F356519

General Info

Members Datasets Scaffolds Average Seq Length
244 142 244 278

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10370497|Ga0157379_103704972
Length 285
Sequence MTSQVRKAAVAGSWYPGTATALASAVDRYLAAADRDTGPDRIAGGDLAALIAPHAGLMYSGPVAAHAYRLLRERVFDVAVLVGPSHFVGFDGVSIQPSGGFETPLGVVPIDADTASAIISAAPVSGLIHELPAAHGREHSLEMQLPFLAHLAPRLPIVPLVMGHQTADTARALGDALGTALGGRRALLVASTDLSHYHDAATASRLDAVVIDCVARFDVAGLQRTLDARPEHACGGGPTVAVMRAAWLAGARDAVVLNYADSGDVSGDKTAVVGYLAAALGTFAP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.69
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10074244 3300005290 Bacteria 4145
2 Ga0070666_10007203 3300005335 Bacteria 6858
3 Ga0070680_100081509 3300005336 Bacteria 2670
4 Ga0070687_100072813 3300005343 Bacteria 1850
5 Ga0070668_100261429 3300005347 Unclassified 1439
6 Ga0070669_100012905 3300005353 Bacteria 5934
7 Ga0070671_100108764 3300005355 Bacteria 2328
8 Ga0070674_100002747 3300005356 Bacteria 9728
9 Ga0070673_100009257 3300005364 Bacteria 6608
10 Ga0070673_100255466 3300005364 Unclassified 1529
11 Ga0070673_100666811 3300005364 Bacteria 953
12 Ga0070711_100051276 3300005439 Bacteria 2833
13 Ga0070708_100393550 3300005445 Unclassified 1307
14 Ga0070678_100119762 3300005456 Unclassified 2074
15 Ga0070681_10012776 3300005458 Bacteria 8333
16 Ga0070681_10338216 3300005458 Bacteria 1415
17 Ga0068867_100031902 3300005459 Unclassified 3807
18 Ga0068867_100218159 3300005459 Bacteria 1536
19 Ga0068867_100451798 3300005459 Bacteria 1095
20 Ga0070698_100264179 3300005471 Unclassified 1653
21 Ga0070679_100276833 3300005530 Bacteria 1631
22 Ga0070697_100049694 3300005536 Bacteria 3404
23 Ga0070686_100001050 3300005544 Bacteria 15900
24 Ga0070696_100034174 3300005546 Bacteria 3497
25 Ga0070665_100022816 3300005548 Bacteria 6301
26 Ga0070665_100107786 3300005548 Bacteria 2788
27 Ga0068855_100221893 3300005563 Bacteria 2119
28 Ga0068855_100519367 3300005563 Bacteria 1292
29 Ga0070664_100283360 3300005564 Bacteria 1495
30 Ga0068854_100010917 3300005578 Bacteria 5892
31 Ga0068859_100186517 3300005617 Bacteria 2158
32 Ga0068859_100247883 3300005617 Bacteria 1871
33 Ga0068859_100615671 3300005617 Bacteria 1179
34 Ga0068864_100011489 3300005618 Bacteria 7314
35 Ga0068864_100090901 3300005618 Bacteria 2692
36 Ga0068863_100019394 3300005841 Bacteria 6505
37 Ga0068858_100033393 3300005842 Bacteria 4776
38 Ga0068860_100146557 3300005843 Bacteria 2272
39 Ga0068860_100233122 3300005843 Bacteria 1789
40 Ga0068860_100546425 3300005843 Bacteria 1160
41 Ga0068860_100811432 3300005843 Bacteria 949
42 Ga0097621_100047805 3300006237 Bacteria 3468
43 Ga0097621_100176367 3300006237 Unclassified 1845
44 Ga0068871_100001260 3300006358 Bacteria 16929
45 Ga0068871_100108461 3300006358 Bacteria 2333
46 Ga0075428_100027444 3300006844 Bacteria 6299
47 Ga0075428_100492487 3300006844 Unclassified 1312
48 Ga0075433_10017098 3300006852 Bacteria 5998
49 Ga0075433_10308095 3300006852 Bacteria 1402
50 Ga0075434_100000505 3300006871 Bacteria 29553
51 Ga0075434_100012294 3300006871 Bacteria 8111
52 Ga0075434_100045659 3300006871 Bacteria 4346
53 Ga0075434_100061083 3300006871 Bacteria 3748
54 Ga0075434_100117131 3300006871 Bacteria 2677
55 Ga0075434_100165444 3300006871 Bacteria 2232
56 Ga0075434_100224716 3300006871 Bacteria 1897
57 Ga0075434_100528845 3300006871 Bacteria 1199
58 Ga0068865_100466827 3300006881 Bacteria 1046
59 Ga0075436_100001003 3300006914 Bacteria 18959
60 Ga0075436_100015009 3300006914 Bacteria 5310
61 Ga0075436_100054813 3300006914 Bacteria 2752
62 Ga0097620_100186520 3300006931 Bacteria 2158
63 Ga0097620_100247872 3300006931 Bacteria 1871
64 Ga0097620_100615687 3300006931 Bacteria 1179
65 Ga0075435_100000129 3300007076 Bacteria 43005
66 Ga0075435_100012127 3300007076 Bacteria 6373
67 Ga0075435_100027379 3300007076 Bacteria 4458
68 Ga0075435_100032243 3300007076 Bacteria 4136
69 Ga0075435_100127962 3300007076 Unclassified 2124
70 Ga0111539_10057320 3300009094 Bacteria 4627
71 Ga0111539_10548321 3300009094 Bacteria 1347
72 Ga0105245_10015807 3300009098 Bacteria 6578
73 Ga0105245_10076307 3300009098 Bacteria 3053
74 Ga0105245_10135428 3300009098 Bacteria 2314
75 Ga0114129_10027029 3300009147 Bacteria 8125
76 Ga0114129_10101698 3300009147 Unclassified 3976
77 Ga0114129_10205119 3300009147 Bacteria 2668
78 Ga0105243_10098774 3300009148 Bacteria 2419
79 Ga0105242_10013301 3300009176 Bacteria 6355
80 Ga0105242_10057808 3300009176 Unclassified 3178
81 Ga0105242_10145952 3300009176 Bacteria 2058
82 Ga0105242_10241414 3300009176 Unclassified 1624
83 Ga0105248_10017587 3300009177 Bacteria 7885
84 Ga0105248_10060725 3300009177 Bacteria 4244
85 Ga0105248_10133609 3300009177 Bacteria 2799
86 Ga0105248_10335250 3300009177 Bacteria 1703
87 Ga0105248_10457870 3300009177 Unclassified 1438
88 Ga0105248_10498951 3300009177 Bacteria 1372
89 Ga0105248_10588941 3300009177 Unclassified 1255
90 Ga0105249_10548294 3300009553 Unclassified 1207
91 Ga0105246_10531507 3300011119 Bacteria 1004
92 Ga0157374_10019334 3300013296 Bacteria 6028
93 Ga0157378_10010006 3300013297 Bacteria 8271
94 Ga0163162_10017441 3300013306 Bacteria 7025
95 Ga0163162_10083992 3300013306 Bacteria 3259
96 Ga0163162_10156549 3300013306 Bacteria 2398
97 Ga0157375_10137914 3300013308 Bacteria 2564
98 Ga0163163_10185088 3300014325 Bacteria 2130
99 Ga0163163_10241693 3300014325 Unclassified 1855
100 Ga0163163_10244435 3300014325 Bacteria 1844
101 Ga0157380_10297927 3300014326 Bacteria 1484
102 Ga0157379_10018670 3300014968 Bacteria 6113
103 Ga0157379_10370497 3300014968 Bacteria 1313
104 Ga0157376_10036125 3300014969 Bacteria 4000
105 Ga0157376_10065836 3300014969 Bacteria 3062
106 Ga0157376_10314813 3300014969 Unclassified 1486
107 Ga0213876_10079171 3300021384 Unclassified 1737
108 Ga0207642_10039455 3300025899 Bacteria 2052
109 Ga0207680_10170520 3300025903 Bacteria 1465
110 Ga0207645_10086376 3300025907 Unclassified 2015
111 Ga0207684_10351874 3300025910 Bacteria 1268
112 Ga0207707_10017266 3300025912 Bacteria 6289
113 Ga0207707_10301867 3300025912 Unclassified 1384
114 Ga0207662_10013380 3300025918 Bacteria 4588
115 Ga0207681_10003393 3300025923 Bacteria 9959
116 Ga0207681_10209125 3300025923 Bacteria 1503
117 Ga0207650_10114259 3300025925 Bacteria 2094
118 Ga0207659_10075073 3300025926 Bacteria 2479
119 Ga0207687_10008341 3300025927 Bacteria 6778
120 Ga0207687_10019716 3300025927 Bacteria 4470
121 Ga0207644_10002532 3300025931 Bacteria 11754
122 Ga0207706_10429761 3300025933 Bacteria 1144
123 Ga0207706_10508592 3300025933 Bacteria 1039
124 Ga0207686_10057561 3300025934 Bacteria 2447
125 Ga0207686_10346122 3300025934 Bacteria 1118
126 Ga0207704_10225316 3300025938 Unclassified 1390
127 Ga0207691_10061359 3300025940 Bacteria 3415
128 Ga0207711_10149950 3300025941 Bacteria 2103
129 Ga0207711_10309755 3300025941 Unclassified 1458
130 Ga0207667_10652643 3300025949 Bacteria 1058
131 Ga0207651_10073513 3300025960 Bacteria 2431
132 Ga0207651_10168158 3300025960 Unclassified 1726
133 Ga0207651_10250966 3300025960 Unclassified 1448
134 Ga0207651_10334489 3300025960 Bacteria 1270
135 Ga0207668_10128092 3300025972 Bacteria 1934
136 Ga0207640_10038610 3300025981 Bacteria 3015
137 Ga0207640_10421711 3300025981 Unclassified 1092
138 Ga0207703_10006395 3300026035 Bacteria 9419
139 Ga0207703_10059702 3300026035 Bacteria 3116
140 Ga0207703_10268141 3300026035 Unclassified 1546
141 Ga0207639_10304162 3300026041 Bacteria 1410
142 Ga0207708_10075272 3300026075 Bacteria 2588
143 Ga0207708_10131599 3300026075 Bacteria 1956
144 Ga0207641_10002052 3300026088 Bacteria 19139
145 Ga0207641_10401046 3300026088 Bacteria 1317
146 Ga0207641_10463662 3300026088 Bacteria 1226
147 Ga0207648_10017949 3300026089 Bacteria 6417
148 Ga0207648_10049297 3300026089 Bacteria 3685
149 Ga0207676_10246055 3300026095 Bacteria 1607
150 Ga0207674_10612334 3300026116 Bacteria 1052
151 Ga0207675_100131805 3300026118 Bacteria 2370
152 Ga0207675_100624251 3300026118 Bacteria 1082
153 Ga0207683_10016232 3300026121 Bacteria 6337
154 Ga0207683_10144496 3300026121 Unclassified 2144
155 Ga0207683_10249132 3300026121 Bacteria 1621
156 Ga0207698_10305614 3300026142 Bacteria 1483
157 Ga0207428_10406444 3300027907 Bacteria 996
158 Ga0268266_10012166 3300028379 Bacteria 7447
159 Ga0268266_10092503 3300028379 Bacteria 2653
160 Ga0268265_10004373 3300028380 Bacteria 9821
161 Ga0268264_10034126 3300028381 Bacteria 4184
162 Ga0268264_10214974 3300028381 Bacteria 1767
163 Ga0307416_100444256 3300032002 Unclassified 1348
164 Ga0373923_0108915 3300035111 Bacteria 1228
165 Ga0373945_0020486 3300035116 Bacteria 2264
166 Ga0373953_0115694 3300035117 Unclassified 1137
167 Ga0373943_0002051 3300035170 Bacteria 9142
168 Ga0373946_0017104 3300035171 Bacteria 2770
169 Ga0373955_0006747 3300035172 Bacteria 5241
170 Ga0373962_0073389 3300035242 Bacteria 1027
171 Ga0373924_0008462 3300035410 Bacteria 3742
172 Ga0373924_0009031 3300035410 Bacteria 3645
173 Ga0373935_0008720 3300035692 Bacteria 6075
174 Ga0373933_0088700 3300035724 Bacteria 1906
175 Ga0373933_0199137 3300035724 Bacteria 1281
176 Ga0373947_0142649 3300035725 Bacteria 1537
177 Ga0373947_0182341 3300035725 Bacteria 1367
178 Ga0373937_0058415 3300036401 Bacteria 3544
179 Ga0373937_0088432 3300036401 Bacteria 2868
180 Ga0373937_0258764 3300036401 Bacteria 1641
181 Ga0373937_0282986 3300036401 Bacteria 1566
182 Ga0373925_0009773 3300037068 Bacteria 6965
183 Ga0436365_1087440 3300039437 Bacteria 3750
184 Ga0451576_0629102 3300045051 Bacteria 1128
185 Ga0495592_0009245 3300046454 Bacteria 7414
186 Ga0495580_0117242 3300046472 Unclassified 1849
187 Ga0495582_0117543 3300046473 Unclassified 1496
188 Ga0495608_0021975 3300046511 Bacteria 4375
189 Ga0495628_0048543 3300046516 Unclassified 3364
190 Ga0495630_0130254 3300046517 Unclassified 1910
191 Ga0495640_0026520 3300046533 Bacteria 4186
192 Ga0495640_0109976 3300046533 Bacteria 1802
193 Ga0495586_0075604 3300046535 Bacteria 1844
194 Ga0495587_0029447 3300046536 Bacteria 3333
195 Ga0495645_0021836 3300046543 Bacteria 4627
196 Ga0495645_0076679 3300046543 Unclassified 2404
197 Ga0495659_0053390 3300046664 Bacteria 1477
198 Ga0495658_0109630 3300046683 Bacteria 1658
199 Ga0495669_0034542 3300046684 Bacteria 2229
200 Ga0495613_0000688 3300046689 Bacteria 26725
201 Ga0495613_0086301 3300046689 Bacteria 2276
202 Ga0495613_0106507 3300046689 Bacteria 2023
203 Ga0495604_0073985 3300047317 Bacteria 2569
204 Ga0495674_0092964 3300047319 Bacteria 2574
205 Ga0495684_0000601 3300047471 Bacteria 28931
206 Ga0495684_0449812 3300047471 Bacteria 895
207 Ga0496102_0426860 3300048905 Bacteria 1245
208 Ga0496104_0100423 3300048907 Bacteria 2770
209 Ga0496105_0154683 3300048908 Bacteria 1884
210 Ga0496109_0115814 3300048912 Bacteria 2494
211 Ga0496109_0700022 3300048912 Unclassified 951
212 Ga0496110_0125694 3300048913 Bacteria 2314
213 Ga0496112_0125575 3300048915 Unclassified 2537
214 Ga0496112_0133070 3300048915 Bacteria 2457
215 Ga0496114_0013207 3300048917 Bacteria 6620
216 Ga0501034_0210348 3300049571 Bacteria 1900
217 Ga0501047_0003215 3300049581 Bacteria 15490
218 Ga0501044_0005224 3300049823 Bacteria 14450
219 nmdc:mga05p37_102531_c1 3300050507 Bacteria 3524
220 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
221 nmdc:mga05p37_2204_c1 3300050507 Bacteria 22685
222 nmdc:mga05p37_48400_c1 3300050507 Bacteria 5229
223 nmdc:mga09592_300089_c1 3300050508 Unclassified 1393
224 nmdc:mga06r32_247995_c1 3300050510 Bacteria 1768
225 nmdc:mga08y16_515213_c1 3300050511 Bacteria 1214
226 nmdc:mga08y16_9897_c1 3300050511 Bacteria 10008
227 nmdc:mga0n895_109_c1 3300050512 Bacteria 48376
228 nmdc:mga0n895_197446_c1 3300050512 Bacteria 2043
229 nmdc:mga0n895_199590_c1 3300050512 Bacteria 2032
230 nmdc:mga0n895_99929_c1 3300050512 Bacteria 2910
231 nmdc:mga0rr50_170301_c1 3300050513 Unclassified 1774
232 nmdc:mga0rr50_187638_c1 3300050513 Bacteria 1693
233 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
234 nmdc:mga08x19_223_c1 3300050514 Bacteria 43405
235 nmdc:mga08x19_72915_c1 3300050514 Bacteria 2241
236 nmdc:mga0a205_299256_c1 3300050515 Bacteria 1482
237 nmdc:mga0a205_307909_c1 3300050515 Bacteria 1456
238 nmdc:mga0a205_8291_c1 3300050515 Bacteria 7789
239 Ga0495601_0043662 3300053077 Unclassified 2815
240 Ga0495619_0000386 3300053085 Bacteria 30136
241 Ga0495619_0016742 3300053085 Bacteria 4641
242 Ga0495619_0017580 3300053085 Bacteria 4529
243 Ga0590071_012663 3300059421 Bacteria 1976
244 Ga0590071_016759 3300059421 Unclassified 1720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100218159 Ga0068867_1002181592 244
2 3300005548 Ga0070665_100022816 Ga0070665_1000228161 244
3 3300006358 Ga0068871_100001260 Ga0068871_1000012604 244
4 3300009098 Ga0105245_10135428 Ga0105245_101354282 244
5 3300009176 Ga0105242_10057808 Ga0105242_100578083 244
6 3300013306 Ga0163162_10083992 Ga0163162_100839923 244
7 3300013308 Ga0157375_10137914 Ga0157375_101379143 244
8 3300014325 Ga0163163_10185088 Ga0163163_101850883 244
9 3300025907 Ga0207645_10086376 Ga0207645_100863762 244
10 3300025927 Ga0207687_10008341 Ga0207687_100083418 244
11 3300025938 Ga0207704_10225316 Ga0207704_102253162 244
12 3300026088 Ga0207641_10401046 Ga0207641_104010461 244
13 3300026089 Ga0207648_10017949 Ga0207648_100179493 244
14 3300035725 Ga0373947_0182341 Ga0373947_0182341_563_1327 254
15 3300026041 Ga0207639_10304162 Ga0207639_103041622 258
16 3300005563 Ga0068855_100519367 Ga0068855_1005193672 261
17 3300025949 Ga0207667_10652643 Ga0207667_106526431 261
18 3300005618 Ga0068864_100090901 Ga0068864_1000909013 264
19 3300011119 Ga0105246_10531507 Ga0105246_105315072 264
20 3300025910 Ga0207684_10351874 Ga0207684_103518742 264
21 3300025925 Ga0207650_10114259 Ga0207650_101142592 264
22 3300026095 Ga0207676_10246055 Ga0207676_102460552 264
23 3300035116 Ga0373945_0020486 Ga0373945_0020486_855_1667 264
24 3300035170 Ga0373943_0002051 Ga0373943_0002051_4468_5280 264
25 3300035171 Ga0373946_0017104 Ga0373946_0017104_633_1445 264
26 3300035172 Ga0373955_0006747 Ga0373955_0006747_4313_5125 264
27 3300035410 Ga0373924_0008462 Ga0373924_0008462_136_948 264
28 3300035692 Ga0373935_0008720 Ga0373935_0008720_3447_4259 264
29 3300035724 Ga0373933_0088700 Ga0373933_0088700_1032_1844 264
30 3300035725 Ga0373947_0142649 Ga0373947_0142649_609_1421 264
31 3300036401 Ga0373937_0258764 Ga0373937_0258764_16_828 264
32 3300037068 Ga0373925_0009773 Ga0373925_0009773_5810_6622 264
33 3300046664 Ga0495659_0053390 Ga0495659_0053390_512_1324 264
34 3300046689 Ga0495613_0086301 Ga0495613_0086301_67_879 264
35 3300047471 Ga0495684_0449812 Ga0495684_0449812_53_865 264
36 3300032002 Ga0307416_100444256 Ga0307416_1004442562 268
37 3300048905 Ga0496102_0426860 Ga0496102_0426860_302_1147 268
38 3300059421 Ga0590071_012663 Ga0590071_012663_249_1082 268
39 3300014969 Ga0157376_10036125 Ga0157376_100361252 269
40 3300046683 Ga0495658_0109630 Ga0495658_0109630_197_1048 269
41 3300046689 Ga0495613_0106507 Ga0495613_0106507_1104_1973 269
42 3300005364 Ga0070673_100009257 Ga0070673_1000092574 270
43 3300005458 Ga0070681_10338216 Ga0070681_103382162 270
44 3300006871 Ga0075434_100000505 Ga0075434_1000005057 270
45 3300006914 Ga0075436_100001003 Ga0075436_10000100312 270
46 3300007076 Ga0075435_100000129 Ga0075435_10000012929 270
47 3300009094 Ga0111539_10548321 Ga0111539_105483212 270
48 3300009177 Ga0105248_10335250 Ga0105248_103352502 270
49 3300021384 Ga0213876_10079171 Ga0213876_100791712 270
50 3300025903 Ga0207680_10170520 Ga0207680_101705202 270
51 3300025912 Ga0207707_10301867 Ga0207707_103018672 270
52 3300025933 Ga0207706_10429761 Ga0207706_104297611 270
53 3300025960 Ga0207651_10168158 Ga0207651_101681581 270
54 3300025981 Ga0207640_10421711 Ga0207640_104217112 270
55 3300026035 Ga0207703_10059702 Ga0207703_100597024 270
56 3300039437 Ga0436365_1087440 Ga0436365_1087440_1661_2479 270
57 3300050511 nmdc:mga08y16_515213_c1 nmdc:mga08y16_515213_c1_268_1098 270
58 3300059421 Ga0590071_016759 Ga0590071_016759_65_895 270
59 3300005456 Ga0070678_100119762 Ga0070678_1001197622 271
60 3300006237 Ga0097621_100047805 Ga0097621_1000478053 271
61 3300006358 Ga0068871_100108461 Ga0068871_1001084613 271
62 3300006871 Ga0075434_100012294 Ga0075434_1000122946 271
63 3300006871 Ga0075434_100061083 Ga0075434_1000610833 271
64 3300007076 Ga0075435_100032243 Ga0075435_1000322435 271
65 3300009098 Ga0105245_10076307 Ga0105245_100763071 271
66 3300013297 Ga0157378_10010006 Ga0157378_1001000610 271
67 3300026035 Ga0207703_10268141 Ga0207703_102681412 271
68 3300026118 Ga0207675_100131805 Ga0207675_1001318052 271
69 3300026121 Ga0207683_10144496 Ga0207683_101444963 271
70 3300035724 Ga0373933_0199137 Ga0373933_0199137_92_937 271
71 3300036401 Ga0373937_0088432 Ga0373937_0088432_595_1440 271
72 3300046533 Ga0495640_0109976 Ga0495640_0109976_884_1729 271
73 3300046535 Ga0495586_0075604 Ga0495586_0075604_560_1405 271
74 3300046543 Ga0495645_0021836 Ga0495645_0021836_1541_2386 271
75 3300050512 nmdc:mga0n895_99929_c1 nmdc:mga0n895_99929_c1_648_1496 271
76 3300050514 nmdc:mga08x19_72915_c1 nmdc:mga08x19_72915_c1_238_1086 271
77 3300053085 Ga0495619_0017580 Ga0495619_0017580_2157_3002 271
78 3300005335 Ga0070666_10007203 Ga0070666_100072035 272
79 3300005343 Ga0070687_100072813 Ga0070687_1000728131 272
80 3300005353 Ga0070669_100012905 Ga0070669_1000129053 272
81 3300005355 Ga0070671_100108764 Ga0070671_1001087642 272
82 3300005364 Ga0070673_100666811 Ga0070673_1006668111 272
83 3300005445 Ga0070708_100393550 Ga0070708_1003935502 272
84 3300005459 Ga0068867_100451798 Ga0068867_1004517981 272
85 3300005471 Ga0070698_100264179 Ga0070698_1002641791 272
86 3300005530 Ga0070679_100276833 Ga0070679_1002768332 272
87 3300005544 Ga0070686_100001050 Ga0070686_10000105013 272
88 3300005563 Ga0068855_100221893 Ga0068855_1002218933 272
89 3300005578 Ga0068854_100010917 Ga0068854_1000109174 272
90 3300005841 Ga0068863_100019394 Ga0068863_1000193948 272
91 3300005843 Ga0068860_100146557 Ga0068860_1001465573 272
92 3300005843 Ga0068860_100233122 Ga0068860_1002331221 272
93 3300005843 Ga0068860_100811432 Ga0068860_1008114321 272
94 3300006844 Ga0075428_100027444 Ga0075428_1000274448 272
95 3300006852 Ga0075433_10017098 Ga0075433_100170985 272
96 3300006871 Ga0075434_100045659 Ga0075434_1000456593 272
97 3300006871 Ga0075434_100117131 Ga0075434_1001171312 272
98 3300006871 Ga0075434_100528845 Ga0075434_1005288451 272
99 3300006914 Ga0075436_100015009 Ga0075436_1000150094 272
100 3300006914 Ga0075436_100054813 Ga0075436_1000548132 272
101 3300007076 Ga0075435_100012127 Ga0075435_10001212710 272
102 3300007076 Ga0075435_100127962 Ga0075435_1001279623 272
103 3300009094 Ga0111539_10057320 Ga0111539_100573203 272
104 3300009147 Ga0114129_10101698 Ga0114129_101016984 272
105 3300009147 Ga0114129_10205119 Ga0114129_102051193 272
106 3300009177 Ga0105248_10017587 Ga0105248_100175878 272
107 3300009177 Ga0105248_10060725 Ga0105248_100607253 272
108 3300009177 Ga0105248_10133609 Ga0105248_101336093 272
109 3300009177 Ga0105248_10498951 Ga0105248_104989511 272
110 3300013306 Ga0163162_10017441 Ga0163162_100174412 272
111 3300014326 Ga0157380_10297927 Ga0157380_102979271 272
112 3300014968 Ga0157379_10018670 Ga0157379_100186706 272
113 3300025918 Ga0207662_10013380 Ga0207662_100133803 272
114 3300025923 Ga0207681_10003393 Ga0207681_1000339310 272
115 3300025931 Ga0207644_10002532 Ga0207644_100025323 272
116 3300025933 Ga0207706_10508592 Ga0207706_105085921 272
117 3300025940 Ga0207691_10061359 Ga0207691_100613592 272
118 3300025941 Ga0207711_10149950 Ga0207711_101499503 272
119 3300025960 Ga0207651_10073513 Ga0207651_100735133 272
120 3300025960 Ga0207651_10334489 Ga0207651_103344892 272
121 3300025981 Ga0207640_10038610 Ga0207640_100386103 272
122 3300026075 Ga0207708_10131599 Ga0207708_101315992 272
123 3300026088 Ga0207641_10002052 Ga0207641_1000205216 272
124 3300026088 Ga0207641_10463662 Ga0207641_104636622 272
125 3300026118 Ga0207675_100624251 Ga0207675_1006242511 272
126 3300026121 Ga0207683_10249132 Ga0207683_102491322 272
127 3300026142 Ga0207698_10305614 Ga0207698_103056141 272
128 3300027907 Ga0207428_10406444 Ga0207428_104064441 272
129 3300028379 Ga0268266_10012166 Ga0268266_100121662 272
130 3300028380 Ga0268265_10004373 Ga0268265_100043734 272
131 3300028381 Ga0268264_10034126 Ga0268264_100341264 272
132 3300028381 Ga0268264_10214974 Ga0268264_102149741 272
133 3300035242 Ga0373962_0073389 Ga0373962_0073389_50_871 272
134 3300048912 Ga0496109_0115814 Ga0496109_0115814_969_1790 272
135 3300048913 Ga0496110_0125694 Ga0496110_0125694_1223_2044 272
136 3300050507 nmdc:mga05p37_102531_c1 nmdc:mga05p37_102531_c1_568_1389 272
137 3300050507 nmdc:mga05p37_1909_c1 nmdc:mga05p37_1909_c1_12797_13681 272
138 3300050507 nmdc:mga05p37_2204_c1 nmdc:mga05p37_2204_c1_1374_2204 272
139 3300050508 nmdc:mga09592_300089_c1 nmdc:mga09592_300089_c1_36_866 272
140 3300050510 nmdc:mga06r32_247995_c1 nmdc:mga06r32_247995_c1_177_1004 272
141 3300050511 nmdc:mga08y16_9897_c1 nmdc:mga08y16_9897_c1_2801_3622 272
142 3300050512 nmdc:mga0n895_109_c1 nmdc:mga0n895_109_c1_30813_31661 272
143 3300050512 nmdc:mga0n895_199590_c1 nmdc:mga0n895_199590_c1_164_985 272
144 3300050513 nmdc:mga0rr50_170301_c1 nmdc:mga0rr50_170301_c1_638_1465 272
145 3300050513 nmdc:mga0rr50_187638_c1 nmdc:mga0rr50_187638_c1_129_956 272
146 3300050513 nmdc:mga0rr50_36_c1 nmdc:mga0rr50_36_c1_54544_55392 272
147 3300050514 nmdc:mga08x19_223_c1 nmdc:mga08x19_223_c1_17023_17871 272
148 3300050515 nmdc:mga0a205_307909_c1 nmdc:mga0a205_307909_c1_55_888 272
149 3300050515 nmdc:mga0a205_8291_c1 nmdc:mga0a205_8291_c1_4775_5596 272
150 3300005347 Ga0070668_100261429 Ga0070668_1002614292 273
151 3300005356 Ga0070674_100002747 Ga0070674_1000027479 273
152 3300005459 Ga0068867_100031902 Ga0068867_1000319025 273
153 3300005536 Ga0070697_100049694 Ga0070697_1000496943 273
154 3300005546 Ga0070696_100034174 Ga0070696_1000341744 273
155 3300005548 Ga0070665_100107786 Ga0070665_1001077863 273
156 3300005617 Ga0068859_100247883 Ga0068859_1002478833 273
157 3300005617 Ga0068859_100615671 Ga0068859_1006156711 273
158 3300005842 Ga0068858_100033393 Ga0068858_1000333933 273
159 3300005843 Ga0068860_100546425 Ga0068860_1005464252 273
160 3300006237 Ga0097621_100176367 Ga0097621_1001763672 273
161 3300006844 Ga0075428_100492487 Ga0075428_1004924872 273
162 3300006852 Ga0075433_10308095 Ga0075433_103080952 273
163 3300006871 Ga0075434_100165444 Ga0075434_1001654442 273
164 3300006871 Ga0075434_100224716 Ga0075434_1002247162 273
165 3300006881 Ga0068865_100466827 Ga0068865_1004668272 273
166 3300006931 Ga0097620_100247872 Ga0097620_1002478723 273
167 3300006931 Ga0097620_100615687 Ga0097620_1006156871 273
168 3300007076 Ga0075435_100027379 Ga0075435_1000273795 273
169 3300009098 Ga0105245_10015807 Ga0105245_100158074 273
170 3300009147 Ga0114129_10027029 Ga0114129_100270295 273
171 3300009148 Ga0105243_10098774 Ga0105243_100987743 273
172 3300009176 Ga0105242_10013301 Ga0105242_100133013 273
173 3300009176 Ga0105242_10145952 Ga0105242_101459523 273
174 3300009176 Ga0105242_10241414 Ga0105242_102414141 273
175 3300009553 Ga0105249_10548294 Ga0105249_105482942 273
176 3300013296 Ga0157374_10019334 Ga0157374_100193347 273
177 3300013306 Ga0163162_10156549 Ga0163162_101565492 273
178 3300014325 Ga0163163_10241693 Ga0163163_102416932 273
179 3300014325 Ga0163163_10244435 Ga0163163_102444352 273
180 3300014969 Ga0157376_10314813 Ga0157376_103148132 273
181 3300025899 Ga0207642_10039455 Ga0207642_100394553 273
182 3300025927 Ga0207687_10019716 Ga0207687_100197164 273
183 3300025934 Ga0207686_10057561 Ga0207686_100575611 273
184 3300025934 Ga0207686_10346122 Ga0207686_103461221 273
185 3300025972 Ga0207668_10128092 Ga0207668_101280922 273
186 3300026035 Ga0207703_10006395 Ga0207703_100063955 273
187 3300026075 Ga0207708_10075272 Ga0207708_100752723 273
188 3300026089 Ga0207648_10049297 Ga0207648_100492974 273
189 3300028379 Ga0268266_10092503 Ga0268266_100925033 273
190 3300035111 Ga0373923_0108915 Ga0373923_0108915_213_1067 273
191 3300035117 Ga0373953_0115694 Ga0373953_0115694_247_1101 273
192 3300035410 Ga0373924_0009031 Ga0373924_0009031_1807_2661 273
193 3300045051 Ga0451576_0629102 Ga0451576_0629102_99_947 273
194 3300046454 Ga0495592_0009245 Ga0495592_0009245_1059_1913 273
195 3300046472 Ga0495580_0117242 Ga0495580_0117242_792_1646 273
196 3300046473 Ga0495582_0117543 Ga0495582_0117543_621_1475 273
197 3300046511 Ga0495608_0021975 Ga0495608_0021975_196_1050 273
198 3300046516 Ga0495628_0048543 Ga0495628_0048543_370_1224 273
199 3300046517 Ga0495630_0130254 Ga0495630_0130254_912_1766 273
200 3300046533 Ga0495640_0026520 Ga0495640_0026520_133_987 273
201 3300046536 Ga0495587_0029447 Ga0495587_0029447_261_1115 273
202 3300046543 Ga0495645_0076679 Ga0495645_0076679_892_1746 273
203 3300046684 Ga0495669_0034542 Ga0495669_0034542_871_1782 273
204 3300046689 Ga0495613_0000688 Ga0495613_0000688_22987_23841 273
205 3300047317 Ga0495604_0073985 Ga0495604_0073985_330_1184 273
206 3300047319 Ga0495674_0092964 Ga0495674_0092964_1570_2424 273
207 3300047471 Ga0495684_0000601 Ga0495684_0000601_8989_9843 273
208 3300048907 Ga0496104_0100423 Ga0496104_0100423_1259_2203 273
209 3300048917 Ga0496114_0013207 Ga0496114_0013207_1581_2525 273
210 3300050507 nmdc:mga05p37_48400_c1 nmdc:mga05p37_48400_c1_358_1197 273
211 3300050512 nmdc:mga0n895_197446_c1 nmdc:mga0n895_197446_c1_759_1589 273
212 3300050515 nmdc:mga0a205_299256_c1 nmdc:mga0a205_299256_c1_309_1148 273
213 3300053077 Ga0495601_0043662 Ga0495601_0043662_1707_2561 273
214 3300053085 Ga0495619_0000386 Ga0495619_0000386_17844_18698 273
215 3300053085 Ga0495619_0016742 Ga0495619_0016742_1256_2110 273
216 3300005336 Ga0070680_100081509 Ga0070680_1000815092 274
217 3300005364 Ga0070673_100255466 Ga0070673_1002554661 274
218 3300005439 Ga0070711_100051276 Ga0070711_1000512763 274
219 3300005458 Ga0070681_10012776 Ga0070681_100127766 274
220 3300005564 Ga0070664_100283360 Ga0070664_1002833602 274
221 3300005617 Ga0068859_100186517 Ga0068859_1001865174 274
222 3300005618 Ga0068864_100011489 Ga0068864_1000114894 274
223 3300006931 Ga0097620_100186520 Ga0097620_1001865204 274
224 3300009177 Ga0105248_10457870 Ga0105248_104578703 274
225 3300009177 Ga0105248_10588941 Ga0105248_105889411 274
226 3300025912 Ga0207707_10017266 Ga0207707_100172663 274
227 3300025923 Ga0207681_10209125 Ga0207681_102091252 274
228 3300025926 Ga0207659_10075073 Ga0207659_100750733 274
229 3300025941 Ga0207711_10309755 Ga0207711_103097551 274
230 3300026116 Ga0207674_10612334 Ga0207674_106123342 274
231 3300026121 Ga0207683_10016232 Ga0207683_100162328 274
232 3300036401 Ga0373937_0058415 Ga0373937_0058415_921_1745 274
233 3300036401 Ga0373937_0282986 Ga0373937_0282986_174_998 274
234 3300048908 Ga0496105_0154683 Ga0496105_0154683_477_1301 274
235 3300048912 Ga0496109_0700022 Ga0496109_0700022_22_849 274
236 3300048915 Ga0496112_0125575 Ga0496112_0125575_79_903 274
237 3300048915 Ga0496112_0133070 Ga0496112_0133070_1174_1998 274
238 3300049571 Ga0501034_0210348 Ga0501034_0210348_72_902 274
239 3300049581 Ga0501047_0003215 Ga0501047_0003215_7140_7970 274
240 3300049823 Ga0501044_0005224 Ga0501044_0005224_7118_7948 274
241 3300005290 Ga0065712_10074244 Ga0065712_100742445 275
242 3300014968 Ga0157379_10370497 Ga0157379_103704972 275
243 3300014969 Ga0157376_10065836 Ga0157376_100658362 275
244 3300025960 Ga0207651_10250966 Ga0207651_102509663 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01875

Memo

Memo-like protein

7

279

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8919 5 273
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8864 5 273
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8704 5 273
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8649 5 273
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.7249 42 275
ID Description Score Start End Superfamily
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9287 4 272 3.40.830.10
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9058 4 272 3.40.830.10
af_Q54NZ1_1_286_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9054 5 271 3.40.830.10
af_Q9VG04_2_293_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.901 4 272 3.40.830.10
af_C0H4B1_3_295_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8797 4 273 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A2V7VG98-F1-model_v4 AmmeMemoRadiSam system protein B 0.9874 72 275
AF-A0A2V8I8D3-F1-model_v4 MEMO1 family protein DMF87_04745 0.9873 1 272
AF-A0A353BHY1-F1-model_v4 AMMECR1 domain-containing protein 0.9819 2 275
AF-A0A2V8GCP8-F1-model_v4 MEMO1 family protein DMF91_10985 0.9802 1 274 GO:0005978
GO:0008878
AF-A0A523DD88-F1-model_v4 MEMO1 family protein E2P06_14390 0.9797 1 272

Feature Viewer

pLDDT pTM Quality
95.07 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map