F357347

General Info

Members Datasets Scaffolds Average Seq Length
245 163 490 148

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10090641|Ga0105239_100906411
Length 175
Sequence VGAGRRAGGGDRMSQATKVKAKPKGLDRPSTTKVIKVMSSLHTRLYRVTGGRIGKNWRIGAAARKAVPVCLVTTTGRKSGQPRTVPLCFLEDGQSIVLVASQGGLPTNPQWYYNVKANPEVQIEIGRQRRVYRARVAGRQERARLWPRLVAMYADYASYQSWTDREIPVVVCEPA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
160 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
161 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
162 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
163 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 6.53
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10090641 3300010375 Bacteria 3373
2 JGI24751J29686_10010014 3300002459 Bacteria 1953
3 rootH1_10260705 3300003323 Bacteria 1329
4 Ga0070666_10010663 3300005335 Bacteria 5753
5 Ga0068868_100984042 3300005338 Bacteria 771
6 Ga0070687_100162662 3300005343 Bacteria 1321
7 Ga0070661_101803995 3300005344 Bacteria 519
8 Ga0070692_10039772 3300005345 Bacteria 2402
9 Ga0070671_100018264 3300005355 Bacteria 5695
10 Ga0070671_100076847 3300005355 Bacteria 2790
11 Ga0070674_100001292 3300005356 Bacteria 13174
12 Ga0070688_100247612 3300005365 Bacteria 1268
13 Ga0070667_100002881 3300005367 Bacteria 14788
14 Ga0070667_100196245 3300005367 Bacteria 1789
15 Ga0070703_10164437 3300005406 Bacteria 845
16 Ga0070714_100340305 3300005435 Bacteria 1407
17 Ga0070710_10000423 3300005437 Bacteria 19929
18 Ga0070710_11226004 3300005437 Bacteria 555
19 Ga0070701_10008067 3300005438 Bacteria 4533
20 Ga0070711_100003922 3300005439 Bacteria 8741
21 Ga0070700_100001071 3300005441 Bacteria 13571
22 Ga0070663_100011174 3300005455 Bacteria 5624
23 Ga0070678_100000075 3300005456 Bacteria 37282
24 Ga0070678_100370110 3300005456 Bacteria 1237
25 Ga0070662_100244912 3300005457 Bacteria 1439
26 Ga0070681_11416089 3300005458 Unclassified 619
27 Ga0070684_100150256 3300005535 Bacteria 2110
28 Ga0070684_100372767 3300005535 Bacteria 1314
29 Ga0070697_100414592 3300005536 Bacteria 1170
30 Ga0068853_100002826 3300005539 Bacteria 13152
31 Ga0070693_100516010 3300005547 Bacteria 850
32 Ga0070665_100008561 3300005548 Bacteria 10351
33 Ga0070665_100045752 3300005548 Bacteria 4395
34 Ga0070704_100000415 3300005549 Bacteria 19786
35 Ga0070704_100582913 3300005549 Bacteria 981
36 Ga0068855_100010910 3300005563 Bacteria 10968
37 Ga0068855_100089966 3300005563 Bacteria 3543
38 Ga0068854_100000209 3300005578 Bacteria 39503
39 Ga0068856_100317958 3300005614 Bacteria 1574
40 Ga0070702_100002730 3300005615 Bacteria 7715
41 Ga0068852_100040527 3300005616 Bacteria 3930
42 Ga0068852_101209107 3300005616 Bacteria 777
43 Ga0068852_101411681 3300005616 Unclassified 718
44 Ga0068859_100006371 3300005617 Bacteria 11971
45 Ga0068861_100001529 3300005719 Bacteria 14652
46 Ga0068861_100820029 3300005719 Bacteria 875
47 Ga0068863_100042602 3300005841 Bacteria 4313
48 Ga0068858_100003735 3300005842 Bacteria 15065
49 Ga0068860_100001399 3300005843 Bacteria 26149
50 Ga0075365_10000246 3300006038 Bacteria 18568
51 Ga0075363_100007088 3300006048 Bacteria 5127
52 Ga0075363_100204066 3300006048 Bacteria 1130
53 Ga0075364_10000205 3300006051 Bacteria 27728
54 Ga0075364_10020654 3300006051 Bacteria 4143
55 Ga0070715_10359597 3300006163 Bacteria 798
56 Ga0070716_100001760 3300006173 Bacteria 9790
57 Ga0070712_100369057 3300006175 Bacteria 1179
58 Ga0075369_10000103 3300006186 Bacteria 22804
59 Ga0075369_10004312 3300006186 Bacteria 5243
60 Ga0097621_100076483 3300006237 Bacteria 2777
61 Ga0075370_10110574 3300006353 Bacteria 1596
62 Ga0068871_100092144 3300006358 Bacteria 2527
63 Ga0075428_100588965 3300006844 Bacteria 1188
64 Ga0068865_100000661 3300006881 Bacteria 19433
65 Ga0097620_100006372 3300006931 Bacteria 11971
66 Ga0105250_10041887 3300009092 Bacteria 1835
67 Ga0105245_10000942 3300009098 Bacteria 26440
68 Ga0105245_10110653 3300009098 Bacteria 2554
69 Ga0105245_10300981 3300009098 Unclassified 1574
70 Ga0105247_10000092 3300009101 Bacteria 97046
71 Ga0105247_11102791 3300009101 Unclassified 626
72 Ga0105243_10001036 3300009148 Bacteria 25549
73 Ga0105241_10018696 3300009174 Bacteria 5102
74 Ga0105241_10513764 3300009174 Bacteria 1070
75 Ga0105241_10638095 3300009174 Unclassified 966
76 Ga0105241_10799885 3300009174 Bacteria 869
77 Ga0105242_10000597 3300009176 Bacteria 28284
78 Ga0105248_10005718 3300009177 Bacteria 13656
79 Ga0105248_11326157 3300009177 Bacteria 814
80 Ga0105237_10283228 3300009545 Bacteria 1660
81 Ga0105237_10367326 3300009545 Bacteria 1444
82 Ga0105237_10540628 3300009545 Bacteria 1172
83 Ga0105238_10348964 3300009551 Bacteria 1469
84 Ga0105238_11015445 3300009551 Bacteria 850
85 Ga0105249_10011623 3300009553 Bacteria 7739
86 Ga0105239_10235663 3300010375 Bacteria 2054
87 Ga0105239_10447896 3300010375 Bacteria 1464
88 Ga0105239_10943310 3300010375 Unclassified 991
89 Ga0157371_10201007 3300013102 Bacteria 1429
90 Ga0157370_10781023 3300013104 Bacteria 869
91 Ga0157369_10245581 3300013105 Bacteria 1869
92 Ga0157369_10856434 3300013105 Unclassified 933
93 Ga0157374_11615877 3300013296 Unclassified 672
94 Ga0157372_10002385 3300013307 Bacteria 20339
95 Ga0157375_10000305 3300013308 Bacteria 44365
96 Ga0163163_10102103 3300014325 Bacteria 2891
97 Ga0157380_10000605 3300014326 Bacteria 22074
98 Ga0157380_11393130 3300014326 Bacteria 751
99 Ga0157379_10060724 3300014968 Bacteria 3380
100 Ga0163161_10002665 3300017792 Bacteria 12684
101 Ga0163161_10435994 3300017792 Bacteria 1057
102 Ga0213876_10415330 3300021384 Unclassified 716
103 Ga0207696_1027151 3300025711 Bacteria 1766
104 Ga0207692_10001868 3300025898 Bacteria 7998
105 Ga0207710_10030681 3300025900 Bacteria 2347
106 Ga0207684_10133034 3300025910 Bacteria 2135
107 Ga0207654_10213810 3300025911 Bacteria 1275
108 Ga0207671_10278763 3300025914 Bacteria 1318
109 Ga0207693_10000717 3300025915 Bacteria 29831
110 Ga0207687_10000794 3300025927 Bacteria 21288
111 Ga0207687_10214188 3300025927 Unclassified 1513
112 Ga0207664_10140588 3300025929 Bacteria 2042
113 Ga0207664_10503368 3300025929 Bacteria 1085
114 Ga0207644_10015548 3300025931 Bacteria 5112
115 Ga0207706_10027380 3300025933 Bacteria 5096
116 Ga0207686_10002279 3300025934 Bacteria 10535
117 Ga0207709_10698269 3300025935 Bacteria 812
118 Ga0207670_10124449 3300025936 Bacteria 1879
119 Ga0207665_10004157 3300025939 Bacteria 9637
120 Ga0207665_10287514 3300025939 Bacteria 1225
121 Ga0207689_10100744 3300025942 Bacteria 2373
122 Ga0207667_10026079 3300025949 Bacteria 6391
123 Ga0207667_10150551 3300025949 Bacteria 2395
124 Ga0207668_10047666 3300025972 Bacteria 2935
125 Ga0207640_10003337 3300025981 Bacteria 8647
126 Ga0207658_10057415 3300025986 Bacteria 2892
127 Ga0207703_10013433 3300026035 Bacteria 6379
128 Ga0207639_10021835 3300026041 Bacteria 4602
129 Ga0207678_10013491 3300026067 Bacteria 7174
130 Ga0207708_10003940 3300026075 Bacteria 10927
131 Ga0207702_10566987 3300026078 Archaea 1112
132 Ga0207648_10001107 3300026089 Bacteria 30199
133 Ga0207675_100000555 3300026118 Bacteria 36440
134 Ga0207675_100126561 3300026118 Bacteria 2420
135 Ga0207683_10000654 3300026121 Bacteria 31734
136 Ga0207698_10005099 3300026142 Bacteria 8065
137 Ga0207698_10855074 3300026142 Unclassified 915
138 Ga0268266_10003769 3300028379 Bacteria 14856
139 Ga0307408_101915879 3300031548 Bacteria 569
140 Ga0307407_11220800 3300031903 Bacteria 588
141 Ga0307415_101632772 3300032126 Bacteria 620
142 Ga0436365_0318148 3300039437 Bacteria 999
143 Ga0439461_0023370 3300041410 Bacteria 1243
144 Ga0439466_0061785 3300041411 Bacteria 1205
145 Ga0439465_0004889 3300041413 Bacteria 4307
146 Ga0439465_0013643 3300041413 Bacteria 2531
147 Ga0451797_0959742 3300041453 Bacteria 527
148 Ga0451795_0096810 3300041456 Bacteria 1868
149 Ga0439445_0014548 3300042004 Bacteria 1917
150 Ga0439434_0042511 3300042435 Bacteria 1397
151 Ga0439434_0074576 3300042435 Bacteria 1071
152 Ga0466972_0028598 3300044658 Bacteria 2749
153 Ga0466972_0155538 3300044658 Bacteria 1074
154 Ga0466972_0171837 3300044658 Bacteria 1017
155 Ga0466966_0004582 3300044684 Bacteria 9103
156 Ga0466966_0014330 3300044684 Bacteria 5249
157 Ga0466966_0021261 3300044684 Bacteria 4262
158 Ga0466966_0023065 3300044684 Bacteria 4077
159 Ga0466966_0052066 3300044684 Bacteria 2602
160 Ga0466966_0176259 3300044684 Bacteria 1298
161 Ga0466961_0020301 3300044693 Bacteria 4274
162 Ga0466961_0030705 3300044693 Bacteria 3452
163 Ga0466961_0034766 3300044693 Bacteria 3235
164 Ga0466961_0040710 3300044693 Bacteria 2978
165 Ga0466961_0310231 3300044693 Bacteria 963
166 Ga0466963_0041414 3300044694 Bacteria 3021
167 Ga0466963_0081019 3300044694 Unclassified 2198
168 Ga0466963_0133145 3300044694 Bacteria 1719
169 Ga0466963_0157986 3300044694 Bacteria 1577
170 Ga0466963_0337828 3300044694 Unclassified 1060
171 Ga0466964_0348470 3300044706 Bacteria 760
172 Ga0466968_0023925 3300044735 Bacteria 2493
173 Ga0466968_0168308 3300044735 Bacteria 1014
174 Ga0466970_0048048 3300044765 Bacteria 2275
175 Ga0466970_0087219 3300044765 Bacteria 1692
176 Ga0466970_0202045 3300044765 Bacteria 1106
177 Ga0466957_0054804 3300044842 Bacteria 2435
178 Ga0466957_0057543 3300044842 Unclassified 2380
179 Ga0466957_0181553 3300044842 Bacteria 1374
180 Ga0466957_0334124 3300044842 Bacteria 1025
181 Ga0466957_0515477 3300044842 Bacteria 830
182 Ga0466957_0793305 3300044842 Bacteria 672
183 Ga0466960_0549023 3300044901 Bacteria 681
184 Ga0466959_0036626 3300045049 Bacteria 3625
185 Ga0466959_0057534 3300045049 Bacteria 2834
186 Ga0466959_0085875 3300045049 Bacteria 2264
187 Ga0466959_0264122 3300045049 Bacteria 1184
188 Ga0466959_1091581 3300045049 Bacteria 531
189 Ga0466958_0027864 3300045836 Bacteria 3345
190 Ga0466958_0032349 3300045836 Bacteria 3111
191 Ga0466958_0040108 3300045836 Bacteria 2814
192 Ga0466958_0135343 3300045836 Bacteria 1549
193 Ga0466958_0326939 3300045836 Bacteria 986
194 Ga0466958_0471838 3300045836 Bacteria 813
195 Ga0466958_0886944 3300045836 Bacteria 582
196 Ga0466967_0005189 3300045976 Bacteria 8968
197 Ga0466967_0019400 3300045976 Bacteria 5467
198 Ga0466967_0063656 3300045976 Bacteria 3278
199 Ga0466967_0105069 3300045976 Bacteria 2587
200 Ga0466967_0552568 3300045976 Bacteria 1133
201 Ga0466967_1287074 3300045976 Unclassified 728
202 Ga0466967_1553981 3300045976 Unclassified 659
203 Ga0495652_0910534 3300046529 Unclassified 580
204 Ga0495672_0028723 3300047320 Bacteria 3513
205 Ga0496100_0198170 3300048903 Bacteria 1462
206 Ga0496101_0008951 3300048904 Bacteria 6562
207 Ga0496101_0146593 3300048904 Bacteria 1803
208 Ga0496102_0001872 3300048905 Bacteria 18125
209 Ga0496103_0000277 3300048906 Bacteria 48396
210 Ga0496103_0042510 3300048906 Bacteria 2797
211 Ga0496104_0002275 3300048907 Bacteria 16561
212 Ga0496105_0041582 3300048908 Bacteria 3789
213 Ga0496106_0000372 3300048909 Bacteria 31847
214 Ga0496108_0741903 3300048911 Bacteria 850
215 Ga0496109_1326834 3300048912 Bacteria 655
216 Ga0496110_0044811 3300048913 Bacteria 3864
217 Ga0496114_0010200 3300048917 Bacteria 7474
218 Ga0496115_0059761 3300048918 Bacteria 3070
219 Ga0496120_0055754 3300048923 Bacteria 2233
220 Ga0501033_0034499 3300049570 Bacteria 3795
221 Ga0501038_0607103 3300049574 Bacteria 827
222 Ga0501070_0000325 3300049586 Bacteria 43267
223 Ga0501073_0173575 3300049589 Bacteria 1492
224 Ga0501080_0000096 3300049742 Bacteria 59454
225 nmdc:mga03683_16138_c1 3300050489 Bacteria 2799
226 nmdc:mga03n38_49084_c1 3300050490 Bacteria 1875
227 nmdc:mga00v17_2441_c1 3300050491 Bacteria 9504
228 nmdc:mga00v17_4504_c1 3300050491 Bacteria 7252
229 nmdc:mga0yw44_988_c2 3300050492 Bacteria 6116
230 nmdc:mga06z11_588094_c1 3300050494 Bacteria 677
231 nmdc:mga07m45_69157_c1 3300050496 Bacteria 2007
232 nmdc:mga0sz30_4475_c1 3300050516 Bacteria 5054
233 nmdc:mga0sz30_478553_c1 3300050516 Bacteria 560
234 Ga0500583_0169656 3300053092 Bacteria 1087
235 Ga0500641_0393347 3300053096 Bacteria 547
236 Ga0500588_0069202 3300053146 Bacteria 1153
237 Ga0500637_0144085 3300053178 Bacteria 1378
238 Ga0500645_000030 3300053730 Bacteria 121213
239 Ga0466962_0051189 3300061719 Bacteria 1974
240 Ga0466962_0077632 3300061719 Bacteria 1588
241 2644489246 2643221687 Bacteria 6500351
242 2744954468 2744054611 Bacteria 5611514
243 2866557187 2866552031 Bacteria 5824618
244 2954681950 2954673503 Bacteria 9685905
245 2954690975 2954682443 Bacteria 9862841
246 Ga0105239_10090641
247 JGI24751J29686_10010014
248 rootH1_10260705
249 Ga0070666_10010663
250 Ga0068868_100984042
251 Ga0070687_100162662
252 Ga0070661_101803995
253 Ga0070692_10039772
254 Ga0070671_100018264
255 Ga0070671_100076847
256 Ga0070674_100001292
257 Ga0070688_100247612
258 Ga0070667_100002881
259 Ga0070667_100196245
260 Ga0070703_10164437
261 Ga0070714_100340305
262 Ga0070710_10000423
263 Ga0070710_11226004
264 Ga0070701_10008067
265 Ga0070711_100003922
266 Ga0070700_100001071
267 Ga0070663_100011174
268 Ga0070678_100000075
269 Ga0070678_100370110
270 Ga0070662_100244912
271 Ga0070681_11416089
272 Ga0070684_100150256
273 Ga0070684_100372767
274 Ga0070697_100414592
275 Ga0068853_100002826
276 Ga0070693_100516010
277 Ga0070665_100008561
278 Ga0070665_100045752
279 Ga0070704_100000415
280 Ga0070704_100582913
281 Ga0068855_100010910
282 Ga0068855_100089966
283 Ga0068854_100000209
284 Ga0068856_100317958
285 Ga0070702_100002730
286 Ga0068852_100040527
287 Ga0068852_101209107
288 Ga0068852_101411681
289 Ga0068859_100006371
290 Ga0068861_100001529
291 Ga0068861_100820029
292 Ga0068863_100042602
293 Ga0068858_100003735
294 Ga0068860_100001399
295 Ga0075365_10000246
296 Ga0075363_100007088
297 Ga0075363_100204066
298 Ga0075364_10000205
299 Ga0075364_10020654
300 Ga0070715_10359597
301 Ga0070716_100001760
302 Ga0070712_100369057
303 Ga0075369_10000103
304 Ga0075369_10004312
305 Ga0097621_100076483
306 Ga0075370_10110574
307 Ga0068871_100092144
308 Ga0075428_100588965
309 Ga0068865_100000661
310 Ga0097620_100006372
311 Ga0105250_10041887
312 Ga0105245_10000942
313 Ga0105245_10110653
314 Ga0105245_10300981
315 Ga0105247_10000092
316 Ga0105247_11102791
317 Ga0105243_10001036
318 Ga0105241_10018696
319 Ga0105241_10513764
320 Ga0105241_10638095
321 Ga0105241_10799885
322 Ga0105242_10000597
323 Ga0105248_10005718
324 Ga0105248_11326157
325 Ga0105237_10283228
326 Ga0105237_10367326
327 Ga0105237_10540628
328 Ga0105238_10348964
329 Ga0105238_11015445
330 Ga0105249_10011623
331 Ga0105239_10235663
332 Ga0105239_10447896
333 Ga0105239_10943310
334 Ga0157371_10201007
335 Ga0157370_10781023
336 Ga0157369_10245581
337 Ga0157369_10856434
338 Ga0157374_11615877
339 Ga0157372_10002385
340 Ga0157375_10000305
341 Ga0163163_10102103
342 Ga0157380_10000605
343 Ga0157380_11393130
344 Ga0157379_10060724
345 Ga0163161_10002665
346 Ga0163161_10435994
347 Ga0213876_10415330
348 Ga0207696_1027151
349 Ga0207692_10001868
350 Ga0207710_10030681
351 Ga0207684_10133034
352 Ga0207654_10213810
353 Ga0207671_10278763
354 Ga0207693_10000717
355 Ga0207687_10000794
356 Ga0207687_10214188
357 Ga0207664_10140588
358 Ga0207664_10503368
359 Ga0207644_10015548
360 Ga0207706_10027380
361 Ga0207686_10002279
362 Ga0207709_10698269
363 Ga0207670_10124449
364 Ga0207665_10004157
365 Ga0207665_10287514
366 Ga0207689_10100744
367 Ga0207667_10026079
368 Ga0207667_10150551
369 Ga0207668_10047666
370 Ga0207640_10003337
371 Ga0207658_10057415
372 Ga0207703_10013433
373 Ga0207639_10021835
374 Ga0207678_10013491
375 Ga0207708_10003940
376 Ga0207702_10566987
377 Ga0207648_10001107
378 Ga0207675_100000555
379 Ga0207675_100126561
380 Ga0207683_10000654
381 Ga0207698_10005099
382 Ga0207698_10855074
383 Ga0268266_10003769
384 Ga0307408_101915879
385 Ga0307407_11220800
386 Ga0307415_101632772
387 Ga0436365_0318148
388 Ga0439461_0023370
389 Ga0439466_0061785
390 Ga0439465_0004889
391 Ga0439465_0013643
392 Ga0451797_0959742
393 Ga0451795_0096810
394 Ga0439445_0014548
395 Ga0439434_0042511
396 Ga0439434_0074576
397 Ga0466972_0028598
398 Ga0466972_0155538
399 Ga0466972_0171837
400 Ga0466966_0004582
401 Ga0466966_0014330
402 Ga0466966_0021261
403 Ga0466966_0023065
404 Ga0466966_0052066
405 Ga0466966_0176259
406 Ga0466961_0020301
407 Ga0466961_0030705
408 Ga0466961_0034766
409 Ga0466961_0040710
410 Ga0466961_0310231
411 Ga0466963_0041414
412 Ga0466963_0081019
413 Ga0466963_0133145
414 Ga0466963_0157986
415 Ga0466963_0337828
416 Ga0466964_0348470
417 Ga0466968_0023925
418 Ga0466968_0168308
419 Ga0466970_0048048
420 Ga0466970_0087219
421 Ga0466970_0202045
422 Ga0466957_0054804
423 Ga0466957_0057543
424 Ga0466957_0181553
425 Ga0466957_0334124
426 Ga0466957_0515477
427 Ga0466957_0793305
428 Ga0466960_0549023
429 Ga0466959_0036626
430 Ga0466959_0057534
431 Ga0466959_0085875
432 Ga0466959_0264122
433 Ga0466959_1091581
434 Ga0466958_0027864
435 Ga0466958_0032349
436 Ga0466958_0040108
437 Ga0466958_0135343
438 Ga0466958_0326939
439 Ga0466958_0471838
440 Ga0466958_0886944
441 Ga0466967_0005189
442 Ga0466967_0019400
443 Ga0466967_0063656
444 Ga0466967_0105069
445 Ga0466967_0552568
446 Ga0466967_1287074
447 Ga0466967_1553981
448 Ga0495652_0910534
449 Ga0495672_0028723
450 Ga0496100_0198170
451 Ga0496101_0008951
452 Ga0496101_0146593
453 Ga0496102_0001872
454 Ga0496103_0000277
455 Ga0496103_0042510
456 Ga0496104_0002275
457 Ga0496105_0041582
458 Ga0496106_0000372
459 Ga0496108_0741903
460 Ga0496109_1326834
461 Ga0496110_0044811
462 Ga0496114_0010200
463 Ga0496115_0059761
464 Ga0496120_0055754
465 Ga0501033_0034499
466 Ga0501038_0607103
467 Ga0501070_0000325
468 Ga0501073_0173575
469 Ga0501080_0000096
470 nmdc:mga03683_16138_c1
471 nmdc:mga03n38_49084_c1
472 nmdc:mga00v17_2441_c1
473 nmdc:mga00v17_4504_c1
474 nmdc:mga0yw44_988_c2
475 nmdc:mga06z11_588094_c1
476 nmdc:mga07m45_69157_c1
477 nmdc:mga0sz30_4475_c1
478 nmdc:mga0sz30_478553_c1
479 Ga0500583_0169656
480 Ga0500641_0393347
481 Ga0500588_0069202
482 Ga0500637_0144085
483 Ga0500645_000030
484 Ga0466962_0051189
485 Ga0466962_0077632
486 2644489246
487 2744954468
488 2866557187
489 2954681950
490 2954690975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

38

174

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9605 46 153
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9437 46 153
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9236 28 155
7kl8-assembly1.cif.gz_B structure of f420 binding protein rv1558 from mycobacterium tuberculosis with f420 bound 0.9061 26 155
3r5z-assembly2.cif.gz_B structure of a deazaflavin-dependent reductase from nocardia farcinica, with co-factor f420 0.9016 26 155
ID Description Score Start End Superfamily
af_P9WP13_9_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9292 23 155 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.917 28 155 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9121 38 155 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9058 26 153 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9047 38 155 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A318HR20-F1-model_v4 Deazaflavin-dependent oxidoreductase (Nitroreductase family) 0.9948 51 157 GO:0005886
GO:0016491
GO:0070967
AF-A0A7X7HUX8-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9787 47 155 GO:0005886
GO:0016491
GO:0070967
AF-A0A318HR20-F1-model_v4 Deazaflavin-dependent oxidoreductase (Nitroreductase family) 0.9766 51 157 GO:0005886
GO:0016491
GO:0070967
AF-A0A537EPZ7-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9746 47 157 GO:0005886
GO:0016491
GO:0070967
AF-A0A1H9KCN9-F1-model_v4 deleted 0.9714 46 156

Map