F357190

General Info

Members Datasets Scaffolds Average Seq Length
245 139 490 241

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100161761|Ga0070665_1001617613
Length 256
Sequence MNQTSRLLLISNSTVHGRGYLDHVQEQIKMFLGDARKALFFPFALYDRDDYAAKAKSRFAAMGYGLESAHATDNPKKAIDRADALFIGGGNTFRLLKALQDRELLEPIRRKVKGGAPYIGSSAGSNVAGPTIKTTKDMPIVQPRSFDSLGLVPFQISPHYLDPDPNSRHMGETQEERILQFLEENETPVVGIREGAWILIENRAVMLKGETGARIFRRGQAPVEVSPGGEIFKLVGGTGCKLKVRSCCVAAMSKGC

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.12
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100161761 3300005548 Unclassified 2241
2 JGI24035J26624_1000363 3300002126 Unclassified 4293
3 JGI24035J26624_1000999 3300002126 Unclassified 2669
4 Ga0065714_10067147 3300005288 Bacteria 5819
5 Ga0065704_10010439 3300005289 Bacteria 3435
6 Ga0065704_10090196 3300005289 Bacteria 2804
7 Ga0065704_10129224 3300005289 Bacteria 1651
8 Ga0065712_10106348 3300005290 Bacteria 1919
9 Ga0065712_10132403 3300005290 Bacteria 1534
10 Ga0065707_10020868 3300005295 Bacteria 1192
11 Ga0065707_10199525 3300005295 Bacteria 1313
12 Ga0070683_100101734 3300005329 Bacteria 2706
13 Ga0070683_100312030 3300005329 Bacteria 1496
14 Ga0070690_100170675 3300005330 Unclassified 1497
15 Ga0070690_100531767 3300005330 Bacteria 884
16 Ga0068868_100013673 3300005338 Bacteria 5961
17 Ga0070660_100292212 3300005339 Bacteria 1335
18 Ga0070660_100398664 3300005339 Bacteria 1138
19 Ga0070689_100004841 3300005340 Bacteria 9138
20 Ga0070668_100039135 3300005347 Unclassified 3626
21 Ga0070668_100044419 3300005347 Bacteria 3409
22 Ga0070669_100029078 3300005353 Unclassified 3982
23 Ga0070669_100382019 3300005353 Bacteria 1149
24 Ga0070675_100041687 3300005354 Bacteria 3749
25 Ga0070675_100203247 3300005354 Bacteria 1720
26 Ga0070675_100448642 3300005354 Unclassified 1157
27 Ga0070675_100579852 3300005354 Unclassified 1016
28 Ga0070671_100120684 3300005355 Bacteria 2206
29 Ga0070671_100131463 3300005355 Unclassified 2108
30 Ga0070674_100048450 3300005356 Bacteria 2916
31 Ga0070673_100317023 3300005364 Unclassified 1376
32 Ga0070688_100005506 3300005365 Bacteria 6678
33 Ga0070659_100002223 3300005366 Bacteria 13793
34 Ga0070659_100199462 3300005366 Unclassified 1647
35 Ga0070710_10029701 3300005437 Bacteria 2934
36 Ga0070705_100009089 3300005440 Bacteria 4931
37 Ga0070705_100158860 3300005440 Unclassified 1509
38 Ga0070694_100067114 3300005444 Unclassified 2462
39 Ga0070694_100101670 3300005444 Bacteria 2034
40 Ga0070708_100018728 3300005445 Bacteria 5796
41 Ga0070708_100051229 3300005445 Unclassified 3657
42 Ga0070708_100071094 3300005445 Bacteria 3132
43 Ga0070663_100081159 3300005455 Bacteria 2383
44 Ga0070663_100373791 3300005455 Bacteria 1159
45 Ga0070678_100657362 3300005456 Unclassified 941
46 Ga0070662_100130715 3300005457 Bacteria 1935
47 Ga0070706_100000338 3300005467 Bacteria 56577
48 Ga0070706_100010626 3300005467 Bacteria 8545
49 Ga0070706_100034695 3300005467 Bacteria 4661
50 Ga0070707_100008958 3300005468 Bacteria 9282
51 Ga0070707_100034987 3300005468 Bacteria 4790
52 Ga0070707_100043893 3300005468 Bacteria 4279
53 Ga0070707_100046937 3300005468 Bacteria 4134
54 Ga0070707_100116076 3300005468 Bacteria 2598
55 Ga0070698_100001390 3300005471 Bacteria 26820
56 Ga0070698_100007559 3300005471 Bacteria 11755
57 Ga0070698_100010353 3300005471 Bacteria 9958
58 Ga0070698_100019042 3300005471 Bacteria 7220
59 Ga0070698_100394407 3300005471 Bacteria 1317
60 Ga0070698_100475982 3300005471 Bacteria 1185
61 Ga0070699_100000771 3300005518 Bacteria 29598
62 Ga0070699_100009917 3300005518 Bacteria 8250
63 Ga0070699_100009989 3300005518 Bacteria 8216
64 Ga0070699_100182764 3300005518 Unclassified 1861
65 Ga0070699_100300039 3300005518 Unclassified 1441
66 Ga0070684_100000632 3300005535 Bacteria 24199
67 Ga0070697_100000333 3300005536 Bacteria 37156
68 Ga0070697_100001797 3300005536 Bacteria 16375
69 Ga0070697_100004777 3300005536 Bacteria 10387
70 Ga0070697_100006407 3300005536 Bacteria 9112
71 Ga0070697_100014158 3300005536 Bacteria 6264
72 Ga0070697_100016654 3300005536 Bacteria 5783
73 Ga0070697_100026300 3300005536 Bacteria 4647
74 Ga0070697_100926717 3300005536 Unclassified 773
75 Ga0070672_100015692 3300005543 Bacteria 5406
76 Ga0070672_100546178 3300005543 Bacteria 1006
77 Ga0070695_100068735 3300005545 Bacteria 2314
78 Ga0070695_100260776 3300005545 Bacteria 1266
79 Ga0070696_100060146 3300005546 Bacteria 2656
80 Ga0070704_100003245 3300005549 Bacteria 9295
81 Ga0070704_100098628 3300005549 Bacteria 2196
82 Ga0068856_100175547 3300005614 Bacteria 2155
83 Ga0070702_100038116 3300005615 Bacteria 2674
84 Ga0070702_100045590 3300005615 Bacteria 2481
85 Ga0068859_100003137 3300005617 Bacteria 16805
86 Ga0068864_100074406 3300005618 Bacteria 2964
87 Ga0068863_100004507 3300005841 Bacteria 13738
88 Ga0068858_100010759 3300005842 Bacteria 8651
89 Ga0068860_100028207 3300005843 Bacteria 5404
90 Ga0068862_100475271 3300005844 Bacteria 1182
91 Ga0081455_10031259 3300005937 Bacteria 4821
92 Ga0081455_10088714 3300005937 Bacteria 2512
93 Ga0081540_1082921 3300005983 Bacteria 1436
94 Ga0070716_100000426 3300006173 Bacteria 17432
95 Ga0070716_100017020 3300006173 Bacteria 3762
96 Ga0070712_100014576 3300006175 Bacteria 5044
97 Ga0070712_100082268 3300006175 Bacteria 2335
98 Ga0070712_100556758 3300006175 Bacteria 967
99 Ga0097621_100601085 3300006237 Bacteria 1005
100 Ga0068871_100651750 3300006358 Unclassified 961
101 Ga0075434_100000588 3300006871 Bacteria 28051
102 Ga0075434_100160707 3300006871 Bacteria 2266
103 Ga0097620_100003137 3300006931 Bacteria 16805
104 Ga0111539_10291545 3300009094 Bacteria 1899
105 Ga0105245_10036063 3300009098 Bacteria 4391
106 Ga0105245_10236420 3300009098 Unclassified 1769
107 Ga0114129_10403481 3300009147 Bacteria 1801
108 Ga0105243_10153106 3300009148 Unclassified 1980
109 Ga0105243_10417546 3300009148 Bacteria 1250
110 Ga0105241_10360755 3300009174 Bacteria 1264
111 Ga0105242_10137372 3300009176 Unclassified 2117
112 Ga0105237_10147717 3300009545 Bacteria 2346
113 Ga0105249_10002728 3300009553 Bacteria 15273
114 Ga0105239_10930253 3300010375 Bacteria 998
115 Ga0105246_10221432 3300011119 Bacteria 1484
116 Ga0105246_10405985 3300011119 Bacteria 1133
117 Ga0157371_10097979 3300013102 Bacteria 2079
118 Ga0157374_10063274 3300013296 Bacteria 3470
119 Ga0157374_10065913 3300013296 Bacteria 3403
120 Ga0157374_10084714 3300013296 Bacteria 3013
121 Ga0157374_10169764 3300013296 Bacteria 2127
122 Ga0157374_10328261 3300013296 Bacteria 1517
123 Ga0157374_10462054 3300013296 Bacteria 1271
124 Ga0157374_10608301 3300013296 Bacteria 1103
125 Ga0157378_10049460 3300013297 Bacteria 3740
126 Ga0157378_10412135 3300013297 Bacteria 1334
127 Ga0163162_10027141 3300013306 Bacteria 5662
128 Ga0163162_10073648 3300013306 Bacteria 3472
129 Ga0163162_10105282 3300013306 Bacteria 2916
130 Ga0163162_10188585 3300013306 Unclassified 2189
131 Ga0163162_10630521 3300013306 Bacteria 1197
132 Ga0157372_10754950 3300013307 Bacteria 1131
133 Ga0157375_10036159 3300013308 Bacteria 4721
134 Ga0157375_10541262 3300013308 Bacteria 1327
135 Ga0163163_10994111 3300014325 Unclassified 902
136 Ga0182008_10004311 3300014497 Bacteria 8328
137 Ga0157377_10011715 3300014745 Bacteria 4385
138 Ga0157379_10012880 3300014968 Bacteria 7315
139 Ga0157379_10152899 3300014968 Bacteria 2082
140 Ga0157376_10146319 3300014969 Bacteria 2126
141 Ga0157376_11319265 3300014969 Unclassified 752
142 Ga0182007_10013158 3300015262 Bacteria 3166
143 Ga0213876_10000121 3300021384 Bacteria 84704
144 Ga0207697_10000209 3300025315 Bacteria 31321
145 Ga0207697_10003264 3300025315 Bacteria 8061
146 Ga0207697_10004011 3300025315 Bacteria 7137
147 Ga0207697_10054648 3300025315 Bacteria 1655
148 Ga0207692_10016260 3300025898 Bacteria 3290
149 Ga0207692_10187486 3300025898 Bacteria 1209
150 Ga0207642_10011552 3300025899 Bacteria 3156
151 Ga0207688_10050403 3300025901 Bacteria 2330
152 Ga0207647_10005631 3300025904 Bacteria 9147
153 Ga0207685_10001400 3300025905 Bacteria 5020
154 Ga0207684_10000417 3300025910 Bacteria 56889
155 Ga0207684_10010012 3300025910 Bacteria 8354
156 Ga0207684_10012107 3300025910 Bacteria 7511
157 Ga0207684_10018942 3300025910 Bacteria 5888
158 Ga0207684_10045904 3300025910 Bacteria 3706
159 Ga0207684_10553414 3300025910 Bacteria 984
160 Ga0207654_10161611 3300025911 Bacteria 1447
161 Ga0207671_10208485 3300025914 Bacteria 1528
162 Ga0207693_10005805 3300025915 Bacteria 10238
163 Ga0207693_10008297 3300025915 Bacteria 8505
164 Ga0207693_10012519 3300025915 Bacteria 6851
165 Ga0207693_10040081 3300025915 Bacteria 3688
166 Ga0207693_10045438 3300025915 Bacteria 3451
167 Ga0207663_10301769 3300025916 Unclassified 1197
168 Ga0207662_10000226 3300025918 Bacteria 26114
169 Ga0207646_10003282 3300025922 Bacteria 18431
170 Ga0207646_10006284 3300025922 Bacteria 12322
171 Ga0207646_10009264 3300025922 Bacteria 9748
172 Ga0207646_10018665 3300025922 Bacteria 6466
173 Ga0207646_10031366 3300025922 Bacteria 4811
174 Ga0207646_10202378 3300025922 Bacteria 1794
175 Ga0207681_10008878 3300025923 Bacteria 6140
176 Ga0207681_10399268 3300025923 Bacteria 1110
177 Ga0207659_10169763 3300025926 Bacteria 1720
178 Ga0207659_10178980 3300025926 Bacteria 1678
179 Ga0207659_10253352 3300025926 Unclassified 1429
180 Ga0207659_10508155 3300025926 Unclassified 1021
181 Ga0207700_10017036 3300025928 Unclassified 4841
182 Ga0207664_10796753 3300025929 Bacteria 850
183 Ga0207644_10135648 3300025931 Bacteria 1889
184 Ga0207690_10142787 3300025932 Bacteria 1766
185 Ga0207706_10005660 3300025933 Bacteria 11647
186 Ga0207706_10017157 3300025933 Bacteria 6529
187 Ga0207706_10457055 3300025933 Bacteria 1104
188 Ga0207709_10189627 3300025935 Bacteria 1459
189 Ga0207669_10010256 3300025937 Unclassified 4505
190 Ga0207704_10217827 3300025938 Unclassified 1410
191 Ga0207665_10000329 3300025939 Bacteria 32870
192 Ga0207665_10007784 3300025939 Bacteria 7071
193 Ga0207665_10075959 3300025939 Unclassified 2302
194 Ga0207691_10014847 3300025940 Bacteria 7423
195 Ga0207691_10288279 3300025940 Bacteria 1412
196 Ga0207689_10088702 3300025942 Bacteria 2540
197 Ga0207661_10086072 3300025944 Bacteria 2607
198 Ga0207679_10217641 3300025945 Bacteria 1605
199 Ga0207651_10010743 3300025960 Bacteria 5089
200 Ga0207712_10031125 3300025961 Bacteria 3591
201 Ga0207668_10012345 3300025972 Bacteria 5227
202 Ga0207668_10180831 3300025972 Unclassified 1663
203 Ga0207658_10410969 3300025986 Unclassified 1191
204 Ga0207703_10036658 3300026035 Bacteria 3904
205 Ga0207678_10027190 3300026067 Bacteria 4989
206 Ga0207678_10200218 3300026067 Bacteria 1707
207 Ga0207678_10602094 3300026067 Bacteria 963
208 Ga0207708_10021528 3300026075 Bacteria 4862
209 Ga0207641_10011471 3300026088 Bacteria 7274
210 Ga0207675_100079142 3300026118 Bacteria 3080
211 Ga0207683_10005253 3300026121 Bacteria 11117
212 Ga0207683_10023837 3300026121 Bacteria 5265
213 Ga0268266_10489416 3300028379 Bacteria 1173
214 Ga0268264_10048459 3300028381 Bacteria 3534
215 Ga0268264_10060845 3300028381 Bacteria 3166
216 Ga0373943_0003040 3300035170 Bacteria 7619
217 Ga0373931_0065740 3300035691 Bacteria 1966
218 Ga0373947_0019873 3300035725 Bacteria 3877
219 Ga0373925_0128350 3300037068 Unclassified 1975
220 Ga0373925_0166629 3300037068 Unclassified 1737
221 Ga0436365_0571259 3300039437 Bacteria 81924
222 Ga0439464_0031956 3300042439 Bacteria 1478
223 Ga0439440_0018649 3300042993 Bacteria 1539
224 Ga0466964_0014148 3300044706 Bacteria 3031
225 Ga0466967_0081560 3300045976 Bacteria 2922
226 Ga0495580_0012913 3300046472 Bacteria 6398
227 Ga0495580_0151024 3300046472 Bacteria 1609
228 Ga0495669_0095057 3300046684 Unclassified 1380
229 Ga0496100_0052654 3300048903 Bacteria 2647
230 Ga0496101_0061111 3300048904 Bacteria 2735
231 Ga0496102_0021911 3300048905 Bacteria 5657
232 Ga0496102_0037247 3300048905 Bacteria 4387
233 Ga0496102_0342024 3300048905 Bacteria 1409
234 Ga0496104_0081697 3300048907 Bacteria 3082
235 Ga0496106_0300754 3300048909 Bacteria 1287
236 Ga0496108_0030689 3300048911 Unclassified 4454
237 Ga0496108_0182360 3300048911 Unclassified 1818
238 Ga0496109_0442218 3300048912 Bacteria 1228
239 Ga0496110_0026563 3300048913 Bacteria 4957
240 Ga0496112_0025442 3300048915 Bacteria 5683
241 Ga0496112_0052377 3300048915 Unclassified 4005
242 Ga0496114_0092107 3300048917 Bacteria 2575
243 Ga0496115_0034837 3300048918 Bacteria 3979
244 nmdc:mga0n895_3062_c1 3300050512 Bacteria 13290
245 nmdc:mga0rr50_3361_c1 3300050513 Bacteria 9189
246 Ga0070665_100161761
247 JGI24035J26624_1000363
248 JGI24035J26624_1000999
249 Ga0065714_10067147
250 Ga0065704_10010439
251 Ga0065704_10090196
252 Ga0065704_10129224
253 Ga0065712_10106348
254 Ga0065712_10132403
255 Ga0065707_10020868
256 Ga0065707_10199525
257 Ga0070683_100101734
258 Ga0070683_100312030
259 Ga0070690_100170675
260 Ga0070690_100531767
261 Ga0068868_100013673
262 Ga0070660_100292212
263 Ga0070660_100398664
264 Ga0070689_100004841
265 Ga0070668_100039135
266 Ga0070668_100044419
267 Ga0070669_100029078
268 Ga0070669_100382019
269 Ga0070675_100041687
270 Ga0070675_100203247
271 Ga0070675_100448642
272 Ga0070675_100579852
273 Ga0070671_100120684
274 Ga0070671_100131463
275 Ga0070674_100048450
276 Ga0070673_100317023
277 Ga0070688_100005506
278 Ga0070659_100002223
279 Ga0070659_100199462
280 Ga0070710_10029701
281 Ga0070705_100009089
282 Ga0070705_100158860
283 Ga0070694_100067114
284 Ga0070694_100101670
285 Ga0070708_100018728
286 Ga0070708_100051229
287 Ga0070708_100071094
288 Ga0070663_100081159
289 Ga0070663_100373791
290 Ga0070678_100657362
291 Ga0070662_100130715
292 Ga0070706_100000338
293 Ga0070706_100010626
294 Ga0070706_100034695
295 Ga0070707_100008958
296 Ga0070707_100034987
297 Ga0070707_100043893
298 Ga0070707_100046937
299 Ga0070707_100116076
300 Ga0070698_100001390
301 Ga0070698_100007559
302 Ga0070698_100010353
303 Ga0070698_100019042
304 Ga0070698_100394407
305 Ga0070698_100475982
306 Ga0070699_100000771
307 Ga0070699_100009917
308 Ga0070699_100009989
309 Ga0070699_100182764
310 Ga0070699_100300039
311 Ga0070684_100000632
312 Ga0070697_100000333
313 Ga0070697_100001797
314 Ga0070697_100004777
315 Ga0070697_100006407
316 Ga0070697_100014158
317 Ga0070697_100016654
318 Ga0070697_100026300
319 Ga0070697_100926717
320 Ga0070672_100015692
321 Ga0070672_100546178
322 Ga0070695_100068735
323 Ga0070695_100260776
324 Ga0070696_100060146
325 Ga0070704_100003245
326 Ga0070704_100098628
327 Ga0068856_100175547
328 Ga0070702_100038116
329 Ga0070702_100045590
330 Ga0068859_100003137
331 Ga0068864_100074406
332 Ga0068863_100004507
333 Ga0068858_100010759
334 Ga0068860_100028207
335 Ga0068862_100475271
336 Ga0081455_10031259
337 Ga0081455_10088714
338 Ga0081540_1082921
339 Ga0070716_100000426
340 Ga0070716_100017020
341 Ga0070712_100014576
342 Ga0070712_100082268
343 Ga0070712_100556758
344 Ga0097621_100601085
345 Ga0068871_100651750
346 Ga0075434_100000588
347 Ga0075434_100160707
348 Ga0097620_100003137
349 Ga0111539_10291545
350 Ga0105245_10036063
351 Ga0105245_10236420
352 Ga0114129_10403481
353 Ga0105243_10153106
354 Ga0105243_10417546
355 Ga0105241_10360755
356 Ga0105242_10137372
357 Ga0105237_10147717
358 Ga0105249_10002728
359 Ga0105239_10930253
360 Ga0105246_10221432
361 Ga0105246_10405985
362 Ga0157371_10097979
363 Ga0157374_10063274
364 Ga0157374_10065913
365 Ga0157374_10084714
366 Ga0157374_10169764
367 Ga0157374_10328261
368 Ga0157374_10462054
369 Ga0157374_10608301
370 Ga0157378_10049460
371 Ga0157378_10412135
372 Ga0163162_10027141
373 Ga0163162_10073648
374 Ga0163162_10105282
375 Ga0163162_10188585
376 Ga0163162_10630521
377 Ga0157372_10754950
378 Ga0157375_10036159
379 Ga0157375_10541262
380 Ga0163163_10994111
381 Ga0182008_10004311
382 Ga0157377_10011715
383 Ga0157379_10012880
384 Ga0157379_10152899
385 Ga0157376_10146319
386 Ga0157376_11319265
387 Ga0182007_10013158
388 Ga0213876_10000121
389 Ga0207697_10000209
390 Ga0207697_10003264
391 Ga0207697_10004011
392 Ga0207697_10054648
393 Ga0207692_10016260
394 Ga0207692_10187486
395 Ga0207642_10011552
396 Ga0207688_10050403
397 Ga0207647_10005631
398 Ga0207685_10001400
399 Ga0207684_10000417
400 Ga0207684_10010012
401 Ga0207684_10012107
402 Ga0207684_10018942
403 Ga0207684_10045904
404 Ga0207684_10553414
405 Ga0207654_10161611
406 Ga0207671_10208485
407 Ga0207693_10005805
408 Ga0207693_10008297
409 Ga0207693_10012519
410 Ga0207693_10040081
411 Ga0207693_10045438
412 Ga0207663_10301769
413 Ga0207662_10000226
414 Ga0207646_10003282
415 Ga0207646_10006284
416 Ga0207646_10009264
417 Ga0207646_10018665
418 Ga0207646_10031366
419 Ga0207646_10202378
420 Ga0207681_10008878
421 Ga0207681_10399268
422 Ga0207659_10169763
423 Ga0207659_10178980
424 Ga0207659_10253352
425 Ga0207659_10508155
426 Ga0207700_10017036
427 Ga0207664_10796753
428 Ga0207644_10135648
429 Ga0207690_10142787
430 Ga0207706_10005660
431 Ga0207706_10017157
432 Ga0207706_10457055
433 Ga0207709_10189627
434 Ga0207669_10010256
435 Ga0207704_10217827
436 Ga0207665_10000329
437 Ga0207665_10007784
438 Ga0207665_10075959
439 Ga0207691_10014847
440 Ga0207691_10288279
441 Ga0207689_10088702
442 Ga0207661_10086072
443 Ga0207679_10217641
444 Ga0207651_10010743
445 Ga0207712_10031125
446 Ga0207668_10012345
447 Ga0207668_10180831
448 Ga0207658_10410969
449 Ga0207703_10036658
450 Ga0207678_10027190
451 Ga0207678_10200218
452 Ga0207678_10602094
453 Ga0207708_10021528
454 Ga0207641_10011471
455 Ga0207675_100079142
456 Ga0207683_10005253
457 Ga0207683_10023837
458 Ga0268266_10489416
459 Ga0268264_10048459
460 Ga0268264_10060845
461 Ga0373943_0003040
462 Ga0373931_0065740
463 Ga0373947_0019873
464 Ga0373925_0128350
465 Ga0373925_0166629
466 Ga0436365_0571259
467 Ga0439464_0031956
468 Ga0439440_0018649
469 Ga0466964_0014148
470 Ga0466967_0081560
471 Ga0495580_0012913
472 Ga0495580_0151024
473 Ga0495669_0095057
474 Ga0496100_0052654
475 Ga0496101_0061111
476 Ga0496102_0021911
477 Ga0496102_0037247
478 Ga0496102_0342024
479 Ga0496104_0081697
480 Ga0496106_0300754
481 Ga0496108_0030689
482 Ga0496108_0182360
483 Ga0496109_0442218
484 Ga0496110_0026563
485 Ga0496112_0025442
486 Ga0496112_0052377
487 Ga0496114_0092107
488 Ga0496115_0034837
489 nmdc:mga0n895_3062_c1
490 nmdc:mga0rr50_3361_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

7

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ffp-assembly1.cif.gz_A-2 crystal structure of di-peptidase-e from xenopus laevis 0.9387 1 235
6a4s-assembly1.cif.gz_B crystal structure of peptidase e with ordered active site loop from salmonella enterica 0.9323 4 229
7c9b-assembly1.cif.gz_A-2 crystal structure of dipeptidase-e from xenopus laevis 0.9284 2 235
1fye-assembly1.cif.gz_A aspartyl dipeptidase (anisotropic b-factor refinement) 0.9238 6 229
7c9b-assembly1.cif.gz_A-2 crystal structure of dipeptidase-e from xenopus laevis 0.9168 2 235
ID Description Score Start End Superfamily
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9452 6 226 3.40.50.880
1fyeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9238 6 229 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9208 6 226 3.40.50.880
1fyeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9117 6 229 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.755 3 227 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7X9HWN3-F1-model_v4 Type 1 glutamine amidotransferase-like domain-containing protein 0.9701 7 128 GO:0006508
GO:0008236
GO:0016740
AF-A0A1B6GNE7-F1-model_v4 Peptidase S51 dipeptidase E 0.9601 3 119 GO:0006508
GO:0008236
AF-A0A6J1V2U9-F1-model_v4 LOW QUALITY PROTEIN: alpha-aspartyl dipeptidase-like 0.9562 10 111 GO:0006508
GO:0008236
AF-A0A5F8G766-F1-model_v4 Alpha-aspartyl dipeptidase-like 0.9556 2 108 GO:0006508
GO:0008236
AF-A0A7V7X436-F1-model_v4 Dipeptidase PepE (EC 3.4.13.21) 0.9543 6 234 GO:0006508
GO:0008236
GO:0016805

Map