F358238

General Info

Members Datasets Scaffolds Average Seq Length
246 166 492 425

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10133957|Ga0207691_101339572
Length 399
Sequence MRDEDPDFTIATLGECRVPSPLSGIRFTGDDERVLYHSTLDGIDACLARGARPPAMESAGPRRMLFFDPAKLACGIVTCGGLCPGLNDVIRAIVLNLHSQYGVRKVYGFRFGYEGLVRRLGHEPLELTPESVHRIHESGGSVLGSSRGPQDPAEMAEYLNELGVGVLFAIGGDGTLRGAQAIGEAAARRGLPIGVIGVPKTIDNDISNGIGLVKLMGRDSGFIAAYSALVNSHVNFCLVPEVPFTLEKFLPALQKRLERTKHALIVVAEGAGQGLMAKTGERDASGNVKYGDIGIFLRDAITKHFKQAGTDITLKYIDPSYTIRSVPATPHDAAFCLLLGQGAVHAGLSGRTNMVVSFWNHRFTHVLIALAVSERKKIDPSDTLWSSVVASTGQPREML

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
100 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.28
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10133957 3300025940 Bacteria 2187
2 Ga0070676_10023663 3300005328 Bacteria 3453
3 Ga0070690_100152116 3300005330 Bacteria 1580
4 Ga0070670_100111777 3300005331 Bacteria 2354
5 Ga0070670_100402415 3300005331 Unclassified 1208
6 Ga0068869_100002183 3300005334 Bacteria 11773
7 Ga0070666_10061736 3300005335 Bacteria 2538
8 Ga0068868_100030914 3300005338 Bacteria 4108
9 Ga0070689_100050662 3300005340 Bacteria 3209
10 Ga0070687_100001769 3300005343 Bacteria 7800
11 Ga0070675_100039117 3300005354 Bacteria 3868
12 Ga0070675_100106235 3300005354 Bacteria 2370
13 Ga0070671_100165799 3300005355 Bacteria 1868
14 Ga0070674_100048246 3300005356 Bacteria 2922
15 Ga0070673_100035869 3300005364 Bacteria 3765
16 Ga0070709_10079249 3300005434 Bacteria 2139
17 Ga0070714_100018853 3300005435 Bacteria 5613
18 Ga0070713_100000195 3300005436 Bacteria 40439
19 Ga0070662_100076181 3300005457 Bacteria 2486
20 Ga0068867_100008315 3300005459 Bacteria 7325
21 Ga0070707_100160886 3300005468 Bacteria 2188
22 Ga0070697_100126529 3300005536 Bacteria 2141
23 Ga0070672_100015856 3300005543 Bacteria 5379
24 Ga0070672_100016903 3300005543 Bacteria 5235
25 Ga0070686_100000576 3300005544 Bacteria 21812
26 Ga0070686_100015244 3300005544 Bacteria 4446
27 Ga0070665_100016340 3300005548 Bacteria 7441
28 Ga0070665_100146587 3300005548 Bacteria 2363
29 Ga0070704_100059289 3300005549 Bacteria 2730
30 Ga0070704_100162186 3300005549 Bacteria 1769
31 Ga0068854_100001738 3300005578 Bacteria 13296
32 Ga0068854_100130722 3300005578 Bacteria 1917
33 Ga0068859_100014994 3300005617 Bacteria 7780
34 Ga0068861_100274537 3300005719 Bacteria 1449
35 Ga0068870_10005363 3300005840 Bacteria 5593
36 Ga0068858_100027845 3300005842 Bacteria 5250
37 Ga0068858_100094313 3300005842 Bacteria 2788
38 Ga0068860_100069326 3300005843 Bacteria 3351
39 Ga0068860_100219781 3300005843 Bacteria 1845
40 Ga0068862_100027478 3300005844 Bacteria 4789
41 Ga0068862_100111190 3300005844 Bacteria 2405
42 Ga0070717_10023157 3300006028 Bacteria 4917
43 Ga0070715_10000284 3300006163 Bacteria 12400
44 Ga0070716_100014228 3300006173 Bacteria 4073
45 Ga0070712_100018138 3300006175 Bacteria 4566
46 Ga0097621_100002403 3300006237 Bacteria 12829
47 Ga0097621_100252565 3300006237 Bacteria 1544
48 Ga0068871_100000137 3300006358 Bacteria 47104
49 Ga0068871_100003037 3300006358 Bacteria 11513
50 Ga0068871_100021653 3300006358 Bacteria 4945
51 Ga0068871_100053560 3300006358 Bacteria 3270
52 Ga0068871_100067471 3300006358 Bacteria 2935
53 Ga0068871_100264236 3300006358 Bacteria 1502
54 Ga0068871_100268850 3300006358 Bacteria 1489
55 Ga0075428_100016772 3300006844 Bacteria 8088
56 Ga0075428_100089847 3300006844 Bacteria 3350
57 Ga0075428_100204503 3300006844 Bacteria 2134
58 Ga0075428_100283677 3300006844 Unclassified 1782
59 Ga0075433_10100392 3300006852 Bacteria 2562
60 Ga0075434_100012278 3300006871 Bacteria 8116
61 Ga0075434_100082456 3300006871 Bacteria 3213
62 Ga0075429_100087356 3300006880 Bacteria 2717
63 Ga0068865_100075861 3300006881 Bacteria 2398
64 Ga0068865_100197247 3300006881 Bacteria 1561
65 Ga0097620_100014994 3300006931 Bacteria 7780
66 Ga0075435_100008647 3300007076 Bacteria 7320
67 Ga0075435_100009968 3300007076 Bacteria 6923
68 Ga0111539_10006438 3300009094 Bacteria 15133
69 Ga0111539_10063492 3300009094 Bacteria 4370
70 Ga0111539_10072381 3300009094 Bacteria 4065
71 Ga0111539_10144346 3300009094 Bacteria 2786
72 Ga0111539_10160003 3300009094 Bacteria 2634
73 Ga0105245_10000516 3300009098 Bacteria 35436
74 Ga0105245_10068030 3300009098 Bacteria 3226
75 Ga0105247_10100362 3300009101 Bacteria 1850
76 Ga0114129_10077727 3300009147 Bacteria 4616
77 Ga0114129_10098672 3300009147 Bacteria 4043
78 Ga0114129_10108147 3300009147 Bacteria 3840
79 Ga0105242_10016223 3300009176 Bacteria 5788
80 Ga0105242_10032988 3300009176 Bacteria 4144
81 Ga0105242_10034262 3300009176 Bacteria 4070
82 Ga0105242_10054623 3300009176 Bacteria 3265
83 Ga0105248_10028880 3300009177 Bacteria 6183
84 Ga0105248_10077398 3300009177 Bacteria 3739
85 Ga0105248_10136037 3300009177 Bacteria 2772
86 Ga0105238_10283431 3300009551 Bacteria 1638
87 Ga0105239_10017606 3300010375 Bacteria 7903
88 Ga0157374_10013288 3300013296 Bacteria 7184
89 Ga0157374_10013423 3300013296 Bacteria 7150
90 Ga0157378_10000632 3300013297 Bacteria 33025
91 Ga0163162_10034147 3300013306 Bacteria 5060
92 Ga0163162_10054971 3300013306 Bacteria 4006
93 Ga0157375_10102351 3300013308 Bacteria 2949
94 Ga0157375_10139088 3300013308 Bacteria 2554
95 Ga0157375_10180640 3300013308 Bacteria 2261
96 Ga0163163_10138764 3300014325 Bacteria 2473
97 Ga0157380_10074375 3300014326 Bacteria 2758
98 Ga0157380_10184487 3300014326 Bacteria 1836
99 Ga0157380_10198311 3300014326 Bacteria 1778
100 Ga0157379_10039913 3300014968 Bacteria 4189
101 Ga0157376_10087161 3300014969 Bacteria 2693
102 Ga0207682_10012770 3300025893 Bacteria 3276
103 Ga0207692_10038999 3300025898 Bacteria 2334
104 Ga0207680_10004868 3300025903 Bacteria 6389
105 Ga0207699_10124652 3300025906 Bacteria 1671
106 Ga0207645_10020107 3300025907 Bacteria 4371
107 Ga0207643_10011124 3300025908 Bacteria 4858
108 Ga0207671_10225461 3300025914 Bacteria 1469
109 Ga0207693_10000057 3300025915 Bacteria 94894
110 Ga0207662_10003073 3300025918 Bacteria 8516
111 Ga0207681_10137383 3300025923 Bacteria 1816
112 Ga0207650_10039724 3300025925 Bacteria 3439
113 Ga0207659_10001909 3300025926 Bacteria 12362
114 Ga0207700_10011885 3300025928 Bacteria 5580
115 Ga0207664_10013631 3300025929 Bacteria 5844
116 Ga0207644_10002269 3300025931 Bacteria 12469
117 Ga0207644_10058050 3300025931 Bacteria 2796
118 Ga0207644_10150201 3300025931 Bacteria 1802
119 Ga0207669_10054750 3300025937 Bacteria 2412
120 Ga0207665_10009191 3300025939 Bacteria 6489
121 Ga0207691_10027796 3300025940 Bacteria 5301
122 Ga0207711_10084014 3300025941 Bacteria 2786
123 Ga0207711_10100071 3300025941 Bacteria 2564
124 Ga0207711_10146983 3300025941 Bacteria 2124
125 Ga0207711_10201034 3300025941 Bacteria 1818
126 Ga0207711_10213013 3300025941 Bacteria 1765
127 Ga0207689_10011097 3300025942 Bacteria 7740
128 Ga0207689_10011759 3300025942 Bacteria 7503
129 Ga0207651_10164974 3300025960 Bacteria 1741
130 Ga0207640_10032238 3300025981 Bacteria 3247
131 Ga0207640_10147543 3300025981 Bacteria 1723
132 Ga0207677_10016859 3300026023 Bacteria 4338
133 Ga0207703_10004056 3300026035 Bacteria 12098
134 Ga0207639_10086128 3300026041 Bacteria 2501
135 Ga0207678_10018349 3300026067 Bacteria 6145
136 Ga0207708_10105144 3300026075 Bacteria 2188
137 Ga0207648_10003366 3300026089 Bacteria 16795
138 Ga0207648_10014953 3300026089 Bacteria 7149
139 Ga0207648_10064339 3300026089 Bacteria 3196
140 Ga0207675_100002840 3300026118 Bacteria 17045
141 Ga0207675_100039968 3300026118 Bacteria 4377
142 Ga0207683_10068826 3300026121 Bacteria 3126
143 Ga0207683_10094524 3300026121 Bacteria 2664
144 Ga0207698_10206661 3300026142 Bacteria 1763
145 Ga0207428_10000912 3300027907 Bacteria 33045
146 Ga0268266_10019536 3300028379 Bacteria 5774
147 Ga0268266_10029307 3300028379 Bacteria 4679
148 Ga0268265_10110486 3300028380 Bacteria 2243
149 Ga0268265_10148989 3300028380 Bacteria 1971
150 Ga0268264_10030687 3300028381 Bacteria 4406
151 Ga0268264_10086285 3300028381 Bacteria 2696
152 Ga0268264_10304459 3300028381 Bacteria 1501
153 Ga0316576_10009602 3300031727 Bacteria 6253
154 Ga0316576_10011059 3300031727 Bacteria 5893
155 Ga0316578_10014306 3300031728 Unclassified 4235
156 Ga0373930_0001791 3300034816 Bacteria 3266
157 Ga0373950_0001063 3300034818 Bacteria 3512
158 Ga0373958_0000525 3300034819 Bacteria 4783
159 Ga0373959_0000967 3300034820 Bacteria 4790
160 Ga0373929_0002463 3300035085 Bacteria 3404
161 Ga0373940_0000674 3300035088 Bacteria 5466
162 Ga0373949_0000709 3300035090 Bacteria 10833
163 Ga0373951_0001405 3300035091 Bacteria 6329
164 Ga0373952_0001175 3300035092 Bacteria 4780
165 Ga0373923_0045519 3300035111 Bacteria 1823
166 Ga0373932_0000535 3300035112 Bacteria 11652
167 Ga0373936_0015822 3300035113 Bacteria 2894
168 Ga0373939_0000340 3300035114 Bacteria 11927
169 Ga0373941_0000226 3300035115 Bacteria 10839
170 Ga0373960_0014353 3300035121 Bacteria 2005
171 Ga0373942_0000224 3300035207 Bacteria 14909
172 Ga0373961_0001037 3300035241 Bacteria 8998
173 Ga0373962_0000575 3300035242 Bacteria 8320
174 Ga0316574_0135597 3300035398 Unclassified 1585
175 Ga0373935_0026328 3300035692 Bacteria 3588
176 Ga0373947_0063789 3300035725 Bacteria 2245
177 Ga0373937_0102578 3300036401 Bacteria 2656
178 Ga0316584_0006395 3300036712 Bacteria 7976
179 Ga0316584_0023604 3300036712 Bacteria 4494
180 Ga0395900_0474501 3300037418 Bacteria 1204
181 Ga0395905_0273291 3300037471 Bacteria 1576
182 Ga0439450_001344 3300042008 Bacteria 3577
183 Ga0439435_0027301 3300042436 Bacteria 1526
184 Ga0453684_0074645 3300044712 Bacteria 4267
185 Ga0453684_0082131 3300044712 Bacteria 4015
186 Ga0453684_0269426 3300044712 Bacteria 1947
187 Ga0451576_0017280 3300045051 Bacteria 7937
188 Ga0495603_0084206 3300046455 Bacteria 1862
189 Ga0495629_0013893 3300046459 Bacteria 5807
190 Ga0495629_0018573 3300046459 Bacteria 4972
191 Ga0495629_0083825 3300046459 Unclassified 2225
192 Ga0495580_0000961 3300046472 Bacteria 25258
193 Ga0495580_0004721 3300046472 Bacteria 11420
194 Ga0495582_0000916 3300046473 Bacteria 16418
195 Ga0495639_0067350 3300046475 Bacteria 1649
196 Ga0495594_0037512 3300046499 Bacteria 2644
197 Ga0495630_0015159 3300046517 Bacteria 5624
198 Ga0495586_0021618 3300046535 Bacteria 3431
199 Ga0495634_0058729 3300046642 Bacteria 2563
200 Ga0495647_0010545 3300046681 Bacteria 3148
201 Ga0495658_0014727 3300046683 Bacteria 4000
202 Ga0495674_0025444 3300047319 Bacteria 5428
203 Ga0495593_0145043 3300047673 Bacteria 1202
204 Ga0496100_0009307 3300048903 Bacteria 5518
205 Ga0496101_0005280 3300048904 Bacteria 8226
206 Ga0496102_0036974 3300048905 Bacteria 4402
207 Ga0496106_0079723 3300048909 Bacteria 2514
208 Ga0496106_0107250 3300048909 Bacteria 2172
209 Ga0496107_0019856 3300048910 Bacteria 4745
210 Ga0496107_0082683 3300048910 Bacteria 2342
211 Ga0496112_0008447 3300048915 Bacteria 9225
212 Ga0496114_0003525 3300048917 Bacteria 12010
213 Ga0496114_0025735 3300048917 Bacteria 4812
214 Ga0496115_0011010 3300048918 Bacteria 6774
215 Ga0496115_0054460 3300048918 Bacteria 3212
216 Ga0496115_0169571 3300048918 Bacteria 1805
217 Ga0501036_0069701 3300049572 Bacteria 2974
218 Ga0501039_0079339 3300049575 Bacteria 2554
219 Ga0501041_0030869 3300049577 Bacteria 3234
220 Ga0501071_0008723 3300049587 Bacteria 6710
221 Ga0501071_0068827 3300049587 Bacteria 2576
222 Ga0501072_0126173 3300049588 Bacteria 2039
223 Ga0501075_0001048 3300049591 Bacteria 17767
224 Ga0501075_0013398 3300049591 Bacteria 5851
225 Ga0501075_0020123 3300049591 Bacteria 4848
226 Ga0501076_0001353 3300049592 Bacteria 16395
227 Ga0501081_0130887 3300049743 Bacteria 1793
228 Ga0501081_0149174 3300049743 Bacteria 1679
229 Ga0501035_0094739 3300049822 Bacteria 2625
230 Ga0501045_0014692 3300049824 Bacteria 5553
231 nmdc:mga06z11_84348_c1 3300050494 Bacteria 1712
232 nmdc:mga05p37_77050_c1 3300050507 Bacteria 4105
233 nmdc:mga05p37_91027_c1 3300050507 Bacteria 3759
234 nmdc:mga08y16_35480_c1 3300050511 Bacteria 5237
235 nmdc:mga08y16_42543_c1 3300050511 Bacteria 4758
236 nmdc:mga08y16_82640_c1 3300050511 Bacteria 3348
237 nmdc:mga0n895_12543_c1 3300050512 Bacteria 7605
238 nmdc:mga0n895_296445_c1 3300050512 Bacteria 1639
239 nmdc:mga0n895_310465_c1 3300050512 Bacteria 1598
240 nmdc:mga0rr50_103346_c1 3300050513 Bacteria 2242
241 nmdc:mga0rr50_7854_c1 3300050513 Bacteria 6616
242 nmdc:mga0a205_6980_c1 3300050515 Bacteria 10212
243 Ga0495601_0029093 3300053077 Bacteria 3425
244 Ga0495595_0133064 3300053084 Bacteria 1217
245 Ga0501082_0001374 3300060353 Bacteria 21401
246 Ga0530510_0094563 3300061734 Bacteria 2183
247 Ga0207691_10133957
248 Ga0070676_10023663
249 Ga0070690_100152116
250 Ga0070670_100111777
251 Ga0070670_100402415
252 Ga0068869_100002183
253 Ga0070666_10061736
254 Ga0068868_100030914
255 Ga0070689_100050662
256 Ga0070687_100001769
257 Ga0070675_100039117
258 Ga0070675_100106235
259 Ga0070671_100165799
260 Ga0070674_100048246
261 Ga0070673_100035869
262 Ga0070709_10079249
263 Ga0070714_100018853
264 Ga0070713_100000195
265 Ga0070662_100076181
266 Ga0068867_100008315
267 Ga0070707_100160886
268 Ga0070697_100126529
269 Ga0070672_100015856
270 Ga0070672_100016903
271 Ga0070686_100000576
272 Ga0070686_100015244
273 Ga0070665_100016340
274 Ga0070665_100146587
275 Ga0070704_100059289
276 Ga0070704_100162186
277 Ga0068854_100001738
278 Ga0068854_100130722
279 Ga0068859_100014994
280 Ga0068861_100274537
281 Ga0068870_10005363
282 Ga0068858_100027845
283 Ga0068858_100094313
284 Ga0068860_100069326
285 Ga0068860_100219781
286 Ga0068862_100027478
287 Ga0068862_100111190
288 Ga0070717_10023157
289 Ga0070715_10000284
290 Ga0070716_100014228
291 Ga0070712_100018138
292 Ga0097621_100002403
293 Ga0097621_100252565
294 Ga0068871_100000137
295 Ga0068871_100003037
296 Ga0068871_100021653
297 Ga0068871_100053560
298 Ga0068871_100067471
299 Ga0068871_100264236
300 Ga0068871_100268850
301 Ga0075428_100016772
302 Ga0075428_100089847
303 Ga0075428_100204503
304 Ga0075428_100283677
305 Ga0075433_10100392
306 Ga0075434_100012278
307 Ga0075434_100082456
308 Ga0075429_100087356
309 Ga0068865_100075861
310 Ga0068865_100197247
311 Ga0097620_100014994
312 Ga0075435_100008647
313 Ga0075435_100009968
314 Ga0111539_10006438
315 Ga0111539_10063492
316 Ga0111539_10072381
317 Ga0111539_10144346
318 Ga0111539_10160003
319 Ga0105245_10000516
320 Ga0105245_10068030
321 Ga0105247_10100362
322 Ga0114129_10077727
323 Ga0114129_10098672
324 Ga0114129_10108147
325 Ga0105242_10016223
326 Ga0105242_10032988
327 Ga0105242_10034262
328 Ga0105242_10054623
329 Ga0105248_10028880
330 Ga0105248_10077398
331 Ga0105248_10136037
332 Ga0105238_10283431
333 Ga0105239_10017606
334 Ga0157374_10013288
335 Ga0157374_10013423
336 Ga0157378_10000632
337 Ga0163162_10034147
338 Ga0163162_10054971
339 Ga0157375_10102351
340 Ga0157375_10139088
341 Ga0157375_10180640
342 Ga0163163_10138764
343 Ga0157380_10074375
344 Ga0157380_10184487
345 Ga0157380_10198311
346 Ga0157379_10039913
347 Ga0157376_10087161
348 Ga0207682_10012770
349 Ga0207692_10038999
350 Ga0207680_10004868
351 Ga0207699_10124652
352 Ga0207645_10020107
353 Ga0207643_10011124
354 Ga0207671_10225461
355 Ga0207693_10000057
356 Ga0207662_10003073
357 Ga0207681_10137383
358 Ga0207650_10039724
359 Ga0207659_10001909
360 Ga0207700_10011885
361 Ga0207664_10013631
362 Ga0207644_10002269
363 Ga0207644_10058050
364 Ga0207644_10150201
365 Ga0207669_10054750
366 Ga0207665_10009191
367 Ga0207691_10027796
368 Ga0207711_10084014
369 Ga0207711_10100071
370 Ga0207711_10146983
371 Ga0207711_10201034
372 Ga0207711_10213013
373 Ga0207689_10011097
374 Ga0207689_10011759
375 Ga0207651_10164974
376 Ga0207640_10032238
377 Ga0207640_10147543
378 Ga0207677_10016859
379 Ga0207703_10004056
380 Ga0207639_10086128
381 Ga0207678_10018349
382 Ga0207708_10105144
383 Ga0207648_10003366
384 Ga0207648_10014953
385 Ga0207648_10064339
386 Ga0207675_100002840
387 Ga0207675_100039968
388 Ga0207683_10068826
389 Ga0207683_10094524
390 Ga0207698_10206661
391 Ga0207428_10000912
392 Ga0268266_10019536
393 Ga0268266_10029307
394 Ga0268265_10110486
395 Ga0268265_10148989
396 Ga0268264_10030687
397 Ga0268264_10086285
398 Ga0268264_10304459
399 Ga0316576_10009602
400 Ga0316576_10011059
401 Ga0316578_10014306
402 Ga0373930_0001791
403 Ga0373950_0001063
404 Ga0373958_0000525
405 Ga0373959_0000967
406 Ga0373929_0002463
407 Ga0373940_0000674
408 Ga0373949_0000709
409 Ga0373951_0001405
410 Ga0373952_0001175
411 Ga0373923_0045519
412 Ga0373932_0000535
413 Ga0373936_0015822
414 Ga0373939_0000340
415 Ga0373941_0000226
416 Ga0373960_0014353
417 Ga0373942_0000224
418 Ga0373961_0001037
419 Ga0373962_0000575
420 Ga0316574_0135597
421 Ga0373935_0026328
422 Ga0373947_0063789
423 Ga0373937_0102578
424 Ga0316584_0006395
425 Ga0316584_0023604
426 Ga0395900_0474501
427 Ga0395905_0273291
428 Ga0439450_001344
429 Ga0439435_0027301
430 Ga0453684_0074645
431 Ga0453684_0082131
432 Ga0453684_0269426
433 Ga0451576_0017280
434 Ga0495603_0084206
435 Ga0495629_0013893
436 Ga0495629_0018573
437 Ga0495629_0083825
438 Ga0495580_0000961
439 Ga0495580_0004721
440 Ga0495582_0000916
441 Ga0495639_0067350
442 Ga0495594_0037512
443 Ga0495630_0015159
444 Ga0495586_0021618
445 Ga0495634_0058729
446 Ga0495647_0010545
447 Ga0495658_0014727
448 Ga0495674_0025444
449 Ga0495593_0145043
450 Ga0496100_0009307
451 Ga0496101_0005280
452 Ga0496102_0036974
453 Ga0496106_0079723
454 Ga0496106_0107250
455 Ga0496107_0019856
456 Ga0496107_0082683
457 Ga0496112_0008447
458 Ga0496114_0003525
459 Ga0496114_0025735
460 Ga0496115_0011010
461 Ga0496115_0054460
462 Ga0496115_0169571
463 Ga0501036_0069701
464 Ga0501039_0079339
465 Ga0501041_0030869
466 Ga0501071_0008723
467 Ga0501071_0068827
468 Ga0501072_0126173
469 Ga0501075_0001048
470 Ga0501075_0013398
471 Ga0501075_0020123
472 Ga0501076_0001353
473 Ga0501081_0130887
474 Ga0501081_0149174
475 Ga0501035_0094739
476 Ga0501045_0014692
477 nmdc:mga06z11_84348_c1
478 nmdc:mga05p37_77050_c1
479 nmdc:mga05p37_91027_c1
480 nmdc:mga08y16_35480_c1
481 nmdc:mga08y16_42543_c1
482 nmdc:mga08y16_82640_c1
483 nmdc:mga0n895_12543_c1
484 nmdc:mga0n895_296445_c1
485 nmdc:mga0n895_310465_c1
486 nmdc:mga0rr50_103346_c1
487 nmdc:mga0rr50_7854_c1
488 nmdc:mga0a205_6980_c1
489 Ga0495601_0029093
490 Ga0495595_0133064
491 Ga0501082_0001374
492 Ga0530510_0094563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

73

210

0.91

PF00365

PFK

Phosphofructokinase

207

347

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f5m-assembly1.cif.gz_A crystal structure of atp-bound phosphofructokinase from trypanosoma brucei 0.9213 1 421
3f5m-assembly1.cif.gz_D crystal structure of atp-bound phosphofructokinase from trypanosoma brucei 0.9202 1 421
2hig-assembly1.cif.gz_B-2 crystal structure of phosphofructokinase apoenzyme from trypanosoma brucei. 0.9185 1 421
3f5m-assembly1.cif.gz_B crystal structure of atp-bound phosphofructokinase from trypanosoma brucei 0.9159 1 421
6qu3-assembly1.cif.gz_D crystal structure of phosphofructokinase from trypanosoma brucei in complex with an allosteric inhibitor ctcb360 0.9146 1 421
ID Description Score Start End Superfamily
af_A0A1D6EPV9_351_509_3.40.50.460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9833 215 369 3.40.50.460
af_A0A1D6EPV9_351_509_3.40.50.460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9529 215 369 3.40.50.460
af_Q4E657_92_285_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9472 69 261 3.40.50.450
af_Q4E657_92_285_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9378 69 261 3.40.50.450
3f5mA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9374 69 401 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A061S0M5-F1-model_v4 Phosphofructokinase family protein 0.9784 218 317 GO:0003872
GO:0046872
AF-A0A4Q3BHI3-F1-model_v4 deleted 0.9769 259 429
AF-A0A7V1P2T6-F1-model_v4 deleted 0.9748 226 425
AF-A0A143PPW2-F1-model_v4 ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase) 0.9738 1 429 GO:0003872
GO:0005524
GO:0005737
GO:0006002
GO:0046872
AF-A0A143PPW2-F1-model_v4 ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase) 0.9716 1 429 GO:0003872
GO:0005524
GO:0005737
GO:0006002
GO:0046872

Map