F356803

General Info

Members Datasets Scaffolds Average Seq Length
244 179 488 383

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0010134|Ga0495636_0010134_1770_3023
Length 417
Sequence LQTLDRSDHNPKLARDRRHTETMKRSRDRFLTTHTGSLPRPEDLIRMMFAKEEGVPVEPHALAHRVRDAVAGIVRRQSAAGIDIVNDGEMSKPSYATYIKDRLNGFGGESQPPPYPDLVPYPGLHQKVYGDRGRARRKMPGCNGPISVRDRDAVKTDIENLKAAGAGEPSGATGAGRAPEDLFMSAASPGVVSLFFHNDYYKTQDEYLYAIADAMQYEYEAIANAGLVLQLDCPDLGMGRHVQYAHLSLEEFRKKARLHVEALNHGVRNIPPDQMRMHLCWGNYEAPHQMDVPLADIIDVVFLARPAAISFEAANPRHAHEWAVFETVKLPDGKILIPGVLESKSNFIEHPELVAQRIGRFASLVGRENVMLGTDCGYGTWVGQAAVDPDVVWGKLAAMSEGARLASQQFWGRVAAV

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
97 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
172 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
173 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
174 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
175 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
176 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
177 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
178 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
179 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.31
Metatranscriptomes 0
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 3.28
Rhizoplane 2.87
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0010134 3300047318 Bacteria 3717
2 JGI25404J52841_10000119 3300003659 Bacteria 8037
3 Ga0065715_10145884 3300005293 Bacteria 1789
4 Ga0070676_10086593 3300005328 Bacteria 1911
5 Ga0070683_100012440 3300005329 Bacteria 7396
6 Ga0070683_100095274 3300005329 Unclassified 2798
7 Ga0070670_100029046 3300005331 Bacteria 4759
8 Ga0070680_100004619 3300005336 Bacteria 10348
9 Ga0070680_100027830 3300005336 Bacteria 4530
10 Ga0070668_100130738 3300005347 Bacteria 2015
11 Ga0070671_100002612 3300005355 Bacteria 13945
12 Ga0070671_100127390 3300005355 Bacteria 2144
13 Ga0070673_100094515 3300005364 Bacteria 2450
14 Ga0070688_100032538 3300005365 Unclassified 3145
15 Ga0070659_100134420 3300005366 Bacteria 2011
16 Ga0070709_10078150 3300005434 Unclassified 2152
17 Ga0070710_10037924 3300005437 Unclassified 2644
18 Ga0070711_100030003 3300005439 Bacteria 3595
19 Ga0070711_100066230 3300005439 Bacteria 2530
20 Ga0070705_100019721 3300005440 Bacteria 3553
21 Ga0070694_100130399 3300005444 Bacteria 1815
22 Ga0070708_100257278 3300005445 Bacteria 1641
23 Ga0070662_100238839 3300005457 Bacteria 1457
24 Ga0070681_10044156 3300005458 Bacteria 4460
25 Ga0070681_10044221 3300005458 Bacteria 4457
26 Ga0070681_10116238 3300005458 Bacteria 2612
27 Ga0068867_100001661 3300005459 Bacteria 15490
28 Ga0070707_100240012 3300005468 Bacteria 1764
29 Ga0070698_100002571 3300005471 Bacteria 19981
30 Ga0070698_100087838 3300005471 Bacteria 3095
31 Ga0070699_100025687 3300005518 Bacteria 5076
32 Ga0070699_100031715 3300005518 Bacteria 4562
33 Ga0070699_100072287 3300005518 Bacteria 3000
34 Ga0070699_100134922 3300005518 Bacteria 2177
35 Ga0070679_100004788 3300005530 Bacteria 12484
36 Ga0070679_100186059 3300005530 Bacteria 2047
37 Ga0070684_100151231 3300005535 Bacteria 2103
38 Ga0070684_100303689 3300005535 Bacteria 1465
39 Ga0070697_100055309 3300005536 Bacteria 3226
40 Ga0070697_100093834 3300005536 Bacteria 2486
41 Ga0068853_100014470 3300005539 Bacteria 6462
42 Ga0070672_100089155 3300005543 Bacteria 2485
43 Ga0070672_100139186 3300005543 Bacteria 2001
44 Ga0070704_100011735 3300005549 Bacteria 5384
45 Ga0068855_100000075 3300005563 Bacteria 119094
46 Ga0068854_100083779 3300005578 Bacteria 2358
47 Ga0068856_100108977 3300005614 Bacteria 2765
48 Ga0068859_100038873 3300005617 Unclassified 4772
49 Ga0068864_100087443 3300005618 Bacteria 2744
50 Ga0068861_100042017 3300005719 Unclassified 3426
51 Ga0068851_10025257 3300005834 Unclassified 2914
52 Ga0068870_10049626 3300005840 Bacteria 2214
53 Ga0068863_100029361 3300005841 Bacteria 5249
54 Ga0068862_100007498 3300005844 Bacteria 9040
55 Ga0081540_1005662 3300005983 Bacteria 9288
56 Ga0081540_1011407 3300005983 Bacteria 5940
57 Ga0081540_1064416 3300005983 Bacteria 1729
58 Ga0070717_10035184 3300006028 Bacteria 4052
59 Ga0070717_10071629 3300006028 Bacteria 2892
60 Ga0070717_10078852 3300006028 Unclassified 2761
61 Ga0070717_10109068 3300006028 Bacteria 2359
62 Ga0075365_10188813 3300006038 Bacteria 1442
63 Ga0070712_100000863 3300006175 Bacteria 18053
64 Ga0070712_100012860 3300006175 Bacteria 5331
65 Ga0070712_100112790 3300006175 Bacteria 2032
66 Ga0068871_100100628 3300006358 Unclassified 2421
67 Ga0075430_100001639 3300006846 Bacteria 18299
68 Ga0075433_10056474 3300006852 Bacteria 3429
69 Ga0075433_10356655 3300006852 Bacteria 1292
70 Ga0075434_100075397 3300006871 Bacteria 3366
71 Ga0075434_100127461 3300006871 Bacteria 2562
72 Ga0068865_100245410 3300006881 Bacteria 1411
73 Ga0075436_100020790 3300006914 Bacteria 4503
74 Ga0097620_100038873 3300006931 Unclassified 4772
75 Ga0099823_1000875 3300006944 Bacteria 22651
76 Ga0075435_100048229 3300007076 Bacteria 3421
77 Ga0105240_10010088 3300009093 Bacteria 13294
78 Ga0105240_10206816 3300009093 Bacteria 2296
79 Ga0105240_10407587 3300009093 Bacteria 1530
80 Ga0111539_10015938 3300009094 Bacteria 9337
81 Ga0114129_10029757 3300009147 Bacteria 7734
82 Ga0114129_10060451 3300009147 Bacteria 5298
83 Ga0105238_10006976 3300009551 Bacteria 11287
84 Ga0105238_10077091 3300009551 Bacteria 3325
85 Ga0105238_10247993 3300009551 Bacteria 1758
86 Ga0099796_10004340 3300010159 Bacteria 3418
87 Ga0105239_10003298 3300010375 Bacteria 19880
88 Ga0105239_10004412 3300010375 Bacteria 16840
89 Ga0157370_10004480 3300013104 Bacteria 16005
90 Ga0157370_10406058 3300013104 Bacteria 1254
91 Ga0157369_10004777 3300013105 Bacteria 15926
92 Ga0157369_10041984 3300013105 Bacteria 4991
93 Ga0157369_10069632 3300013105 Bacteria 3780
94 Ga0157369_10120235 3300013105 Bacteria 2787
95 Ga0163162_10051879 3300013306 Unclassified 4117
96 Ga0157375_10009767 3300013308 Bacteria 8434
97 Ga0163163_10293897 3300014325 Bacteria 1677
98 Ga0182008_10032427 3300014497 Bacteria 2625
99 Ga0157377_10039574 3300014745 Bacteria 2608
100 Ga0213874_10043315 3300021377 Bacteria 1356
101 Ga0209233_1008632 3300025261 Bacteria 3138
102 Ga0207692_10039913 3300025898 Bacteria 2313
103 Ga0207684_10012981 3300025910 Bacteria 7212
104 Ga0207707_10047717 3300025912 Bacteria 3730
105 Ga0207707_10067876 3300025912 Bacteria 3106
106 Ga0207707_10069927 3300025912 Bacteria 3059
107 Ga0207695_10000018 3300025913 Bacteria 766611
108 Ga0207695_10042516 3300025913 Bacteria 4852
109 Ga0207695_10082735 3300025913 Bacteria 3244
110 Ga0207693_10011765 3300025915 Bacteria 7072
111 Ga0207693_10089137 3300025915 Bacteria 2418
112 Ga0207693_10106893 3300025915 Bacteria 2195
113 Ga0207662_10002140 3300025918 Bacteria 9830
114 Ga0207652_10012784 3300025921 Bacteria 6787
115 Ga0207652_10065004 3300025921 Bacteria 3157
116 Ga0207652_10315276 3300025921 Bacteria 1412
117 Ga0207681_10013700 3300025923 Bacteria 5021
118 Ga0207694_10000018 3300025924 Bacteria 331281
119 Ga0207694_10076358 3300025924 Bacteria 2624
120 Ga0207650_10021485 3300025925 Bacteria 4561
121 Ga0207700_10135206 3300025928 Bacteria 2018
122 Ga0207700_10322414 3300025928 Bacteria 1339
123 Ga0207664_10183151 3300025929 Bacteria 1799
124 Ga0207644_10105604 3300025931 Bacteria 2122
125 Ga0207706_10242868 3300025933 Bacteria 1574
126 Ga0207691_10039883 3300025940 Bacteria 4343
127 Ga0207691_10155841 3300025940 Bacteria 2006
128 Ga0207661_10208316 3300025944 Bacteria 1722
129 Ga0207667_10000052 3300025949 Bacteria 232415
130 Ga0207667_10173319 3300025949 Bacteria 2217
131 Ga0207712_10062102 3300025961 Bacteria 2654
132 Ga0207640_10097120 3300025981 Bacteria 2056
133 Ga0207703_10287332 3300026035 Bacteria 1496
134 Ga0207639_10005640 3300026041 Bacteria 8470
135 Ga0207702_10197100 3300026078 Bacteria 1864
136 Ga0207641_10040352 3300026088 Bacteria 3908
137 Ga0207641_10297312 3300026088 Unclassified 1524
138 Ga0207648_10003078 3300026089 Bacteria 17622
139 Ga0207676_10119202 3300026095 Bacteria 2222
140 Ga0207675_100005819 3300026118 Bacteria 11782
141 Ga0207698_10039071 3300026142 Bacteria 3513
142 Ga0209389_1000146 3300027296 Bacteria 60860
143 Ga0209967_1003371 3300027364 Bacteria 2104
144 Ga0209981_1002043 3300027378 Bacteria 2576
145 Ga0210000_1001358 3300027462 Bacteria 3445
146 Ga0207428_10002747 3300027907 Bacteria 17505
147 Ga0268265_10000899 3300028380 Bacteria 27634
148 Ga0268265_10211504 3300028380 Bacteria 1690
149 Ga0265338_10043575 3300028800 Bacteria 4159
150 Ga0265327_10012642 3300031251 Bacteria 5678
151 Ga0265313_10068277 3300031595 Bacteria 1643
152 Ga0265314_10035483 3300031711 Bacteria 3634
153 Ga0307516_10053839 3300031730 Bacteria 3934
154 Ga0316583_10000776 3300032133 Bacteria 10040
155 Ga0373936_0061602 3300035113 Bacteria 1533
156 Ga0373941_0070269 3300035115 Bacteria 1161
157 Ga0373953_0002461 3300035117 Bacteria 5605
158 Ga0373954_0047994 3300035118 Bacteria 2000
159 Ga0373956_0032234 3300035119 Bacteria 2299
160 Ga0373933_0006495 3300035724 Bacteria 6368
161 Ga0373933_0012779 3300035724 Bacteria 4641
162 Ga0373933_0056059 3300035724 Bacteria 2365
163 Ga0373937_0005157 3300036401 Bacteria 11139
164 Ga0373937_0005171 3300036401 Bacteria 11131
165 Ga0373937_0043920 3300036401 Bacteria 4081
166 Ga0373937_0049239 3300036401 Unclassified 3859
167 Ga0373937_0140681 3300036401 Bacteria 2258
168 Ga0436364_0724787 3300037853 Bacteria 3928
169 Ga0436365_0929897 3300039437 Bacteria 2740
170 Ga0436365_1399104 3300039437 Bacteria 2048
171 Ga0436360_0103441 3300039438 Bacteria 2719
172 Ga0436361_0805629 3300039447 Bacteria 3983
173 Ga0436362_0371891 3300039453 Bacteria 1734
174 Ga0451576_0046216 3300045051 Bacteria 4584
175 Ga0451576_0053391 3300045051 Bacteria 4233
176 Ga0495592_0122740 3300046454 Bacteria 1825
177 Ga0495664_0020722 3300046477 Bacteria 3794
178 Ga0495664_0094277 3300046477 Unclassified 1802
179 Ga0495618_0066585 3300046514 Bacteria 2290
180 Ga0495652_0118267 3300046529 Unclassified 2118
181 Ga0495586_0086362 3300046535 Bacteria 1729
182 Ga0495598_0015230 3300046537 Bacteria 1937
183 Ga0495609_0067717 3300046538 Bacteria 1572
184 Ga0495667_0011726 3300046559 Bacteria 5935
185 Ga0495611_0097648 3300046648 Bacteria 1362
186 Ga0495635_0114466 3300046663 Bacteria 1841
187 Ga0495659_0001428 3300046664 Bacteria 8108
188 Ga0495659_0018804 3300046664 Bacteria 2306
189 Ga0495599_0070665 3300046678 Bacteria 2179
190 Ga0495671_0077464 3300046692 Bacteria 1630
191 Ga0495600_0022930 3300046809 Bacteria 4013
192 Ga0495581_0123530 3300047315 Unclassified 1507
193 Ga0495604_0196265 3300047317 Bacteria 1403
194 Ga0495674_0012769 3300047319 Bacteria 7909
195 Ga0495680_0018217 3300047322 Bacteria 5970
196 Ga0495680_0077084 3300047322 Bacteria 2526
197 Ga0495675_0066089 3300047444 Unclassified 2286
198 Ga0495686_0118476 3300047472 Bacteria 1580
199 Ga0495602_0096616 3300048088 Bacteria 2436
200 Ga0496108_0275371 3300048911 Bacteria 1465
201 Ga0496109_0056500 3300048912 Bacteria 3581
202 Ga0496110_0036543 3300048913 Bacteria 4265
203 Ga0496112_0056929 3300048915 Bacteria 3849
204 Ga0496113_0065190 3300048916 Bacteria 2756
205 Ga0496113_0174601 3300048916 Bacteria 1702
206 Ga0496114_0343914 3300048917 Unclassified 1319
207 Ga0501047_0008653 3300049581 Bacteria 9614
208 Ga0501048_0258299 3300049582 Bacteria 1238
209 Ga0501067_0010524 3300049583 Bacteria 5123
210 Ga0501068_0102591 3300049584 Bacteria 1774
211 Ga0501070_0122738 3300049586 Bacteria 2147
212 Ga0501072_0001266 3300049588 Bacteria 18870
213 Ga0501073_0005109 3300049589 Bacteria 9842
214 Ga0501074_0028337 3300049590 Bacteria 4059
215 Ga0501079_0081642 3300049741 Bacteria 2500
216 nmdc:mga0yw44_97713_c1 3300050492 Bacteria 1866
217 nmdc:mga05p37_110347_c1 3300050507 Bacteria 3384
218 nmdc:mga0qj67_14879_c1 3300050509 Bacteria 5885
219 nmdc:mga08y16_4165_c1 3300050511 Bacteria 15104
220 nmdc:mga08y16_440177_c1 3300050511 Bacteria 1330
221 nmdc:mga0n895_100888_c1 3300050512 Bacteria 2896
222 nmdc:mga0n895_151478_c1 3300050512 Bacteria 2350
223 nmdc:mga0rr50_136101_c1 3300050513 Bacteria 1972
224 nmdc:mga0rr50_192965_c1 3300050513 Bacteria 1670
225 nmdc:mga0rr50_95838_c1 3300050513 Bacteria 2320
226 Ga0495601_0031315 3300053077 Bacteria 3305
227 Ga0495601_0045924 3300053077 Bacteria 2749
228 Ga0495612_0043811 3300053078 Bacteria 1830
229 Ga0495595_0023521 3300053084 Bacteria 2713
230 Ga0495619_0032461 3300053085 Bacteria 3388
231 Ga0495619_0041619 3300053085 Bacteria 3006
232 Ga0500641_0001522 3300053096 Bacteria 8271
233 Ga0500616_0088203 3300053153 Bacteria 1542
234 Ga0501084_0000933 3300054114 Bacteria 22658
235 Ga0501082_0098674 3300060353 Bacteria 2526
236 2513721018 2513237104 Bacteria 10034502
237 2643757641 2643221547 Bacteria 4740017
238 2728748354 2728368998 Bacteria 8720350
239 2805922565 2802429603 Bacteria 8777136
240 2841945994 2841941048 Bacteria 8688029
241 2841965235 2841957949 Bacteria 8652217
242 2885384014 2885383462 Bacteria 9473874
243 3005717087 3005710791 Bacteria 7622528
244 8056684859 8056681323 Bacteria 8472857
245 Ga0495636_0010134
246 JGI25404J52841_10000119
247 Ga0065715_10145884
248 Ga0070676_10086593
249 Ga0070683_100012440
250 Ga0070683_100095274
251 Ga0070670_100029046
252 Ga0070680_100004619
253 Ga0070680_100027830
254 Ga0070668_100130738
255 Ga0070671_100002612
256 Ga0070671_100127390
257 Ga0070673_100094515
258 Ga0070688_100032538
259 Ga0070659_100134420
260 Ga0070709_10078150
261 Ga0070710_10037924
262 Ga0070711_100030003
263 Ga0070711_100066230
264 Ga0070705_100019721
265 Ga0070694_100130399
266 Ga0070708_100257278
267 Ga0070662_100238839
268 Ga0070681_10044156
269 Ga0070681_10044221
270 Ga0070681_10116238
271 Ga0068867_100001661
272 Ga0070707_100240012
273 Ga0070698_100002571
274 Ga0070698_100087838
275 Ga0070699_100025687
276 Ga0070699_100031715
277 Ga0070699_100072287
278 Ga0070699_100134922
279 Ga0070679_100004788
280 Ga0070679_100186059
281 Ga0070684_100151231
282 Ga0070684_100303689
283 Ga0070697_100055309
284 Ga0070697_100093834
285 Ga0068853_100014470
286 Ga0070672_100089155
287 Ga0070672_100139186
288 Ga0070704_100011735
289 Ga0068855_100000075
290 Ga0068854_100083779
291 Ga0068856_100108977
292 Ga0068859_100038873
293 Ga0068864_100087443
294 Ga0068861_100042017
295 Ga0068851_10025257
296 Ga0068870_10049626
297 Ga0068863_100029361
298 Ga0068862_100007498
299 Ga0081540_1005662
300 Ga0081540_1011407
301 Ga0081540_1064416
302 Ga0070717_10035184
303 Ga0070717_10071629
304 Ga0070717_10078852
305 Ga0070717_10109068
306 Ga0075365_10188813
307 Ga0070712_100000863
308 Ga0070712_100012860
309 Ga0070712_100112790
310 Ga0068871_100100628
311 Ga0075430_100001639
312 Ga0075433_10056474
313 Ga0075433_10356655
314 Ga0075434_100075397
315 Ga0075434_100127461
316 Ga0068865_100245410
317 Ga0075436_100020790
318 Ga0097620_100038873
319 Ga0099823_1000875
320 Ga0075435_100048229
321 Ga0105240_10010088
322 Ga0105240_10206816
323 Ga0105240_10407587
324 Ga0111539_10015938
325 Ga0114129_10029757
326 Ga0114129_10060451
327 Ga0105238_10006976
328 Ga0105238_10077091
329 Ga0105238_10247993
330 Ga0099796_10004340
331 Ga0105239_10003298
332 Ga0105239_10004412
333 Ga0157370_10004480
334 Ga0157370_10406058
335 Ga0157369_10004777
336 Ga0157369_10041984
337 Ga0157369_10069632
338 Ga0157369_10120235
339 Ga0163162_10051879
340 Ga0157375_10009767
341 Ga0163163_10293897
342 Ga0182008_10032427
343 Ga0157377_10039574
344 Ga0213874_10043315
345 Ga0209233_1008632
346 Ga0207692_10039913
347 Ga0207684_10012981
348 Ga0207707_10047717
349 Ga0207707_10067876
350 Ga0207707_10069927
351 Ga0207695_10000018
352 Ga0207695_10042516
353 Ga0207695_10082735
354 Ga0207693_10011765
355 Ga0207693_10089137
356 Ga0207693_10106893
357 Ga0207662_10002140
358 Ga0207652_10012784
359 Ga0207652_10065004
360 Ga0207652_10315276
361 Ga0207681_10013700
362 Ga0207694_10000018
363 Ga0207694_10076358
364 Ga0207650_10021485
365 Ga0207700_10135206
366 Ga0207700_10322414
367 Ga0207664_10183151
368 Ga0207644_10105604
369 Ga0207706_10242868
370 Ga0207691_10039883
371 Ga0207691_10155841
372 Ga0207661_10208316
373 Ga0207667_10000052
374 Ga0207667_10173319
375 Ga0207712_10062102
376 Ga0207640_10097120
377 Ga0207703_10287332
378 Ga0207639_10005640
379 Ga0207702_10197100
380 Ga0207641_10040352
381 Ga0207641_10297312
382 Ga0207648_10003078
383 Ga0207676_10119202
384 Ga0207675_100005819
385 Ga0207698_10039071
386 Ga0209389_1000146
387 Ga0209967_1003371
388 Ga0209981_1002043
389 Ga0210000_1001358
390 Ga0207428_10002747
391 Ga0268265_10000899
392 Ga0268265_10211504
393 Ga0265338_10043575
394 Ga0265327_10012642
395 Ga0265313_10068277
396 Ga0265314_10035483
397 Ga0307516_10053839
398 Ga0316583_10000776
399 Ga0373936_0061602
400 Ga0373941_0070269
401 Ga0373953_0002461
402 Ga0373954_0047994
403 Ga0373956_0032234
404 Ga0373933_0006495
405 Ga0373933_0012779
406 Ga0373933_0056059
407 Ga0373937_0005157
408 Ga0373937_0005171
409 Ga0373937_0043920
410 Ga0373937_0049239
411 Ga0373937_0140681
412 Ga0436364_0724787
413 Ga0436365_0929897
414 Ga0436365_1399104
415 Ga0436360_0103441
416 Ga0436361_0805629
417 Ga0436362_0371891
418 Ga0451576_0046216
419 Ga0451576_0053391
420 Ga0495592_0122740
421 Ga0495664_0020722
422 Ga0495664_0094277
423 Ga0495618_0066585
424 Ga0495652_0118267
425 Ga0495586_0086362
426 Ga0495598_0015230
427 Ga0495609_0067717
428 Ga0495667_0011726
429 Ga0495611_0097648
430 Ga0495635_0114466
431 Ga0495659_0001428
432 Ga0495659_0018804
433 Ga0495599_0070665
434 Ga0495671_0077464
435 Ga0495600_0022930
436 Ga0495581_0123530
437 Ga0495604_0196265
438 Ga0495674_0012769
439 Ga0495680_0018217
440 Ga0495680_0077084
441 Ga0495675_0066089
442 Ga0495686_0118476
443 Ga0495602_0096616
444 Ga0496108_0275371
445 Ga0496109_0056500
446 Ga0496110_0036543
447 Ga0496112_0056929
448 Ga0496113_0065190
449 Ga0496113_0174601
450 Ga0496114_0343914
451 Ga0501047_0008653
452 Ga0501048_0258299
453 Ga0501067_0010524
454 Ga0501068_0102591
455 Ga0501070_0122738
456 Ga0501072_0001266
457 Ga0501073_0005109
458 Ga0501074_0028337
459 Ga0501079_0081642
460 nmdc:mga0yw44_97713_c1
461 nmdc:mga05p37_110347_c1
462 nmdc:mga0qj67_14879_c1
463 nmdc:mga08y16_4165_c1
464 nmdc:mga08y16_440177_c1
465 nmdc:mga0n895_100888_c1
466 nmdc:mga0n895_151478_c1
467 nmdc:mga0rr50_136101_c1
468 nmdc:mga0rr50_192965_c1
469 nmdc:mga0rr50_95838_c1
470 Ga0495601_0031315
471 Ga0495601_0045924
472 Ga0495612_0043811
473 Ga0495595_0023521
474 Ga0495619_0032461
475 Ga0495619_0041619
476 Ga0500641_0001522
477 Ga0500616_0088203
478 Ga0501084_0000933
479 Ga0501082_0098674
480 2513721018
481 2643757641
482 2728748354
483 2805922565
484 2841945994
485 2841965235
486 2885384014
487 3005717087
488 8056684859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.899 7 377
1xdj-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine 0.8987 7 373
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8964 7 374
3bq6-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8956 8 373
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8917 8 374
ID Description Score Start End Superfamily
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8762 8 375 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8501 3 371 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8474 5 376 3.20.20.210
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8453 285 374 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8434 7 374 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2S6U3H5-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.986 301 377
AF-A0A537BYS7-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9851 273 377 GO:0016740
AF-A0A2W4PMZ6-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9845 261 377
AF-A0A836TRA0-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9839 258 377
AF-A0A2E5Q7Q8-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9823 226 377 GO:0016740

Map