_311 | 69 |
| 34 | 3300050516 | nmdc:mga0sz30_165339_c1 | nmdc:mga0sz30_165339_c1_21_230 | 69 |
| 35 | 3300053158 | Ga0500627_0382696 | Ga0500627_0382696_376_585 | 69 |
| 36 | 3300005336 | Ga0070680_100037856 | Ga0070680_1000378564 | 70 |
| 37 | 3300005355 | Ga0070671_100025012 | Ga0070671_1000250127 | 70 |
| 38 | 3300005364 | Ga0070673_102064554 | Ga0070673_1020645542 | 70 |
| 39 | 3300005458 | Ga0070681_10090567 | Ga0070681_100905675 | 70 |
| 40 | 3300005530 | Ga0070679_100040804 | Ga0070679_1000408043 | 70 |
| 41 | 3300005614 | Ga0068856_102054774 | Ga0068856_1020547741 | 70 |
| 42 | 3300005617 | Ga0068859_100424506 | Ga0068859_1004245063 | 70 |
| 43 | 3300005841 | Ga0068863_100130684 | Ga0068863_1001306843 | 70 |
| 44 | 3300005841 | Ga0068863_101209359 | Ga0068863_1012093592 | 70 |
| 45 | 3300006931 | Ga0097620_100424476 | Ga0097620_1004244761 | 70 |
| 46 | 3300009093 | Ga0105240_10000118 | Ga0105240_1000011817 | 70 |
| 47 | 3300009094 | Ga0111539_11239744 | Ga0111539_112397441 | 70 |
| 48 | 3300009101 | Ga0105247_10205588 | Ga0105247_102055882 | 70 |
| 49 | 3300009176 | Ga0105242_13147619 | Ga0105242_131476192 | 70 |
| 50 | 3300009545 | Ga0105237_10310938 | Ga0105237_103109383 | 70 |
| 51 | 3300013105 | Ga0157369_10136895 | Ga0157369_101368953 | 70 |
| 52 | 3300013306 | Ga0163162_12504899 | Ga0163162_125048992 | 70 |
| 53 | 3300013307 | Ga0157372_10020217 | Ga0157372_100202174 | 70 |
| 54 | 3300014968 | Ga0157379_10118313 | Ga0157379_101183133 | 70 |
| 55 | 3300025900 | Ga0207710_10364375 | Ga0207710_103643752 | 70 |
| 56 | 3300025913 | Ga0207695_10003048 | Ga0207695_1000304825 | 70 |
| 57 | 3300025914 | Ga0207671_10579723 | Ga0207671_105797232 | 70 |
| 58 | 3300025917 | Ga0207660_10015677 | Ga0207660_100156774 | 70 |
| 59 | 3300025921 | Ga0207652_10003529 | Ga0207652_1000352911 | 70 |
| 60 | 3300025931 | Ga0207644_10016264 | Ga0207644_100162643 | 70 |
| 61 | 3300026078 | Ga0207702_11450761 | Ga0207702_114507612 | 70 |
| 62 | 3300026088 | Ga0207641_10918958 | Ga0207641_109189582 | 70 |
| 63 | 3300028556 | Ga0265337_1008585 | Ga0265337_10085855 | 70 |
| 64 | 3300003323 | rootH1_10057818 | rootH1_100578186 | 71 |
| 65 | 3300005327 | Ga0070658_10034624 | Ga0070658_100346244 | 71 |
| 66 | 3300005327 | Ga0070658_10720312 | Ga0070658_107203122 | 71 |
| 67 | 3300005335 | Ga0070666_10006299 | Ga0070666_100062995 | 71 |
| 68 | 3300005335 | Ga0070666_10067112 | Ga0070666_100671122 | 71 |
| 69 | 3300005340 | Ga0070689_101695126 | Ga0070689_1016951261 | 71 |
| 70 | 3300005347 | Ga0070668_100247653 | Ga0070668_1002476532 | 71 |
| 71 | 3300005347 | Ga0070668_100326589 | Ga0070668_1003265892 | 71 |
| 72 | 3300005353 | Ga0070669_100151350 | Ga0070669_1001513504 | 71 |
| 73 | 3300005355 | Ga0070671_100000001 | Ga0070671_10000000118 | 71 |
| 74 | 3300005367 | Ga0070667_100000001 | Ga0070667_1000000011165 | 71 |
| 75 | 3300005367 | Ga0070667_100186005 | Ga0070667_1001860051 | 71 |
| 76 | 3300005459 | Ga0068867_102198817 | Ga0068867_1021988172 | 71 |
| 77 | 3300005530 | Ga0070679_100309872 | Ga0070679_1003098723 | 71 |
| 78 | 3300005544 | Ga0070686_100030131 | Ga0070686_1000301314 | 71 |
| 79 | 3300005563 | Ga0068855_100000364 | Ga0068855_10000036454 | 71 |
| 80 | 3300005563 | Ga0068855_100045868 | Ga0068855_1000458687 | 71 |
| 81 | 3300005563 | Ga0068855_100142157 | Ga0068855_1001421574 | 71 |
| 82 | 3300005577 | Ga0068857_100023129 | Ga0068857_1000231295 | 71 |
| 83 | 3300005578 | Ga0068854_101189902 | Ga0068854_1011899022 | 71 |
| 84 | 3300005616 | Ga0068852_100017766 | Ga0068852_1000177667 | 71 |
| 85 | 3300005617 | Ga0068859_101518371 | Ga0068859_1015183712 | 71 |
| 86 | 3300005617 | Ga0068859_102973054 | Ga0068859_1029730542 | 71 |
| 87 | 3300005841 | Ga0068863_100109813 | Ga0068863_1001098133 | 71 |
| 88 | 3300005842 | Ga0068858_100012467 | Ga0068858_1000124674 | 71 |
| 89 | 3300005843 | Ga0068860_100005914 | Ga0068860_10000591411 | 71 |
| 90 | 3300005843 | Ga0068860_100133560 | Ga0068860_1001335602 | 71 |
| 91 | 3300005844 | Ga0068862_100074601 | Ga0068862_1000746015 | 71 |
| 92 | 3300006038 | Ga0075365_10000151 | Ga0075365_1000015114 | 71 |
| 93 | 3300006051 | Ga0075364_10000496 | Ga0075364_100004966 | 71 |
| 94 | 3300006051 | Ga0075364_10270332 | Ga0075364_102703322 | 71 |
| 95 | 3300006051 | Ga0075364_11002446 | Ga0075364_110024462 | 71 |
| 96 | 3300006177 | Ga0075362_10444032 | Ga0075362_104440322 | 71 |
| 97 | 3300006186 | Ga0075369_10000021 | Ga0075369_1000002116 | 71 |
| 98 | 3300006186 | Ga0075369_10135693 | Ga0075369_101356932 | 71 |
| 99 | 3300006195 | Ga0075366_10711039 | Ga0075366_107110392 | 71 |
| 100 | 3300006358 | Ga0068871_100000001 | Ga0068871_1000000015 | 71 |
| 101 | 3300006931 | Ga0097620_101518537 | Ga0097620_1015185372 | 71 |
| 102 | 3300006931 | Ga0097620_102970565 | Ga0097620_1029705652 | 71 |
| 103 | 3300009093 | Ga0105240_10002095 | Ga0105240_1000209522 | 71 |
| 104 | 3300009093 | Ga0105240_10009553 | Ga0105240_1000955311 | 71 |
| 105 | 3300009093 | Ga0105240_11118382 | Ga0105240_111183822 | 71 |
| 106 | 3300009098 | Ga0105245_10153490 | Ga0105245_101534903 | 71 |
| 107 | 3300009098 | Ga0105245_10232779 | Ga0105245_102327793 | 71 |
| 108 | 3300009098 | Ga0105245_10908219 | Ga0105245_109082192 | 71 |
| 109 | 3300009101 | Ga0105247_10040171 | Ga0105247_100401715 | 71 |
| 110 | 3300009101 | Ga0105247_10184673 | Ga0105247_101846732 | 71 |
| 111 | 3300009174 | Ga0105241_10000917 | Ga0105241_1000091714 | 71 |
| 112 | 3300009174 | Ga0105241_10601191 | Ga0105241_106011911 | 71 |
| 113 | 3300009176 | Ga0105242_10223353 | Ga0105242_102233534 | 71 |
| 114 | 3300009177 | Ga0105248_10028875 | Ga0105248_100288759 | 71 |
| 115 | 3300009551 | Ga0105238_10141121 | Ga0105238_101411214 | 71 |
| 116 | 3300009551 | Ga0105238_10375669 | Ga0105238_103756691 | 71 |
| 117 | 3300009553 | Ga0105249_11415137 | Ga0105249_114151371 | 71 |
| 118 | 3300009553 | Ga0105249_11627792 | Ga0105249_116277922 | 71 |
| 119 | 3300009993 | Ga0105028_103411 | Ga0105028_1034114 | 71 |
| 120 | 3300010375 | Ga0105239_11962475 | Ga0105239_119624752 | 71 |
| 121 | 3300011119 | Ga0105246_10015223 | Ga0105246_100152235 | 71 |
| 122 | 3300013102 | Ga0157371_10023238 | Ga0157371_100232385 | 71 |
| 123 | 3300013296 | Ga0157374_10044566 | Ga0157374_100445661 | 71 |
| 124 | 3300013296 | Ga0157374_12420769 | Ga0157374_124207692 | 71 |
| 125 | 3300013297 | Ga0157378_11106041 | Ga0157378_111060412 | 71 |
| 126 | 3300013307 | Ga0157372_10017916 | Ga0157372_100179168 | 71 |
| 127 | 3300013307 | Ga0157372_10198815 | Ga0157372_101988152 | 71 |
| 128 | 3300013307 | Ga0157372_12896102 | Ga0157372_128961022 | 71 |
| 129 | 3300014325 | Ga0163163_10026687 | Ga0163163_1002668710 | 71 |
| 130 | 3300014325 | Ga0163163_10291391 | Ga0163163_102913913 | 71 |
| 131 | 3300014325 | Ga0163163_11160069 | Ga0163163_111600691 | 71 |
| 132 | 3300014745 | Ga0157377_10026744 | Ga0157377_100267445 | 71 |
| 133 | 3300025900 | Ga0207710_10110237 | Ga0207710_101102372 | 71 |
| 134 | 3300025903 | Ga0207680_10040297 | Ga0207680_100402975 | 71 |
| 135 | 3300025903 | Ga0207680_10052309 | Ga0207680_100523092 | 71 |
| 136 | 3300025903 | Ga0207680_11107003 | Ga0207680_111070032 | 71 |
| 137 | 3300025911 | Ga0207654_10000905 | Ga0207654_1000090511 | 71 |
| 138 | 3300025913 | Ga0207695_10001907 | Ga0207695_1000190718 | 71 |
| 139 | 3300025913 | Ga0207695_10001983 | Ga0207695_100019834 | 71 |
| 140 | 3300025917 | Ga0207660_10182364 | Ga0207660_101823641 | 71 |
| 141 | 3300025920 | Ga0207649_11124950 | Ga0207649_111249502 | 71 |
| 142 | 3300025921 | Ga0207652_11069106 | Ga0207652_110691062 | 71 |
| 143 | 3300025923 | Ga0207681_10135081 | Ga0207681_101350814 | 71 |
| 144 | 3300025923 | Ga0207681_11362346 | Ga0207681_113623462 | 71 |
| 145 | 3300025924 | Ga0207694_10123272 | Ga0207694_101232723 | 71 |
| 146 | 3300025927 | Ga0207687_10120614 | Ga0207687_101206142 | 71 |
| 147 | 3300025927 | Ga0207687_10470955 | Ga0207687_104709553 | 71 |
| 148 | 3300025931 | Ga0207644_10000001 | Ga0207644_1000000166 | 71 |
| 149 | 3300025931 | Ga0207644_11199081 | Ga0207644_111990811 | 71 |
| 150 | 3300025934 | Ga0207686_10400330 | Ga0207686_104003302 | 71 |
| 151 | 3300025949 | Ga0207667_10000434 | Ga0207667_1000043410 | 71 |
| 152 | 3300025949 | Ga0207667_10035276 | Ga0207667_100352767 | 71 |
| 153 | 3300025949 | Ga0207667_10074552 | Ga0207667_100745523 | 71 |
| 154 | 3300025961 | Ga0207712_10692690 | Ga0207712_106926901 | 71 |
| 155 | 3300025961 | Ga0207712_11642413 | Ga0207712_116424132 | 71 |
| 156 | 3300025972 | Ga0207668_10193133 | Ga0207668_101931333 | 71 |
| 157 | 3300025972 | Ga0207668_10223959 | Ga0207668_102239593 | 71 |
| 158 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003219 | 71 |
| 159 | 3300025986 | Ga0207658_10091228 | Ga0207658_100912283 | 71 |
| 160 | 3300026035 | Ga0207703_10001658 | Ga0207703_1000165810 | 71 |
| 161 | 3300026035 | Ga0207703_10254739 | Ga0207703_102547393 | 71 |
| 162 | 3300026088 | Ga0207641_10112305 | Ga0207641_101123053 | 71 |
| 163 | 3300026095 | Ga0207676_11565678 | Ga0207676_115656781 | 71 |
| 164 | 3300026116 | Ga0207674_10017029 | Ga0207674_100170294 | 71 |
| 165 | 3300026142 | Ga0207698_10012285 | Ga0207698_100122856 | 71 |
| 166 | 3300027617 | Ga0210002_1005398 | Ga0210002_10053982 | 71 |
| 167 | 3300027717 | Ga0209998_10011583 | Ga0209998_100115833 | 71 |
| 168 | 3300028380 | Ga0268265_10077495 | Ga0268265_100774955 | 71 |
| 169 | 3300028381 | Ga0268264_10007278 | Ga0268264_100072786 | 71 |
| 170 | 3300028381 | Ga0268264_10728717 | Ga0268264_107287172 | 71 |
| 171 | 3300028558 | Ga0265326_10109756 | Ga0265326_101097562 | 71 |
| 172 | 3300028800 | Ga0265338_10070790 | Ga0265338_100707903 | 71 |
| 173 | 3300031251 | Ga0265327_10001541 | Ga0265327_1000154116 | 71 |
| 174 | 3300031251 | Ga0265327_10004612 | Ga0265327_100046122 | 71 |
| 175 | 3300031251 | Ga0265327_10136629 | Ga0265327_101366292 | 71 |
| 176 | 3300031507 | Ga0307509_10023020 | Ga0307509_100230205 | 71 |
| 177 | 3300031903 | Ga0307407_11433627 | Ga0307407_114336272 | 71 |
| 178 | 3300031903 | Ga0307407_11664763 | Ga0307407_116647631 | 71 |
| 179 | 3300037068 | Ga0373925_0126490 | Ga0373925_0126490_1164_1379 | 71 |
| 180 | 3300037312 | Ga0395899_0001513 | Ga0395899_0001513_13137_13352 | 71 |
| 181 | 3300037312 | Ga0395899_0031150 | Ga0395899_0031150_2708_2923 | 71 |
| 182 | 3300037418 | Ga0395900_0037003 | Ga0395900_0037003_2771_2986 | 71 |
| 183 | 3300037418 | Ga0395900_0056463 | Ga0395900_0056463_3753_3968 | 71 |
| 184 | 3300037418 | Ga0395900_0103815 | Ga0395900_0103815_354_569 | 71 |
| 185 | 3300037466 | Ga0395898_0001854 | Ga0395898_0001854_16780_16995 | 71 |
| 186 | 3300037466 | Ga0395898_0016480 | Ga0395898_0016480_4566_4781 | 71 |
| 187 | 3300037471 | Ga0395905_0000682 | Ga0395905_0000682_39554_39769 | 71 |
| 188 | 3300037471 | Ga0395905_0076224 | Ga0395905_0076224_1210_1425 | 71 |
| 189 | 3300038443 | Ga0395901_0002934 | Ga0395901_0002934_6539_6754 | 71 |
| 190 | 3300038443 | Ga0395901_0003747 | Ga0395901_0003747_9846_10061 | 71 |
| 191 | 3300038443 | Ga0395901_0053367 | Ga0395901_0053367_502_717 | 71 |
| 192 | 3300041443 | Ga0451789_0704842 | Ga0451789_0704842_172_387 | 71 |
| 193 | 3300041486 | Ga0451807_2720857 | Ga0451807_2720857_606_821 | 71 |
| 194 | 3300041491 | Ga0451833_0079502 | Ga0451833_0079502_94_309 | 71 |
| 195 | 3300041997 | Ga0439431_0057281 | Ga0439431_0057281_375_593 | 71 |
| 196 | 3300042002 | Ga0439442_032135 | Ga0439442_032135_278_496 | 71 |
| 197 | 3300045836 | Ga0466958_0808976 | Ga0466958_0808976_147_365 | 71 |
| 198 | 3300045976 | Ga0466967_0266214 | Ga0466967_0266214_743_958 | 71 |
| 199 | 3300046457 | Ga0495590_0092501 | Ga0495590_0092501_352_567 | 71 |
| 200 | 3300046506 | Ga0495583_0048413 | Ga0495583_0048413_721_936 | 71 |
| 201 | 3300046692 | Ga0495671_0386560 | Ga0495671_0386560_199_414 | 71 |
| 202 | 3300046810 | Ga0495660_0001416 | Ga0495660_0001416_2647_2862 | 71 |
| 203 | 3300047320 | Ga0495672_0000016 | Ga0495672_0000016_439885_440100 | 71 |
| 204 | 3300047320 | Ga0495672_0021288 | Ga0495672_0021288_3441_3656 | 71 |
| 205 | 3300047320 | Ga0495672_0050808 | Ga0495672_0050808_612_830 | 71 |
| 206 | 3300048928 | Ga0496125_0233991 | Ga0496125_0233991_891_1106 | 71 |
| 207 | 3300049571 | Ga0501034_1158256 | Ga0501034_1158256_207_422 | 71 |
| 208 | 3300049589 | Ga0501073_0022183 | Ga0501073_0022183_336_551 | 71 |
| 209 | 3300049742 | Ga0501080_0000252 | Ga0501080_0000252_19423_19638 | 71 |
| 210 | 3300050489 | nmdc:mga03683_698614_c1 | nmdc:mga03683_698614_c1_99_314 | 71 |
| 211 | 3300050489 | nmdc:mga03683_89854_c2 | nmdc:mga03683_89854_c2_336_551 | 71 |
| 212 | 3300050491 | nmdc:mga00v17_247493_c1 | nmdc:mga00v17_247493_c1_705_920 | 71 |
| 213 | 3300050491 | nmdc:mga00v17_585_c1 | nmdc:mga00v17_585_c1_15726_15944 | 71 |
| 214 | 3300050491 | nmdc:mga00v17_882589_c1 | nmdc:mga00v17_882589_c1_126_341 | 71 |
| 215 | 3300050492 | nmdc:mga0yw44_182_c1 | nmdc:mga0yw44_182_c1_12602_12820 | 71 |
| 216 | 3300050493 | nmdc:mga0k408_748791_c1 | nmdc:mga0k408_748791_c1_175_390 | 71 |
| 217 | 3300050516 | nmdc:mga0sz30_2_c1 | nmdc:mga0sz30_2_c1_42141_42356 | 71 |
| 218 | 3300050516 | nmdc:mga0sz30_52796_c1 | nmdc:mga0sz30_52796_c1_178_393 | 71 |
| 219 | 3300053079 | Ga0500610_0002552 | Ga0500610_0002552_1237_1452 | 71 |
| 220 | 3300053087 | Ga0500643_000011 | Ga0500643_000011_372821_373036 | 71 |
| 221 | 3300053087 | Ga0500643_000428 | Ga0500643_000428_13761_13976 | 71 |
| 222 | 3300053088 | Ga0500644_0000397 | Ga0500644_0000397_10134_10349 | 71 |
| 223 | 3300053088 | Ga0500644_0028941 | Ga0500644_0028941_449_667 | 71 |
| 224 | 3300053088 | Ga0500644_0318677 | Ga0500644_0318677_328_543 | 71 |
| 225 | 3300053090 | Ga0500646_0016433 | Ga0500646_0016433_291_509 | 71 |
| 226 | 3300053092 | Ga0500583_0000146 | Ga0500583_0000146_12743_12958 | 71 |
| 227 | 3300053092 | Ga0500583_0028716 | Ga0500583_0028716_536_751 | 71 |
| 228 | 3300053093 | Ga0500651_0000246 | Ga0500651_0000246_17911_18129 | 71 |
| 229 | 3300053093 | Ga0500651_0138576 | Ga0500651_0138576_369_584 | 71 |
| 230 | 3300053102 | Ga0500554_061291 | Ga0500554_061291_248_466 | 71 |
| 231 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_1338439_1338654 | 71 |
| 232 | 3300053103 | Ga0500555_114251 | Ga0500555_114251_264_479 | 71 |
| 233 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_682173_682388 | 71 |
| 234 | 3300053126 | Ga0500621_013026 | Ga0500621_013026_672_887 | 71 |
| 235 | 3300053130 | Ga0500642_0001929 | Ga0500642_0001929_2475_2690 | 71 |
| 236 | 3300053133 | Ga0500655_045935 | Ga0500655_045935_538_753 | 71 |
| 237 | 3300053139 | Ga0500568_0096001 | Ga0500568_0096001_414_629 | 71 |
| 238 | 3300053142 | Ga0500577_0000369 | Ga0500577_0000369_8234_8449 | 71 |
| 239 | 3300053146 | Ga0500588_0089170 | Ga0500588_0089170_775_990 | 71 |
| 240 | 3300053147 | Ga0500589_000002 | Ga0500589_000002_227670_227885 | 71 |
| 241 | 3300053147 | Ga0500589_291819 | Ga0500589_291819_75_293 | 71 |
| 242 | 3300053151 | Ga0500604_0059359 | Ga0500604_0059359_398_613 | 71 |
| 243 | 3300053151 | Ga0500604_0286238 | Ga0500604_0286238_16_231 | 71 |
| 244 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_677126_677341 | 71 |
| 245 | 3300053727 | Ga0500611_000193 | Ga0500611_000193_7292_7507 | 71 |
| 246 | 3300053727 | Ga0500611_004473 | Ga0500611_004473_1491_1706 | 71 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar