F355814

General Info

Members Datasets Scaffolds Average Seq Length
243 221 486 104

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_0427356|Ga0451837_0427356_33_551
Length 132
Sequence MRIRRHIATAASVTFLTLALAPAAHASGSSMPWEAPLQAILESIEGPVAKIVTGLTLAFGDTSGGFRRLIQIVFGLSITMTSRAYASGAGMPWEQTGLTLAFGDTSGGFRRLIQAASSFFLSFFSFGGGALI

Samples

Sample ID Description Type Environment
1 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
78 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
115 2512875024
116 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
117 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
118 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
119 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
120 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
121 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
122 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
123 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
124 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
125 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
126 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
127 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
128 2643221558 Rhizobium sp. Root149 Isolate Unclassified
129 2643221568 Rhizobium sp. Root564 Isolate Unclassified
130 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
131 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
132 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
133 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
134 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
135 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
136 2773857925 Microvirga vignae BR3299 Isolate Unclassified
137 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
138 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
139 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
140 2802429634 Rhizobium anhuiense S10 Isolate Nodule
141 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
142 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
143 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
144 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
145 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
146 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
147 2842694124 Methylopila sp. R-72369 Isolate Unclassified
148 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
149 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
150 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
151 2854911287 Brucella lupini LUP21 Isolate Unclassified
152 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
153 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
154 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
155 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
156 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
157 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
158 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
159 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
160 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
161 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
162 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
163 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
164 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
165 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
166 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
167 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
168 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
169 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
170 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
171 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
172 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
173 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
174 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
175 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
176 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
177 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
178 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
179 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
180 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
181 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
182 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
183 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
184 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
185 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
186 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
187 2936381700 Rhizobium chutanense C16 Isolate Unclassified
188 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
189 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
190 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
191 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
192 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
193 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
194 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
195 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
196 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
197 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
198 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
199 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
200 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
201 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
202 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
203 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
204 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
205 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
206 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
207 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
208 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
209 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
210 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
211 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
212 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
213 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
214 3004167301 Mesorhizobium loti 582 Isolate Unclassified
215 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
216 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
217 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
218 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
219 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
220 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
221 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 51.03
Metatranscriptomes 0
Isolates 48.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 32.1
Rhizoplane 3.7
Rhizosphere 34.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451837_0427356 3300041494 Bacteria 641
2 JGI24740J21852_10029363 3300001979 Bacteria 1806
3 JGI24739J22299_10007208 3300001989 Bacteria 4181
4 JGI25152J39213_1000350 3300002773 Bacteria 28963
5 JGI25150J39212_1000040 3300002774 Bacteria 84981
6 JGI25151J46595_10000152 3300003187 Bacteria 90443
7 JGI25153J46596_10001799 3300003215 Bacteria 12714
8 Ga0055542_1000557 3300003762 Bacteria 32931
9 Ga0055529_1006536 3300003763 Bacteria 1626
10 JGI25405J52794_10004874 3300003911 Bacteria 2405
11 JGI25405J52794_10049593 3300003911 Bacteria 898
12 Ga0065704_10070267 3300005289 Bacteria 43544
13 Ga0070658_10313862 3300005327 Bacteria 1338
14 Ga0070660_100406558 3300005339 Bacteria 1126
15 Ga0070675_101168365 3300005354 Bacteria 708
16 Ga0070671_101670808 3300005355 Bacteria 565
17 Ga0070667_100000265 3300005367 Bacteria 59228
18 Ga0070700_101584285 3300005441 Bacteria 559
19 Ga0070693_100220558 3300005547 Bacteria 1242
20 Ga0068854_100504955 3300005578 Bacteria 1019
21 Ga0081455_10021584 3300005937 Bacteria 6036
22 Ga0075365_10032324 3300006038 Bacteria 3362
23 Ga0075368_10019358 3300006042 Bacteria 2569
24 Ga0075363_100009686 3300006048 Bacteria 4537
25 Ga0075364_10065974 3300006051 Bacteria 2377
26 Ga0075367_10011187 3300006178 Bacteria 4737
27 Ga0099826_10000056 3300006948 Bacteria 70004
28 Ga0099794_10069323 3300007265 Bacteria 1725
29 Ga0105240_10202949 3300009093 Bacteria 2322
30 Ga0105240_11317603 3300009093 Bacteria 761
31 Ga0105241_10330235 3300009174 Bacteria 1318
32 Ga0105237_11699599 3300009545 Bacteria 638
33 Ga0105237_12785794 3300009545 Bacteria 500
34 Ga0105238_10056740 3300009551 Bacteria 3928
35 Ga0105033_101416 3300009986 Bacteria 1959
36 Ga0105239_10033143 3300010375 Bacteria 5673
37 Ga0105246_10738613 3300011119 Bacteria 867
38 Ga0157373_10154387 3300013100 Bacteria 1615
39 Ga0157371_10000346 3300013102 Bacteria 59564
40 Ga0157370_10128156 3300013104 Bacteria 2368
41 Ga0157374_10554801 3300013296 Bacteria 1157
42 Ga0163162_10152794 3300013306 Bacteria 2427
43 Ga0163162_11851734 3300013306 Bacteria 690
44 Ga0163163_12734531 3300014325 Bacteria 550
45 Ga0213874_10282916 3300021377 Bacteria 620
46 Ga0213876_10000708 3300021384 Bacteria 23398
47 Ga0207425_1000046 3300025245 Bacteria 189433
48 Ga0209026_1003473 3300025250 Bacteria 5132
49 Ga0209026_1064662 3300025250 Bacteria 512
50 Ga0209677_116697 3300025253 Bacteria 933
51 Ga0209148_1000126 3300025254 Bacteria 181590
52 Ga0209129_1000170 3300025258 Bacteria 95792
53 Ga0209455_1000280 3300025272 Bacteria 55431
54 Ga0209025_1000137 3300025294 Bacteria 190136
55 Ga0209758_1000123 3300025297 Bacteria 190136
56 Ga0207705_10119611 3300025909 Bacteria 1953
57 Ga0207654_10892249 3300025911 Bacteria 644
58 Ga0207695_10211799 3300025913 Bacteria 1848
59 Ga0207695_10604168 3300025913 Bacteria 978
60 Ga0207657_10298207 3300025919 Bacteria 1277
61 Ga0207649_11203608 3300025920 Bacteria 599
62 Ga0207694_10267611 3300025924 Bacteria 1401
63 Ga0207690_10740398 3300025932 Bacteria 810
64 Ga0207661_11457239 3300025944 Bacteria 628
65 Ga0207640_11200196 3300025981 Bacteria 674
66 Ga0207658_10000703 3300025986 Bacteria 29036
67 Ga0207639_10014746 3300026041 Bacteria 5505
68 Ga0207678_10598074 3300026067 Bacteria 967
69 Ga0207708_11533678 3300026075 Bacteria 585
70 Ga0207648_11916728 3300026089 Bacteria 554
71 Ga0207676_10847747 3300026095 Bacteria 894
72 Ga0207683_10499690 3300026121 Bacteria 1123
73 Ga0207683_10591473 3300026121 Bacteria 1027
74 Ga0209282_1000084 3300027666 Bacteria 70012
75 Ga0209282_1337167 3300027666 Bacteria 623
76 Ga0209588_1037486 3300027671 Bacteria 1560
77 Ga0209813_10072571 3300027866 Bacteria 1122
78 Ga0265338_10322695 3300028800 Bacteria 1117
79 Ga0265328_10000098 3300031239 Bacteria 42728
80 Ga0307516_10732747 3300031730 Bacteria 647
81 Ga0307405_10165169 3300031731 Bacteria 1573
82 Ga0307406_10096536 3300031901 Bacteria 2003
83 Ga0315914_1000129 3300031967 Bacteria 70013
84 Ga0307510_10462328 3300033180 Bacteria 710
85 Ga0315913_1000034 3300033430 Bacteria 70013
86 Ga0315915_1000066 3300033464 Bacteria 70010
87 Ga0395899_0000059 3300037312 Bacteria 213004
88 Ga0395900_0184311 3300037418 Bacteria 2119
89 Ga0395898_0310004 3300037466 Bacteria 1505
90 Ga0436365_1540873 3300039437 Bacteria 18330
91 Ga0436363_0474942 3300039450 Bacteria 810
92 Ga0436362_1183220 3300039453 Bacteria 2489
93 Ga0439436_0001686 3300041404 Bacteria 6462
94 Ga0495603_0370127 3300046455 Bacteria 822
95 Ga0495628_0863703 3300046516 Bacteria 630
96 Ga0495632_0140854 3300046519 Bacteria 1119
97 Ga0496105_0211950 3300048908 Bacteria 1579
98 Ga0496106_0308296 3300048909 Bacteria 1270
99 Ga0496107_0052424 3300048910 Bacteria 2943
100 Ga0496109_1397689 3300048912 Bacteria 635
101 Ga0496114_1054983 3300048917 Bacteria 697
102 Ga0496116_0000026 3300048919 Bacteria 450803
103 Ga0496116_0031558 3300048919 Bacteria 3791
104 Ga0496118_0080472 3300048921 Bacteria 2293
105 Ga0496119_0044477 3300048922 Bacteria 2795
106 Ga0496119_0145636 3300048922 Bacteria 1275
107 Ga0496120_0147901 3300048923 Bacteria 1184
108 Ga0496124_0033898 3300048927 Bacteria 4488
109 Ga0496124_0453472 3300048927 Bacteria 874
110 Ga0496125_0002059 3300048928 Bacteria 27177
111 Ga0496126_0531285 3300048929 Bacteria 936
112 Ga0501032_0112590 3300049569 Bacteria 1800
113 Ga0501047_0061904 3300049581 Bacteria 3611
114 Ga0501048_0130775 3300049582 Bacteria 1775
115 Ga0501198_039898 3300049649 Bacteria 810
116 Ga0501044_0422043 3300049823 Bacteria 1244
117 nmdc:mga03n38_13425_c1 3300050490 Bacteria 3111
118 nmdc:mga00v17_36982_c1 3300050491 Bacteria 2912
119 nmdc:mga0yw44_446_c1 3300050492 Bacteria 14563
120 nmdc:mga06z11_5260_c2 3300050494 Bacteria 2482
121 nmdc:mga04h51_31408_c1 3300050495 Bacteria 1678
122 Ga0495601_0415718 3300053077 Bacteria 871
123 Ga0500554_112970 3300053102 Bacteria 914
124 Ga0500559_0001889 3300053136 Bacteria 11368
125 2511390573 2511231027 Bacteria 5013807
126 2512963709 2512875024 Bacteria 7195110
127 2513593818 2513237087 Bacteria 5817514
128 2513595437 2513237088 Bacteria 6927906
129 2514037567 2513237164 Bacteria 7563725
130 2514590850 2513237351 Bacteria 6968952
131 2585260870 2582581305 Bacteria 4895574
132 2585281065 2582581308 Bacteria 7413247
133 2585547037 2585427529 Bacteria 7395659
134 2599718863 2599185236 Bacteria 6875203
135 2599936044 2599185301 Bacteria 6161860
136 2601611344 2600255279 Bacteria 5605316
137 2601748235 2600255308 Bacteria 5611129
138 2616556371 2615840698 Bacteria 7319877
139 2643813530 2643221558 Bacteria 5460675
140 2643855173 2643221568 Bacteria 5187270
141 2643905779 2643221579 Bacteria 4443405
142 2643985674 2643221595 Bacteria 6565519
143 2644129038 2643221623 Bacteria 5239945
144 2756676829 2756170246 Bacteria 7451806
145 2757572209 2757320392 Bacteria 3737298
146 2758639481 2758568016 Bacteria 5645291
147 2774872000 2773857925 Bacteria 6472445
148 2776913405 2775507049 Bacteria 6284736
149 2792583308 2791355082 Bacteria 5973319
150 2792748469 2791355123 Bacteria 8049106
151 2806053748 2802429634 Bacteria 7083200
152 2806060948 2802429635 Bacteria 7650140
153 2806066743 2802429636 Bacteria 7597525
154 2809062768 2808606401 Bacteria 4586670
155 2809078548 2808606404 Bacteria 4652788
156 2809083157 2808606405 Bacteria 4586632
157 2834581053 2834578030 Bacteria 3530182
158 2842694432 2842694124 Bacteria 4063419
159 2844004406 2844002411 Bacteria 7168230
160 2852655673 2852653556 Bacteria 4050083
161 2854900731 2854896431 Bacteria 5869725
162 2854913169 2854911287 Bacteria 5582813
163 2856343088 2856342000 Bacteria 7176905
164 2856359465 2856356410 Bacteria 6297484
165 2857355782 2857349434 Bacteria 7926032
166 2869257518 2869256925 Bacteria 6981691
167 2871457613 2871451962 Bacteria 7336357
168 2871491812 2871488783 Bacteria 6929816
169 2874104621 2874102143 Bacteria 6342645
170 2874139697 2874139085 Bacteria 7021506
171 2874171284 2874168670 Bacteria 8062617
172 2874173245 2874168670 Bacteria 8062617
173 2876370776 2876369609 Bacteria 6807521
174 2878755973 2878753008 Bacteria 6922523
175 2878786639 2878781027 Bacteria 6834456
176 2880521375 2880518877 Bacteria 5012590
177 2881860580 2881853255 Bacteria 6698367
178 2881868732 2881861095 Bacteria 7128710
179 2882460957 2882456835 Bacteria 6863978
180 2882638761 2882632389 Bacteria 8154593
181 2882918338 2882912400 Bacteria 6801539
182 2885320926 2885318864 Bacteria 6729568
183 2885345947 2885342637 Bacteria 7011821
184 2888339916 2888337043 Bacteria 6629336
185 2889011749 2889010040 Bacteria 6749192
186 2889919620 2889914905 Bacteria 5702301
187 2896385254 2896384573 Bacteria 7700774
188 2903501442 2903492973 Bacteria 13473544
189 2904694728 2904690495 Bacteria 9412302
190 2915654025 2915650412 Bacteria 4288180
191 2916064037 2916061851 Bacteria 6737736
192 2919454286 2919450847 Bacteria 5631160
193 2920766715 2920760137 Bacteria 7427611
194 2922156182 2922151315 Bacteria 6902399
195 2924757771 2924754689 Bacteria 6774424
196 2924761984 2924754689 Bacteria 6774424
197 2924791073 2924784321 Bacteria 7416538
198 2928961929 2928959182 Bacteria 4725774
199 2929202855 2929199973 Bacteria 7260745
200 2936386247 2936381700 Bacteria 7006523
201 2937843862 2937843397 Bacteria 5256375
202 2937844941 2937843397 Bacteria 5256375
203 2937846849 2937843397 Bacteria 5256375
204 2937976456 2937972304 Bacteria 7532020
205 2958038602 2958034702 Bacteria 6989922
206 2958093366 2958092219 Bacteria 6861151
207 2958096169 2958092219 Bacteria 6861151
208 2960638649 2960637947 Bacteria 7296468
209 2960638939 2960637947 Bacteria 7296468
210 2961132379 2961127735 Bacteria 7196641
211 2961174022 2961170736 Bacteria 7072258
212 2964629790 2964628898 Bacteria 7083044
213 2964634280 2964628898 Bacteria 7083044
214 2964720324 2964719344 Bacteria 7286602
215 2965064378 2965062239 Bacteria 7412989
216 2965113687 2965110997 Bacteria 6693150
217 2968005569 2968003550 Bacteria 6929263
218 2968023797 2968016561 Bacteria 7022047
219 2968120038 2968117919 Bacteria 6536078
220 2970469838 2970469710 Bacteria 6969209
221 2970506612 2970503327 Bacteria 7099517
222 2977527077 2977523885 Bacteria 6960446
223 2977825196 2977821940 Bacteria 6906439
224 2977833834 2977828996 Bacteria 7007971
225 2977944447 2977942078 Bacteria 7570577
226 2979794174 2979793036 Bacteria 6808957
227 2979811258 2979808191 Bacteria 7179355
228 2987654202 2987652177 Bacteria 6969023
229 2987659018 2987652177 Bacteria 6969023
230 2996350643 2996348954 Bacteria 7239054
231 2996355094 2996348954 Bacteria 7239054
232 2996393900 2996386984 Bacteria 6978667
233 3002142810 3002141150 Bacteria 5254435
234 3004171895 3004167301 Bacteria 8330599
235 3004277341 3004275668 Bacteria 7114440
236 3004281628 3004275668 Bacteria 7114440
237 8001846516 8001845381 Bacteria 5804942
238 8004377563 8004374579 Bacteria 6898112
239 8004397665 8004395343 Bacteria 6620908
240 8004397710 8004395343 Bacteria 6620908
241 8045869169 8045864390 Bacteria 5043873
242 8055912045 8055909800 Bacteria 7278581
243 8056875884 8056875544 Bacteria 4355797
244 Ga0451837_0427356
245 JGI24740J21852_10029363
246 JGI24739J22299_10007208
247 JGI25152J39213_1000350
248 JGI25150J39212_1000040
249 JGI25151J46595_10000152
250 JGI25153J46596_10001799
251 Ga0055542_1000557
252 Ga0055529_1006536
253 JGI25405J52794_10004874
254 JGI25405J52794_10049593
255 Ga0065704_10070267
256 Ga0070658_10313862
257 Ga0070660_100406558
258 Ga0070675_101168365
259 Ga0070671_101670808
260 Ga0070667_100000265
261 Ga0070700_101584285
262 Ga0070693_100220558
263 Ga0068854_100504955
264 Ga0081455_10021584
265 Ga0075365_10032324
266 Ga0075368_10019358
267 Ga0075363_100009686
268 Ga0075364_10065974
269 Ga0075367_10011187
270 Ga0099826_10000056
271 Ga0099794_10069323
272 Ga0105240_10202949
273 Ga0105240_11317603
274 Ga0105241_10330235
275 Ga0105237_11699599
276 Ga0105237_12785794
277 Ga0105238_10056740
278 Ga0105033_101416
279 Ga0105239_10033143
280 Ga0105246_10738613
281 Ga0157373_10154387
282 Ga0157371_10000346
283 Ga0157370_10128156
284 Ga0157374_10554801
285 Ga0163162_10152794
286 Ga0163162_11851734
287 Ga0163163_12734531
288 Ga0213874_10282916
289 Ga0213876_10000708
290 Ga0207425_1000046
291 Ga0209026_1003473
292 Ga0209026_1064662
293 Ga0209677_116697
294 Ga0209148_1000126
295 Ga0209129_1000170
296 Ga0209455_1000280
297 Ga0209025_1000137
298 Ga0209758_1000123
299 Ga0207705_10119611
300 Ga0207654_10892249
301 Ga0207695_10211799
302 Ga0207695_10604168
303 Ga0207657_10298207
304 Ga0207649_11203608
305 Ga0207694_10267611
306 Ga0207690_10740398
307 Ga0207661_11457239
308 Ga0207640_11200196
309 Ga0207658_10000703
310 Ga0207639_10014746
311 Ga0207678_10598074
312 Ga0207708_11533678
313 Ga0207648_11916728
314 Ga0207676_10847747
315 Ga0207683_10499690
316 Ga0207683_10591473
317 Ga0209282_1000084
318 Ga0209282_1337167
319 Ga0209588_1037486
320 Ga0209813_10072571
321 Ga0265338_10322695
322 Ga0265328_10000098
323 Ga0307516_10732747
324 Ga0307405_10165169
325 Ga0307406_10096536
326 Ga0315914_1000129
327 Ga0307510_10462328
328 Ga0315913_1000034
329 Ga0315915_1000066
330 Ga0395899_0000059
331 Ga0395900_0184311
332 Ga0395898_0310004
333 Ga0436365_1540873
334 Ga0436363_0474942
335 Ga0436362_1183220
336 Ga0439436_0001686
337 Ga0495603_0370127
338 Ga0495628_0863703
339 Ga0495632_0140854
340 Ga0496105_0211950
341 Ga0496106_0308296
342 Ga0496107_0052424
343 Ga0496109_1397689
344 Ga0496114_1054983
345 Ga0496116_0000026
346 Ga0496116_0031558
347 Ga0496118_0080472
348 Ga0496119_0044477
349 Ga0496119_0145636
350 Ga0496120_0147901
351 Ga0496124_0033898
352 Ga0496124_0453472
353 Ga0496125_0002059
354 Ga0496126_0531285
355 Ga0501032_0112590
356 Ga0501047_0061904
357 Ga0501048_0130775
358 Ga0501198_039898
359 Ga0501044_0422043
360 nmdc:mga03n38_13425_c1
361 nmdc:mga00v17_36982_c1
362 nmdc:mga0yw44_446_c1
363 nmdc:mga06z11_5260_c2
364 nmdc:mga04h51_31408_c1
365 Ga0495601_0415718
366 Ga0500554_112970
367 Ga0500559_0001889
368 2511390573
369 2512963709
370 2513593818
371 2513595437
372 2514037567
373 2514590850
374 2585260870
375 2585281065
376 2585547037
377 2599718863
378 2599936044
379 2601611344
380 2601748235
381 2616556371
382 2643813530
383 2643855173
384 2643905779
385 2643985674
386 2644129038
387 2756676829
388 2757572209
389 2758639481
390 2774872000
391 2776913405
392 2792583308
393 2792748469
394 2806053748
395 2806060948
396 2806066743
397 2809062768
398 2809078548
399 2809083157
400 2834581053
401 2842694432
402 2844004406
403 2852655673
404 2854900731
405 2854913169
406 2856343088
407 2856359465
408 2857355782
409 2869257518
410 2871457613
411 2871491812
412 2874104621
413 2874139697
414 2874171284
415 2874173245
416 2876370776
417 2878755973
418 2878786639
419 2880521375
420 2881860580
421 2881868732
422 2882460957
423 2882638761
424 2882918338
425 2885320926
426 2885345947
427 2888339916
428 2889011749
429 2889919620
430 2896385254
431 2903501442
432 2904694728
433 2915654025
434 2916064037
435 2919454286
436 2920766715
437 2922156182
438 2924757771
439 2924761984
440 2924791073
441 2928961929
442 2929202855
443 2936386247
444 2937843862
445 2937844941
446 2937846849
447 2937976456
448 2958038602
449 2958093366
450 2958096169
451 2960638649
452 2960638939
453 2961132379
454 2961174022
455 2964629790
456 2964634280
457 2964720324
458 2965064378
459 2965113687
460 2968005569
461 2968023797
462 2968120038
463 2970469838
464 2970506612
465 2977527077
466 2977825196
467 2977833834
468 2977944447
469 2979794174
470 2979811258
471 2987654202
472 2987659018
473 2996350643
474 2996355094
475 2996393900
476 3002142810
477 3004171895
478 3004277341
479 3004281628
480 8001846516
481 8004377563
482 8004397665
483 8004397710
484 8045869169
485 8055912045
486 8056875884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

1

82

0.92

Map