F356519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 244 | 142 | 244 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10370497|Ga0157379_103704972 |
| Length | 285 |
| Sequence | MTSQVRKAAVAGSWYPGTATALASAVDRYLAAADRDTGPDRIAGGDLAALIAPHAGLMYSGPVAAHAYRLLRERVFDVAVLVGPSHFVGFDGVSIQPSGGFETPLGVVPIDADTASAIISAAPVSGLIHELPAAHGREHSLEMQLPFLAHLAPRLPIVPLVMGHQTADTARALGDALGTALGGRRALLVASTDLSHYHDAATASRLDAVVIDCVARFDVAGLQRTLDARPEHACGGGPTVAVMRAAWLAGARDAVVLNYADSGDVSGDKTAVVGYLAAALGTFAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 91 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 97 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 98 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 100 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 129 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.69 |
| Rhizosphere | 95.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10074244 | 3300005290 | Bacteria | 4145 |
| 2 | Ga0070666_10007203 | 3300005335 | Bacteria | 6858 |
| 3 | Ga0070680_100081509 | 3300005336 | Bacteria | 2670 |
| 4 | Ga0070687_100072813 | 3300005343 | Bacteria | 1850 |
| 5 | Ga0070668_100261429 | 3300005347 | Unclassified | 1439 |
| 6 | Ga0070669_100012905 | 3300005353 | Bacteria | 5934 |
| 7 | Ga0070671_100108764 | 3300005355 | Bacteria | 2328 |
| 8 | Ga0070674_100002747 | 3300005356 | Bacteria | 9728 |
| 9 | Ga0070673_100009257 | 3300005364 | Bacteria | 6608 |
| 10 | Ga0070673_100255466 | 3300005364 | Unclassified | 1529 |
| 11 | Ga0070673_100666811 | 3300005364 | Bacteria | 953 |
| 12 | Ga0070711_100051276 | 3300005439 | Bacteria | 2833 |
| 13 | Ga0070708_100393550 | 3300005445 | Unclassified | 1307 |
| 14 | Ga0070678_100119762 | 3300005456 | Unclassified | 2074 |
| 15 | Ga0070681_10012776 | 3300005458 | Bacteria | 8333 |
| 16 | Ga0070681_10338216 | 3300005458 | Bacteria | 1415 |
| 17 | Ga0068867_100031902 | 3300005459 | Unclassified | 3807 |
| 18 | Ga0068867_100218159 | 3300005459 | Bacteria | 1536 |
| 19 | Ga0068867_100451798 | 3300005459 | Bacteria | 1095 |
| 20 | Ga0070698_100264179 | 3300005471 | Unclassified | 1653 |
| 21 | Ga0070679_100276833 | 3300005530 | Bacteria | 1631 |
| 22 | Ga0070697_100049694 | 3300005536 | Bacteria | 3404 |
| 23 | Ga0070686_100001050 | 3300005544 | Bacteria | 15900 |
| 24 | Ga0070696_100034174 | 3300005546 | Bacteria | 3497 |
| 25 | Ga0070665_100022816 | 3300005548 | Bacteria | 6301 |
| 26 | Ga0070665_100107786 | 3300005548 | Bacteria | 2788 |
| 27 | Ga0068855_100221893 | 3300005563 | Bacteria | 2119 |
| 28 | Ga0068855_100519367 | 3300005563 | Bacteria | 1292 |
| 29 | Ga0070664_100283360 | 3300005564 | Bacteria | 1495 |
| 30 | Ga0068854_100010917 | 3300005578 | Bacteria | 5892 |
| 31 | Ga0068859_100186517 | 3300005617 | Bacteria | 2158 |
| 32 | Ga0068859_100247883 | 3300005617 | Bacteria | 1871 |
| 33 | Ga0068859_100615671 | 3300005617 | Bacteria | 1179 |
| 34 | Ga0068864_100011489 | 3300005618 | Bacteria | 7314 |
| 35 | Ga0068864_100090901 | 3300005618 | Bacteria | 2692 |
| 36 | Ga0068863_100019394 | 3300005841 | Bacteria | 6505 |
| 37 | Ga0068858_100033393 | 3300005842 | Bacteria | 4776 |
| 38 | Ga0068860_100146557 | 3300005843 | Bacteria | 2272 |
| 39 | Ga0068860_100233122 | 3300005843 | Bacteria | 1789 |
| 40 | Ga0068860_100546425 | 3300005843 | Bacteria | 1160 |
| 41 | Ga0068860_100811432 | 3300005843 | Bacteria | 949 |
| 42 | Ga0097621_100047805 | 3300006237 | Bacteria | 3468 |
| 43 | Ga0097621_100176367 | 3300006237 | Unclassified | 1845 |
| 44 | Ga0068871_100001260 | 3300006358 | Bacteria | 16929 |
| 45 | Ga0068871_100108461 | 3300006358 | Bacteria | 2333 |
| 46 | Ga0075428_100027444 | 3300006844 | Bacteria | 6299 |
| 47 | Ga0075428_100492487 | 3300006844 | Unclassified | 1312 |
| 48 | Ga0075433_10017098 | 3300006852 | Bacteria | 5998 |
| 49 | Ga0075433_10308095 | 3300006852 | Bacteria | 1402 |
| 50 | Ga0075434_100000505 | 3300006871 | Bacteria | 29553 |
| 51 | Ga0075434_100012294 | 3300006871 | Bacteria | 8111 |
| 52 | Ga0075434_100045659 | 3300006871 | Bacteria | 4346 |
| 53 | Ga0075434_100061083 | 3300006871 | Bacteria | 3748 |
| 54 | Ga0075434_100117131 | 3300006871 | Bacteria | 2677 |
| 55 | Ga0075434_100165444 | 3300006871 | Bacteria | 2232 |
| 56 | Ga0075434_100224716 | 3300006871 | Bacteria | 1897 |
| 57 | Ga0075434_100528845 | 3300006871 | Bacteria | 1199 |
| 58 | Ga0068865_100466827 | 3300006881 | Bacteria | 1046 |
| 59 | Ga0075436_100001003 | 3300006914 | Bacteria | 18959 |
| 60 | Ga0075436_100015009 | 3300006914 | Bacteria | 5310 |
| 61 | Ga0075436_100054813 | 3300006914 | Bacteria | 2752 |
| 62 | Ga0097620_100186520 | 3300006931 | Bacteria | 2158 |
| 63 | Ga0097620_100247872 | 3300006931 | Bacteria | 1871 |
| 64 | Ga0097620_100615687 | 3300006931 | Bacteria | 1179 |
| 65 | Ga0075435_100000129 | 3300007076 | Bacteria | 43005 |
| 66 | Ga0075435_100012127 | 3300007076 | Bacteria | 6373 |
| 67 | Ga0075435_100027379 | 3300007076 | Bacteria | 4458 |
| 68 | Ga0075435_100032243 | 3300007076 | Bacteria | 4136 |
| 69 | Ga0075435_100127962 | 3300007076 | Unclassified | 2124 |
| 70 | Ga0111539_10057320 | 3300009094 | Bacteria | 4627 |
| 71 | Ga0111539_10548321 | 3300009094 | Bacteria | 1347 |
| 72 | Ga0105245_10015807 | 3300009098 | Bacteria | 6578 |
| 73 | Ga0105245_10076307 | 3300009098 | Bacteria | 3053 |
| 74 | Ga0105245_10135428 | 3300009098 | Bacteria | 2314 |
| 75 | Ga0114129_10027029 | 3300009147 | Bacteria | 8125 |
| 76 | Ga0114129_10101698 | 3300009147 | Unclassified | 3976 |
| 77 | Ga0114129_10205119 | 3300009147 | Bacteria | 2668 |
| 78 | Ga0105243_10098774 | 3300009148 | Bacteria | 2419 |
| 79 | Ga0105242_10013301 | 3300009176 | Bacteria | 6355 |
| 80 | Ga0105242_10057808 | 3300009176 | Unclassified | 3178 |
| 81 | Ga0105242_10145952 | 3300009176 | Bacteria | 2058 |
| 82 | Ga0105242_10241414 | 3300009176 | Unclassified | 1624 |
| 83 | Ga0105248_10017587 | 3300009177 | Bacteria | 7885 |
| 84 | Ga0105248_10060725 | 3300009177 | Bacteria | 4244 |
| 85 | Ga0105248_10133609 | 3300009177 | Bacteria | 2799 |
| 86 | Ga0105248_10335250 | 3300009177 | Bacteria | 1703 |
| 87 | Ga0105248_10457870 | 3300009177 | Unclassified | 1438 |
| 88 | Ga0105248_10498951 | 3300009177 | Bacteria | 1372 |
| 89 | Ga0105248_10588941 | 3300009177 | Unclassified | 1255 |
| 90 | Ga0105249_10548294 | 3300009553 | Unclassified | 1207 |
| 91 | Ga0105246_10531507 | 3300011119 | Bacteria | 1004 |
| 92 | Ga0157374_10019334 | 3300013296 | Bacteria | 6028 |
| 93 | Ga0157378_10010006 | 3300013297 | Bacteria | 8271 |
| 94 | Ga0163162_10017441 | 3300013306 | Bacteria | 7025 |
| 95 | Ga0163162_10083992 | 3300013306 | Bacteria | 3259 |
| 96 | Ga0163162_10156549 | 3300013306 | Bacteria | 2398 |
| 97 | Ga0157375_10137914 | 3300013308 | Bacteria | 2564 |
| 98 | Ga0163163_10185088 | 3300014325 | Bacteria | 2130 |
| 99 | Ga0163163_10241693 | 3300014325 | Unclassified | 1855 |
| 100 | Ga0163163_10244435 | 3300014325 | Bacteria | 1844 |
| 101 | Ga0157380_10297927 | 3300014326 | Bacteria | 1484 |
| 102 | Ga0157379_10018670 | 3300014968 | Bacteria | 6113 |
| 103 | Ga0157379_10370497 | 3300014968 | Bacteria | 1313 |
| 104 | Ga0157376_10036125 | 3300014969 | Bacteria | 4000 |
| 105 | Ga0157376_10065836 | 3300014969 | Bacteria | 3062 |
| 106 | Ga0157376_10314813 | 3300014969 | Unclassified | 1486 |
| 107 | Ga0213876_10079171 | 3300021384 | Unclassified | 1737 |
| 108 | Ga0207642_10039455 | 3300025899 | Bacteria | 2052 |
| 109 | Ga0207680_10170520 | 3300025903 | Bacteria | 1465 |
| 110 | Ga0207645_10086376 | 3300025907 | Unclassified | 2015 |
| 111 | Ga0207684_10351874 | 3300025910 | Bacteria | 1268 |
| 112 | Ga0207707_10017266 | 3300025912 | Bacteria | 6289 |
| 113 | Ga0207707_10301867 | 3300025912 | Unclassified | 1384 |
| 114 | Ga0207662_10013380 | 3300025918 | Bacteria | 4588 |
| 115 | Ga0207681_10003393 | 3300025923 | Bacteria | 9959 |
| 116 | Ga0207681_10209125 | 3300025923 | Bacteria | 1503 |
| 117 | Ga0207650_10114259 | 3300025925 | Bacteria | 2094 |
| 118 | Ga0207659_10075073 | 3300025926 | Bacteria | 2479 |
| 119 | Ga0207687_10008341 | 3300025927 | Bacteria | 6778 |
| 120 | Ga0207687_10019716 | 3300025927 | Bacteria | 4470 |
| 121 | Ga0207644_10002532 | 3300025931 | Bacteria | 11754 |
| 122 | Ga0207706_10429761 | 3300025933 | Bacteria | 1144 |
| 123 | Ga0207706_10508592 | 3300025933 | Bacteria | 1039 |
| 124 | Ga0207686_10057561 | 3300025934 | Bacteria | 2447 |
| 125 | Ga0207686_10346122 | 3300025934 | Bacteria | 1118 |
| 126 | Ga0207704_10225316 | 3300025938 | Unclassified | 1390 |
| 127 | Ga0207691_10061359 | 3300025940 | Bacteria | 3415 |
| 128 | Ga0207711_10149950 | 3300025941 | Bacteria | 2103 |
| 129 | Ga0207711_10309755 | 3300025941 | Unclassified | 1458 |
| 130 | Ga0207667_10652643 | 3300025949 | Bacteria | 1058 |
| 131 | Ga0207651_10073513 | 3300025960 | Bacteria | 2431 |
| 132 | Ga0207651_10168158 | 3300025960 | Unclassified | 1726 |
| 133 | Ga0207651_10250966 | 3300025960 | Unclassified | 1448 |
| 134 | Ga0207651_10334489 | 3300025960 | Bacteria | 1270 |
| 135 | Ga0207668_10128092 | 3300025972 | Bacteria | 1934 |
| 136 | Ga0207640_10038610 | 3300025981 | Bacteria | 3015 |
| 137 | Ga0207640_10421711 | 3300025981 | Unclassified | 1092 |
| 138 | Ga0207703_10006395 | 3300026035 | Bacteria | 9419 |
| 139 | Ga0207703_10059702 | 3300026035 | Bacteria | 3116 |
| 140 | Ga0207703_10268141 | 3300026035 | Unclassified | 1546 |
| 141 | Ga0207639_10304162 | 3300026041 | Bacteria | 1410 |
| 142 | Ga0207708_10075272 | 3300026075 | Bacteria | 2588 |
| 143 | Ga0207708_10131599 | 3300026075 | Bacteria | 1956 |
| 144 | Ga0207641_10002052 | 3300026088 | Bacteria | 19139 |
| 145 | Ga0207641_10401046 | 3300026088 | Bacteria | 1317 |
| 146 | Ga0207641_10463662 | 3300026088 | Bacteria | 1226 |
| 147 | Ga0207648_10017949 | 3300026089 | Bacteria | 6417 |
| 148 | Ga0207648_10049297 | 3300026089 | Bacteria | 3685 |
| 149 | Ga0207676_10246055 | 3300026095 | Bacteria | 1607 |
| 150 | Ga0207674_10612334 | 3300026116 | Bacteria | 1052 |
| 151 | Ga0207675_100131805 | 3300026118 | Bacteria | 2370 |
| 152 | Ga0207675_100624251 | 3300026118 | Bacteria | 1082 |
| 153 | Ga0207683_10016232 | 3300026121 | Bacteria | 6337 |
| 154 | Ga0207683_10144496 | 3300026121 | Unclassified | 2144 |
| 155 | Ga0207683_10249132 | 3300026121 | Bacteria | 1621 |
| 156 | Ga0207698_10305614 | 3300026142 | Bacteria | 1483 |
| 157 | Ga0207428_10406444 | 3300027907 | Bacteria | 996 |
| 158 | Ga0268266_10012166 | 3300028379 | Bacteria | 7447 |
| 159 | Ga0268266_10092503 | 3300028379 | Bacteria | 2653 |
| 160 | Ga0268265_10004373 | 3300028380 | Bacteria | 9821 |
| 161 | Ga0268264_10034126 | 3300028381 | Bacteria | 4184 |
| 162 | Ga0268264_10214974 | 3300028381 | Bacteria | 1767 |
| 163 | Ga0307416_100444256 | 3300032002 | Unclassified | 1348 |
| 164 | Ga0373923_0108915 | 3300035111 | Bacteria | 1228 |
| 165 | Ga0373945_0020486 | 3300035116 | Bacteria | 2264 |
| 166 | Ga0373953_0115694 | 3300035117 | Unclassified | 1137 |
| 167 | Ga0373943_0002051 | 3300035170 | Bacteria | 9142 |
| 168 | Ga0373946_0017104 | 3300035171 | Bacteria | 2770 |
| 169 | Ga0373955_0006747 | 3300035172 | Bacteria | 5241 |
| 170 | Ga0373962_0073389 | 3300035242 | Bacteria | 1027 |
| 171 | Ga0373924_0008462 | 3300035410 | Bacteria | 3742 |
| 172 | Ga0373924_0009031 | 3300035410 | Bacteria | 3645 |
| 173 | Ga0373935_0008720 | 3300035692 | Bacteria | 6075 |
| 174 | Ga0373933_0088700 | 3300035724 | Bacteria | 1906 |
| 175 | Ga0373933_0199137 | 3300035724 | Bacteria | 1281 |
| 176 | Ga0373947_0142649 | 3300035725 | Bacteria | 1537 |
| 177 | Ga0373947_0182341 | 3300035725 | Bacteria | 1367 |
| 178 | Ga0373937_0058415 | 3300036401 | Bacteria | 3544 |
| 179 | Ga0373937_0088432 | 3300036401 | Bacteria | 2868 |
| 180 | Ga0373937_0258764 | 3300036401 | Bacteria | 1641 |
| 181 | Ga0373937_0282986 | 3300036401 | Bacteria | 1566 |
| 182 | Ga0373925_0009773 | 3300037068 | Bacteria | 6965 |
| 183 | Ga0436365_1087440 | 3300039437 | Bacteria | 3750 |
| 184 | Ga0451576_0629102 | 3300045051 | Bacteria | 1128 |
| 185 | Ga0495592_0009245 | 3300046454 | Bacteria | 7414 |
| 186 | Ga0495580_0117242 | 3300046472 | Unclassified | 1849 |
| 187 | Ga0495582_0117543 | 3300046473 | Unclassified | 1496 |
| 188 | Ga0495608_0021975 | 3300046511 | Bacteria | 4375 |
| 189 | Ga0495628_0048543 | 3300046516 | Unclassified | 3364 |
| 190 | Ga0495630_0130254 | 3300046517 | Unclassified | 1910 |
| 191 | Ga0495640_0026520 | 3300046533 | Bacteria | 4186 |
| 192 | Ga0495640_0109976 | 3300046533 | Bacteria | 1802 |
| 193 | Ga0495586_0075604 | 3300046535 | Bacteria | 1844 |
| 194 | Ga0495587_0029447 | 3300046536 | Bacteria | 3333 |
| 195 | Ga0495645_0021836 | 3300046543 | Bacteria | 4627 |
| 196 | Ga0495645_0076679 | 3300046543 | Unclassified | 2404 |
| 197 | Ga0495659_0053390 | 3300046664 | Bacteria | 1477 |
| 198 | Ga0495658_0109630 | 3300046683 | Bacteria | 1658 |
| 199 | Ga0495669_0034542 | 3300046684 | Bacteria | 2229 |
| 200 | Ga0495613_0000688 | 3300046689 | Bacteria | 26725 |
| 201 | Ga0495613_0086301 | 3300046689 | Bacteria | 2276 |
| 202 | Ga0495613_0106507 | 3300046689 | Bacteria | 2023 |
| 203 | Ga0495604_0073985 | 3300047317 | Bacteria | 2569 |
| 204 | Ga0495674_0092964 | 3300047319 | Bacteria | 2574 |
| 205 | Ga0495684_0000601 | 3300047471 | Bacteria | 28931 |
| 206 | Ga0495684_0449812 | 3300047471 | Bacteria | 895 |
| 207 | Ga0496102_0426860 | 3300048905 | Bacteria | 1245 |
| 208 | Ga0496104_0100423 | 3300048907 | Bacteria | 2770 |
| 209 | Ga0496105_0154683 | 3300048908 | Bacteria | 1884 |
| 210 | Ga0496109_0115814 | 3300048912 | Bacteria | 2494 |
| 211 | Ga0496109_0700022 | 3300048912 | Unclassified | 951 |
| 212 | Ga0496110_0125694 | 3300048913 | Bacteria | 2314 |
| 213 | Ga0496112_0125575 | 3300048915 | Unclassified | 2537 |
| 214 | Ga0496112_0133070 | 3300048915 | Bacteria | 2457 |
| 215 | Ga0496114_0013207 | 3300048917 | Bacteria | 6620 |
| 216 | Ga0501034_0210348 | 3300049571 | Bacteria | 1900 |
| 217 | Ga0501047_0003215 | 3300049581 | Bacteria | 15490 |
| 218 | Ga0501044_0005224 | 3300049823 | Bacteria | 14450 |
| 219 | nmdc:mga05p37_102531_c1 | 3300050507 | Bacteria | 3524 |
| 220 | nmdc:mga05p37_1909_c1 | 3300050507 | Bacteria | 24257 |
| 221 | nmdc:mga05p37_2204_c1 | 3300050507 | Bacteria | 22685 |
| 222 | nmdc:mga05p37_48400_c1 | 3300050507 | Bacteria | 5229 |
| 223 | nmdc:mga09592_300089_c1 | 3300050508 | Unclassified | 1393 |
| 224 | nmdc:mga06r32_247995_c1 | 3300050510 | Bacteria | 1768 |
| 225 | nmdc:mga08y16_515213_c1 | 3300050511 | Bacteria | 1214 |
| 226 | nmdc:mga08y16_9897_c1 | 3300050511 | Bacteria | 10008 |
| 227 | nmdc:mga0n895_109_c1 | 3300050512 | Bacteria | 48376 |
| 228 | nmdc:mga0n895_197446_c1 | 3300050512 | Bacteria | 2043 |
| 229 | nmdc:mga0n895_199590_c1 | 3300050512 | Bacteria | 2032 |
| 230 | nmdc:mga0n895_99929_c1 | 3300050512 | Bacteria | 2910 |
| 231 | nmdc:mga0rr50_170301_c1 | 3300050513 | Unclassified | 1774 |
| 232 | nmdc:mga0rr50_187638_c1 | 3300050513 | Bacteria | 1693 |
| 233 | nmdc:mga0rr50_36_c1 | 3300050513 | Bacteria | 89726 |
| 234 | nmdc:mga08x19_223_c1 | 3300050514 | Bacteria | 43405 |
| 235 | nmdc:mga08x19_72915_c1 | 3300050514 | Bacteria | 2241 |
| 236 | nmdc:mga0a205_299256_c1 | 3300050515 | Bacteria | 1482 |
| 237 | nmdc:mga0a205_307909_c1 | 3300050515 | Bacteria | 1456 |
| 238 | nmdc:mga0a205_8291_c1 | 3300050515 | Bacteria | 7789 |
| 239 | Ga0495601_0043662 | 3300053077 | Unclassified | 2815 |
| 240 | Ga0495619_0000386 | 3300053085 | Bacteria | 30136 |
| 241 | Ga0495619_0016742 | 3300053085 | Bacteria | 4641 |
| 242 | Ga0495619_0017580 | 3300053085 | Bacteria | 4529 |
| 243 | Ga0590071_012663 | 3300059421 | Bacteria | 1976 |
| 244 | Ga0590071_016759 | 3300059421 | Unclassified | 1720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100218159 | Ga0068867_1002181592 | 244 |
| 2 | 3300005548 | Ga0070665_100022816 | Ga0070665_1000228161 | 244 |
| 3 | 3300006358 | Ga0068871_100001260 | Ga0068871_1000012604 | 244 |
| 4 | 3300009098 | Ga0105245_10135428 | Ga0105245_101354282 | 244 |
| 5 | 3300009176 | Ga0105242_10057808 | Ga0105242_100578083 | 244 |
| 6 | 3300013306 | Ga0163162_10083992 | Ga0163162_100839923 | 244 |
| 7 | 3300013308 | Ga0157375_10137914 | Ga0157375_101379143 | 244 |
| 8 | 3300014325 | Ga0163163_10185088 | Ga0163163_101850883 | 244 |
| 9 | 3300025907 | Ga0207645_10086376 | Ga0207645_100863762 | 244 |
| 10 | 3300025927 | Ga0207687_10008341 | Ga0207687_100083418 | 244 |
| 11 | 3300025938 | Ga0207704_10225316 | Ga0207704_102253162 | 244 |
| 12 | 3300026088 | Ga0207641_10401046 | Ga0207641_104010461 | 244 |
| 13 | 3300026089 | Ga0207648_10017949 | Ga0207648_100179493 | 244 |
| 14 | 3300035725 | Ga0373947_0182341 | Ga0373947_0182341_563_1327 | 254 |
| 15 | 3300026041 | Ga0207639_10304162 | Ga0207639_103041622 | 258 |
| 16 | 3300005563 | Ga0068855_100519367 | Ga0068855_1005193672 | 261 |
| 17 | 3300025949 | Ga0207667_10652643 | Ga0207667_106526431 | 261 |
| 18 | 3300005618 | Ga0068864_100090901 | Ga0068864_1000909013 | 264 |
| 19 | 3300011119 | Ga0105246_10531507 | Ga0105246_105315072 | 264 |
| 20 | 3300025910 | Ga0207684_10351874 | Ga0207684_103518742 | 264 |
| 21 | 3300025925 | Ga0207650_10114259 | Ga0207650_101142592 | 264 |
| 22 | 3300026095 | Ga0207676_10246055 | Ga0207676_102460552 | 264 |
| 23 | 3300035116 | Ga0373945_0020486 | Ga0373945_0020486_855_1667 | 264 |
| 24 | 3300035170 | Ga0373943_0002051 | Ga0373943_0002051_4468_5280 | 264 |
| 25 | 3300035171 | Ga0373946_0017104 | Ga0373946_0017104_633_1445 | 264 |
| 26 | 3300035172 | Ga0373955_0006747 | Ga0373955_0006747_4313_5125 | 264 |
| 27 | 3300035410 | Ga0373924_0008462 | Ga0373924_0008462_136_948 | 264 |
| 28 | 3300035692 | Ga0373935_0008720 | Ga0373935_0008720_3447_4259 | 264 |
| 29 | 3300035724 | Ga0373933_0088700 | Ga0373933_0088700_1032_1844 | 264 |
| 30 | 3300035725 | Ga0373947_0142649 | Ga0373947_0142649_609_1421 | 264 |
| 31 | 3300036401 | Ga0373937_0258764 | Ga0373937_0258764_16_828 | 264 |
| 32 | 3300037068 | Ga0373925_0009773 | Ga0373925_0009773_5810_6622 | 264 |
| 33 | 3300046664 | Ga0495659_0053390 | Ga0495659_0053390_512_1324 | 264 |
| 34 | 3300046689 | Ga0495613_0086301 | Ga0495613_0086301_67_879 | 264 |
| 35 | 3300047471 | Ga0495684_0449812 | Ga0495684_0449812_53_865 | 264 |
| 36 | 3300032002 | Ga0307416_100444256 | Ga0307416_1004442562 | 268 |
| 37 | 3300048905 | Ga0496102_0426860 | Ga0496102_0426860_302_1147 | 268 |
| 38 | 3300059421 | Ga0590071_012663 | Ga0590071_012663_249_1082 | 268 |
| 39 | 3300014969 | Ga0157376_10036125 | Ga0157376_100361252 | 269 |
| 40 | 3300046683 | Ga0495658_0109630 | Ga0495658_0109630_197_1048 | 269 |
| 41 | 3300046689 | Ga0495613_0106507 | Ga0495613_0106507_1104_1973 | 269 |
| 42 | 3300005364 | Ga0070673_100009257 | Ga0070673_1000092574 | 270 |
| 43 | 3300005458 | Ga0070681_10338216 | Ga0070681_103382162 | 270 |
| 44 | 3300006871 | Ga0075434_100000505 | Ga0075434_1000005057 | 270 |
| 45 | 3300006914 | Ga0075436_100001003 | Ga0075436_10000100312 | 270 |
| 46 | 3300007076 | Ga0075435_100000129 | Ga0075435_10000012929 | 270 |
| 47 | 3300009094 | Ga0111539_10548321 | Ga0111539_105483212 | 270 |
| 48 | 3300009177 | Ga0105248_10335250 | Ga0105248_103352502 | 270 |
| 49 | 3300021384 | Ga0213876_10079171 | Ga0213876_100791712 | 270 |
| 50 | 3300025903 | Ga0207680_10170520 | Ga0207680_101705202 | 270 |
| 51 | 3300025912 | Ga0207707_10301867 | Ga0207707_103018672 | 270 |
| 52 | 3300025933 | Ga0207706_10429761 | Ga0207706_104297611 | 270 |
| 53 | 3300025960 | Ga0207651_10168158 | Ga0207651_101681581 | 270 |
| 54 | 3300025981 | Ga0207640_10421711 | Ga0207640_104217112 | 270 |
| 55 | 3300026035 | Ga0207703_10059702 | Ga0207703_100597024 | 270 |
| 56 | 3300039437 | Ga0436365_1087440 | Ga0436365_1087440_1661_2479 | 270 |
| 57 | 3300050511 | nmdc:mga08y16_515213_c1 | nmdc:mga08y16_515213_c1_268_1098 | 270 |
| 58 | 3300059421 | Ga0590071_016759 | Ga0590071_016759_65_895 | 270 |
| 59 | 3300005456 | Ga0070678_100119762 | Ga0070678_1001197622 | 271 |
| 60 | 3300006237 | Ga0097621_100047805 | Ga0097621_1000478053 | 271 |
| 61 | 3300006358 | Ga0068871_100108461 | Ga0068871_1001084613 | 271 |
| 62 | 3300006871 | Ga0075434_100012294 | Ga0075434_1000122946 | 271 |
| 63 | 3300006871 | Ga0075434_100061083 | Ga0075434_1000610833 | 271 |
| 64 | 3300007076 | Ga0075435_100032243 | Ga0075435_1000322435 | 271 |
| 65 | 3300009098 | Ga0105245_10076307 | Ga0105245_100763071 | 271 |
| 66 | 3300013297 | Ga0157378_10010006 | Ga0157378_1001000610 | 271 |
| 67 | 3300026035 | Ga0207703_10268141 | Ga0207703_102681412 | 271 |
| 68 | 3300026118 | Ga0207675_100131805 | Ga0207675_1001318052 | 271 |
| 69 | 3300026121 | Ga0207683_10144496 | Ga0207683_101444963 | 271 |
| 70 | 3300035724 | Ga0373933_0199137 | Ga0373933_0199137_92_937 | 271 |
| 71 | 3300036401 | Ga0373937_0088432 | Ga0373937_0088432_595_1440 | 271 |
| 72 | 3300046533 | Ga0495640_0109976 | Ga0495640_0109976_884_1729 | 271 |
| 73 | 3300046535 | Ga0495586_0075604 | Ga0495586_0075604_560_1405 | 271 |
| 74 | 3300046543 | Ga0495645_0021836 | Ga0495645_0021836_1541_2386 | 271 |
| 75 | 3300050512 | nmdc:mga0n895_99929_c1 | nmdc:mga0n895_99929_c1_648_1496 | 271 |
| 76 | 3300050514 | nmdc:mga08x19_72915_c1 | nmdc:mga08x19_72915_c1_238_1086 | 271 |
| 77 | 3300053085 | Ga0495619_0017580 | Ga0495619_0017580_2157_3002 | 271 |
| 78 | 3300005335 | Ga0070666_10007203 | Ga0070666_100072035 | 272 |
| 79 | 3300005343 | Ga0070687_100072813 | Ga0070687_1000728131 | 272 |
| 80 | 3300005353 | Ga0070669_100012905 | Ga0070669_1000129053 | 272 |
| 81 | 3300005355 | Ga0070671_100108764 | Ga0070671_1001087642 | 272 |
| 82 | 3300005364 | Ga0070673_100666811 | Ga0070673_1006668111 | 272 |
| 83 | 3300005445 | Ga0070708_100393550 | Ga0070708_1003935502 | 272 |
| 84 | 3300005459 | Ga0068867_100451798 | Ga0068867_1004517981 | 272 |
| 85 | 3300005471 | Ga0070698_100264179 | Ga0070698_1002641791 | 272 |
| 86 | 3300005530 | Ga0070679_100276833 | Ga0070679_1002768332 | 272 |
| 87 | 3300005544 | Ga0070686_100001050 | Ga0070686_10000105013 | 272 |
| 88 | 3300005563 | Ga0068855_100221893 | Ga0068855_1002218933 | 272 |
| 89 | 3300005578 | Ga0068854_100010917 | Ga0068854_1000109174 | 272 |
| 90 | 3300005841 | Ga0068863_100019394 | Ga0068863_1000193948 | 272 |
| 91 | 3300005843 | Ga0068860_100146557 | Ga0068860_1001465573 | 272 |
| 92 | 3300005843 | Ga0068860_100233122 | Ga0068860_1002331221 | 272 |
| 93 | 3300005843 | Ga0068860_100811432 | Ga0068860_1008114321 | 272 |
| 94 | 3300006844 | Ga0075428_100027444 | Ga0075428_1000274448 | 272 |
| 95 | 3300006852 | Ga0075433_10017098 | Ga0075433_100170985 | 272 |
| 96 | 3300006871 | Ga0075434_100045659 | Ga0075434_1000456593 | 272 |
| 97 | 3300006871 | Ga0075434_100117131 | Ga0075434_1001171312 | 272 |
| 98 | 3300006871 | Ga0075434_100528845 | Ga0075434_1005288451 | 272 |
| 99 | 3300006914 | Ga0075436_100015009 | Ga0075436_1000150094 | 272 |
| 100 | 3300006914 | Ga0075436_100054813 | Ga0075436_1000548132 | 272 |
| 101 | 3300007076 | Ga0075435_100012127 | Ga0075435_10001212710 | 272 |
| 102 | 3300007076 | Ga0075435_100127962 | Ga0075435_1001279623 | 272 |
| 103 | 3300009094 | Ga0111539_10057320 | Ga0111539_100573203 | 272 |
| 104 | 3300009147 | Ga0114129_10101698 | Ga0114129_101016984 | 272 |
| 105 | 3300009147 | Ga0114129_10205119 | Ga0114129_102051193 | 272 |
| 106 | 3300009177 | Ga0105248_10017587 | Ga0105248_100175878 | 272 |
| 107 | 3300009177 | Ga0105248_10060725 | Ga0105248_100607253 | 272 |
| 108 | 3300009177 | Ga0105248_10133609 | Ga0105248_101336093 | 272 |
| 109 | 3300009177 | Ga0105248_10498951 | Ga0105248_104989511 | 272 |
| 110 | 3300013306 | Ga0163162_10017441 | Ga0163162_100174412 | 272 |
| 111 | 3300014326 | Ga0157380_10297927 | Ga0157380_102979271 | 272 |
| 112 | 3300014968 | Ga0157379_10018670 | Ga0157379_100186706 | 272 |
| 113 | 3300025918 | Ga0207662_10013380 | Ga0207662_100133803 | 272 |
| 114 | 3300025923 | Ga0207681_10003393 | Ga0207681_1000339310 | 272 |
| 115 | 3300025931 | Ga0207644_10002532 | Ga0207644_100025323 | 272 |
| 116 | 3300025933 | Ga0207706_10508592 | Ga0207706_105085921 | 272 |
| 117 | 3300025940 | Ga0207691_10061359 | Ga0207691_100613592 | 272 |
| 118 | 3300025941 | Ga0207711_10149950 | Ga0207711_101499503 | 272 |
| 119 | 3300025960 | Ga0207651_10073513 | Ga0207651_100735133 | 272 |
| 120 | 3300025960 | Ga0207651_10334489 | Ga0207651_103344892 | 272 |
| 121 | 3300025981 | Ga0207640_10038610 | Ga0207640_100386103 | 272 |
| 122 | 3300026075 | Ga0207708_10131599 | Ga0207708_101315992 | 272 |
| 123 | 3300026088 | Ga0207641_10002052 | Ga0207641_1000205216 | 272 |
| 124 | 3300026088 | Ga0207641_10463662 | Ga0207641_104636622 | 272 |
| 125 | 3300026118 | Ga0207675_100624251 | Ga0207675_1006242511 | 272 |
| 126 | 3300026121 | Ga0207683_10249132 | Ga0207683_102491322 | 272 |
| 127 | 3300026142 | Ga0207698_10305614 | Ga0207698_103056141 | 272 |
| 128 | 3300027907 | Ga0207428_10406444 | Ga0207428_104064441 | 272 |
| 129 | 3300028379 | Ga0268266_10012166 | Ga0268266_100121662 | 272 |
| 130 | 3300028380 | Ga0268265_10004373 | Ga0268265_100043734 | 272 |
| 131 | 3300028381 | Ga0268264_10034126 | Ga0268264_100341264 | 272 |
| 132 | 3300028381 | Ga0268264_10214974 | Ga0268264_102149741 | 272 |
| 133 | 3300035242 | Ga0373962_0073389 | Ga0373962_0073389_50_871 | 272 |
| 134 | 3300048912 | Ga0496109_0115814 | Ga0496109_0115814_969_1790 | 272 |
| 135 | 3300048913 | Ga0496110_0125694 | Ga0496110_0125694_1223_2044 | 272 |
| 136 | 3300050507 | nmdc:mga05p37_102531_c1 | nmdc:mga05p37_102531_c1_568_1389 | 272 |
| 137 | 3300050507 | nmdc:mga05p37_1909_c1 | nmdc:mga05p37_1909_c1_12797_13681 | 272 |
| 138 | 3300050507 | nmdc:mga05p37_2204_c1 | nmdc:mga05p37_2204_c1_1374_2204 | 272 |
| 139 | 3300050508 | nmdc:mga09592_300089_c1 | nmdc:mga09592_300089_c1_36_866 | 272 |
| 140 | 3300050510 | nmdc:mga06r32_247995_c1 | nmdc:mga06r32_247995_c1_177_1004 | 272 |
| 141 | 3300050511 | nmdc:mga08y16_9897_c1 | nmdc:mga08y16_9897_c1_2801_3622 | 272 |
| 142 | 3300050512 | nmdc:mga0n895_109_c1 | nmdc:mga0n895_109_c1_30813_31661 | 272 |
| 143 | 3300050512 | nmdc:mga0n895_199590_c1 | nmdc:mga0n895_199590_c1_164_985 | 272 |
| 144 | 3300050513 | nmdc:mga0rr50_170301_c1 | nmdc:mga0rr50_170301_c1_638_1465 | 272 |
| 145 | 3300050513 | nmdc:mga0rr50_187638_c1 | nmdc:mga0rr50_187638_c1_129_956 | 272 |
| 146 | 3300050513 | nmdc:mga0rr50_36_c1 | nmdc:mga0rr50_36_c1_54544_55392 | 272 |
| 147 | 3300050514 | nmdc:mga08x19_223_c1 | nmdc:mga08x19_223_c1_17023_17871 | 272 |
| 148 | 3300050515 | nmdc:mga0a205_307909_c1 | nmdc:mga0a205_307909_c1_55_888 | 272 |
| 149 | 3300050515 | nmdc:mga0a205_8291_c1 | nmdc:mga0a205_8291_c1_4775_5596 | 272 |
| 150 | 3300005347 | Ga0070668_100261429 | Ga0070668_1002614292 | 273 |
| 151 | 3300005356 | Ga0070674_100002747 | Ga0070674_1000027479 | 273 |
| 152 | 3300005459 | Ga0068867_100031902 | Ga0068867_1000319025 | 273 |
| 153 | 3300005536 | Ga0070697_100049694 | Ga0070697_1000496943 | 273 |
| 154 | 3300005546 | Ga0070696_100034174 | Ga0070696_1000341744 | 273 |
| 155 | 3300005548 | Ga0070665_100107786 | Ga0070665_1001077863 | 273 |
| 156 | 3300005617 | Ga0068859_100247883 | Ga0068859_1002478833 | 273 |
| 157 | 3300005617 | Ga0068859_100615671 | Ga0068859_1006156711 | 273 |
| 158 | 3300005842 | Ga0068858_100033393 | Ga0068858_1000333933 | 273 |
| 159 | 3300005843 | Ga0068860_100546425 | Ga0068860_1005464252 | 273 |
| 160 | 3300006237 | Ga0097621_100176367 | Ga0097621_1001763672 | 273 |
| 161 | 3300006844 | Ga0075428_100492487 | Ga0075428_1004924872 | 273 |
| 162 | 3300006852 | Ga0075433_10308095 | Ga0075433_103080952 | 273 |
| 163 | 3300006871 | Ga0075434_100165444 | Ga0075434_1001654442 | 273 |
| 164 | 3300006871 | Ga0075434_100224716 | Ga0075434_1002247162 | 273 |
| 165 | 3300006881 | Ga0068865_100466827 | Ga0068865_1004668272 | 273 |
| 166 | 3300006931 | Ga0097620_100247872 | Ga0097620_1002478723 | 273 |
| 167 | 3300006931 | Ga0097620_100615687 | Ga0097620_1006156871 | 273 |
| 168 | 3300007076 | Ga0075435_100027379 | Ga0075435_1000273795 | 273 |
| 169 | 3300009098 | Ga0105245_10015807 | Ga0105245_100158074 | 273 |
| 170 | 3300009147 | Ga0114129_10027029 | Ga0114129_100270295 | 273 |
| 171 | 3300009148 | Ga0105243_10098774 | Ga0105243_100987743 | 273 |
| 172 | 3300009176 | Ga0105242_10013301 | Ga0105242_100133013 | 273 |
| 173 | 3300009176 | Ga0105242_10145952 | Ga0105242_101459523 | 273 |
| 174 | 3300009176 | Ga0105242_10241414 | Ga0105242_102414141 | 273 |
| 175 | 3300009553 | Ga0105249_10548294 | Ga0105249_105482942 | 273 |
| 176 | 3300013296 | Ga0157374_10019334 | Ga0157374_100193347 | 273 |
| 177 | 3300013306 | Ga0163162_10156549 | Ga0163162_101565492 | 273 |
| 178 | 3300014325 | Ga0163163_10241693 | Ga0163163_102416932 | 273 |
| 179 | 3300014325 | Ga0163163_10244435 | Ga0163163_102444352 | 273 |
| 180 | 3300014969 | Ga0157376_10314813 | Ga0157376_103148132 | 273 |
| 181 | 3300025899 | Ga0207642_10039455 | Ga0207642_100394553 | 273 |
| 182 | 3300025927 | Ga0207687_10019716 | Ga0207687_100197164 | 273 |
| 183 | 3300025934 | Ga0207686_10057561 | Ga0207686_100575611 | 273 |
| 184 | 3300025934 | Ga0207686_10346122 | Ga0207686_103461221 | 273 |
| 185 | 3300025972 | Ga0207668_10128092 | Ga0207668_101280922 | 273 |
| 186 | 3300026035 | Ga0207703_10006395 | Ga0207703_100063955 | 273 |
| 187 | 3300026075 | Ga0207708_10075272 | Ga0207708_100752723 | 273 |
| 188 | 3300026089 | Ga0207648_10049297 | Ga0207648_100492974 | 273 |
| 189 | 3300028379 | Ga0268266_10092503 | Ga0268266_100925033 | 273 |
| 190 | 3300035111 | Ga0373923_0108915 | Ga0373923_0108915_213_1067 | 273 |
| 191 | 3300035117 | Ga0373953_0115694 | Ga0373953_0115694_247_1101 | 273 |
| 192 | 3300035410 | Ga0373924_0009031 | Ga0373924_0009031_1807_2661 | 273 |
| 193 | 3300045051 | Ga0451576_0629102 | Ga0451576_0629102_99_947 | 273 |
| 194 | 3300046454 | Ga0495592_0009245 | Ga0495592_0009245_1059_1913 | 273 |
| 195 | 3300046472 | Ga0495580_0117242 | Ga0495580_0117242_792_1646 | 273 |
| 196 | 3300046473 | Ga0495582_0117543 | Ga0495582_0117543_621_1475 | 273 |
| 197 | 3300046511 | Ga0495608_0021975 | Ga0495608_0021975_196_1050 | 273 |
| 198 | 3300046516 | Ga0495628_0048543 | Ga0495628_0048543_370_1224 | 273 |
| 199 | 3300046517 | Ga0495630_0130254 | Ga0495630_0130254_912_1766 | 273 |
| 200 | 3300046533 | Ga0495640_0026520 | Ga0495640_0026520_133_987 | 273 |
| 201 | 3300046536 | Ga0495587_0029447 | Ga0495587_0029447_261_1115 | 273 |
| 202 | 3300046543 | Ga0495645_0076679 | Ga0495645_0076679_892_1746 | 273 |
| 203 | 3300046684 | Ga0495669_0034542 | Ga0495669_0034542_871_1782 | 273 |
| 204 | 3300046689 | Ga0495613_0000688 | Ga0495613_0000688_22987_23841 | 273 |
| 205 | 3300047317 | Ga0495604_0073985 | Ga0495604_0073985_330_1184 | 273 |
| 206 | 3300047319 | Ga0495674_0092964 | Ga0495674_0092964_1570_2424 | 273 |
| 207 | 3300047471 | Ga0495684_0000601 | Ga0495684_0000601_8989_9843 | 273 |
| 208 | 3300048907 | Ga0496104_0100423 | Ga0496104_0100423_1259_2203 | 273 |
| 209 | 3300048917 | Ga0496114_0013207 | Ga0496114_0013207_1581_2525 | 273 |
| 210 | 3300050507 | nmdc:mga05p37_48400_c1 | nmdc:mga05p37_48400_c1_358_1197 | 273 |
| 211 | 3300050512 | nmdc:mga0n895_197446_c1 | nmdc:mga0n895_197446_c1_759_1589 | 273 |
| 212 | 3300050515 | nmdc:mga0a205_299256_c1 | nmdc:mga0a205_299256_c1_309_1148 | 273 |
| 213 | 3300053077 | Ga0495601_0043662 | Ga0495601_0043662_1707_2561 | 273 |
| 214 | 3300053085 | Ga0495619_0000386 | Ga0495619_0000386_17844_18698 | 273 |
| 215 | 3300053085 | Ga0495619_0016742 | Ga0495619_0016742_1256_2110 | 273 |
| 216 | 3300005336 | Ga0070680_100081509 | Ga0070680_1000815092 | 274 |
| 217 | 3300005364 | Ga0070673_100255466 | Ga0070673_1002554661 | 274 |
| 218 | 3300005439 | Ga0070711_100051276 | Ga0070711_1000512763 | 274 |
| 219 | 3300005458 | Ga0070681_10012776 | Ga0070681_100127766 | 274 |
| 220 | 3300005564 | Ga0070664_100283360 | Ga0070664_1002833602 | 274 |
| 221 | 3300005617 | Ga0068859_100186517 | Ga0068859_1001865174 | 274 |
| 222 | 3300005618 | Ga0068864_100011489 | Ga0068864_1000114894 | 274 |
| 223 | 3300006931 | Ga0097620_100186520 | Ga0097620_1001865204 | 274 |
| 224 | 3300009177 | Ga0105248_10457870 | Ga0105248_104578703 | 274 |
| 225 | 3300009177 | Ga0105248_10588941 | Ga0105248_105889411 | 274 |
| 226 | 3300025912 | Ga0207707_10017266 | Ga0207707_100172663 | 274 |
| 227 | 3300025923 | Ga0207681_10209125 | Ga0207681_102091252 | 274 |
| 228 | 3300025926 | Ga0207659_10075073 | Ga0207659_100750733 | 274 |
| 229 | 3300025941 | Ga0207711_10309755 | Ga0207711_103097551 | 274 |
| 230 | 3300026116 | Ga0207674_10612334 | Ga0207674_106123342 | 274 |
| 231 | 3300026121 | Ga0207683_10016232 | Ga0207683_100162328 | 274 |
| 232 | 3300036401 | Ga0373937_0058415 | Ga0373937_0058415_921_1745 | 274 |
| 233 | 3300036401 | Ga0373937_0282986 | Ga0373937_0282986_174_998 | 274 |
| 234 | 3300048908 | Ga0496105_0154683 | Ga0496105_0154683_477_1301 | 274 |
| 235 | 3300048912 | Ga0496109_0700022 | Ga0496109_0700022_22_849 | 274 |
| 236 | 3300048915 | Ga0496112_0125575 | Ga0496112_0125575_79_903 | 274 |
| 237 | 3300048915 | Ga0496112_0133070 | Ga0496112_0133070_1174_1998 | 274 |
| 238 | 3300049571 | Ga0501034_0210348 | Ga0501034_0210348_72_902 | 274 |
| 239 | 3300049581 | Ga0501047_0003215 | Ga0501047_0003215_7140_7970 | 274 |
| 240 | 3300049823 | Ga0501044_0005224 | Ga0501044_0005224_7118_7948 | 274 |
| 241 | 3300005290 | Ga0065712_10074244 | Ga0065712_100742445 | 275 |
| 242 | 3300014968 | Ga0157379_10370497 | Ga0157379_103704972 | 275 |
| 243 | 3300014969 | Ga0157376_10065836 | Ga0157376_100658362 | 275 |
| 244 | 3300025960 | Ga0207651_10250966 | Ga0207651_102509663 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m8h-assembly4.cif.gz_D | structure of memo1 c244s metal binding site mutant at 1.75a | 0.8919 | 5 | 273 |
| 3bcz-assembly1.cif.gz_A | crystal structure of memo | 0.8864 | 5 | 273 |
| 7m8h-assembly4.cif.gz_D | structure of memo1 c244s metal binding site mutant at 1.75a | 0.8704 | 5 | 273 |
| 3bcz-assembly1.cif.gz_A | crystal structure of memo | 0.8649 | 5 | 273 |
| 3vsh-assembly1.cif.gz_C | crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase | 0.7249 | 42 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57846_3_287_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9287 | 4 | 272 | 3.40.830.10 |
| af_Q57846_3_287_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9058 | 4 | 272 | 3.40.830.10 |
| af_Q54NZ1_1_286_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9054 | 5 | 271 | 3.40.830.10 |
| af_Q9VG04_2_293_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.901 | 4 | 272 | 3.40.830.10 |
| af_C0H4B1_3_295_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8797 | 4 | 273 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7VG98-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.9874 | 72 | 275 |
|
| AF-A0A2V8I8D3-F1-model_v4 | MEMO1 family protein DMF87_04745 | 0.9873 | 1 | 272 |
|
| AF-A0A353BHY1-F1-model_v4 | AMMECR1 domain-containing protein | 0.9819 | 2 | 275 |
|
| AF-A0A2V8GCP8-F1-model_v4 | MEMO1 family protein DMF91_10985 | 0.9802 | 1 | 274 |
GO:0005978
GO:0008878 |
| AF-A0A523DD88-F1-model_v4 | MEMO1 family protein E2P06_14390 | 0.9797 | 1 | 272 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar