F355650

General Info

Members Datasets Scaffolds Average Seq Length
243 136 486 186

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10000001|Ga0207695_100000012414
Length 217
Sequence MSRTESKMVELGTEAPAFELVDVVSGKVMGRDDIAALVWDEKLTDAANQSTHGGPARKHGLLIMFVCMHCPYVKHVEDELGRIGRDYFANGEGPIAIAAIQSNDIVEYPEDGPDGMREQAARCGWTFPYLLDDTQEVARAYNAACTPDFFLFDAEMKLVYRGQLDSSRPRRKDFGNDIPVTGEDLRAALDAVIAGKRPDPNQRQSIGCNIKWRGVPA

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
108 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
111 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.41
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 1.23
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10000001 3300025913 Bacteria 2888630
2 JGI24743J22301_10024772 3300001991 Bacteria 1160
3 rootH1_10266558 3300003323 Bacteria 1571
4 Ga0070658_10004784 3300005327 Bacteria 11014
5 Ga0070658_10040937 3300005327 Bacteria 3738
6 Ga0070658_10117208 3300005327 Bacteria 2211
7 Ga0070658_10819156 3300005327 Unclassified 809
8 Ga0070683_100015174 3300005329 Bacteria 6762
9 Ga0070683_100027125 3300005329 Bacteria 5163
10 Ga0070683_100095521 3300005329 Bacteria 2795
11 Ga0070683_100792535 3300005329 Bacteria 908
12 Ga0070670_100003603 3300005331 Bacteria 12886
13 Ga0070682_100375669 3300005337 Bacteria 1067
14 Ga0070682_100534693 3300005337 Bacteria 914
15 Ga0068868_100007533 3300005338 Bacteria 7754
16 Ga0070661_100133760 3300005344 Bacteria 1864
17 Ga0070661_100172248 3300005344 Bacteria 1644
18 Ga0070671_100032180 3300005355 Bacteria 4337
19 Ga0070667_100014331 3300005367 Bacteria 6552
20 Ga0070714_100019390 3300005435 Bacteria 5540
21 Ga0070714_100653845 3300005435 Bacteria 1012
22 Ga0070694_100051024 3300005444 Bacteria 2791
23 Ga0070694_100506887 3300005444 Bacteria 961
24 Ga0070684_100039691 3300005535 Bacteria 4051
25 Ga0070684_100085968 3300005535 Bacteria 2790
26 Ga0070684_100298122 3300005535 Unclassified 1479
27 Ga0068853_100001622 3300005539 Bacteria 16427
28 Ga0068853_100010477 3300005539 Bacteria 7499
29 Ga0068853_100015787 3300005539 Bacteria 6202
30 Ga0070686_100075301 3300005544 Bacteria 2220
31 Ga0070695_100264682 3300005545 Bacteria 1257
32 Ga0070665_100087327 3300005548 Bacteria 3124
33 Ga0068855_100030625 3300005563 Bacteria 6433
34 Ga0068855_100050901 3300005563 Bacteria 4880
35 Ga0068855_100122204 3300005563 Bacteria 2980
36 Ga0068855_100219351 3300005563 Bacteria 2133
37 Ga0068855_100573021 3300005563 Bacteria 1220
38 Ga0068855_100638390 3300005563 Bacteria 1145
39 Ga0070664_100035345 3300005564 Bacteria 4195
40 Ga0070664_100141169 3300005564 Bacteria 2121
41 Ga0068857_100001794 3300005577 Bacteria 17284
42 Ga0068857_100014110 3300005577 Bacteria 6957
43 Ga0068856_100001460 3300005614 Bacteria 24761
44 Ga0068856_100038946 3300005614 Bacteria 4667
45 Ga0068856_100057669 3300005614 Bacteria 3834
46 Ga0068856_100173357 3300005614 Unclassified 2169
47 Ga0068856_100206064 3300005614 Bacteria 1981
48 Ga0068852_100000099 3300005616 Bacteria 58503
49 Ga0068852_100124038 3300005616 Bacteria 2369
50 Ga0068852_100273437 3300005616 Unclassified 1626
51 Ga0068859_100050267 3300005617 Bacteria 4188
52 Ga0068859_100065429 3300005617 Bacteria 3670
53 Ga0068864_100080920 3300005618 Bacteria 2847
54 Ga0068851_10005476 3300005834 Bacteria 5758
55 Ga0068851_10031249 3300005834 Bacteria 2643
56 Ga0068863_100021131 3300005841 Bacteria 6217
57 Ga0068858_100208765 3300005842 Bacteria 1848
58 Ga0068860_100005242 3300005843 Bacteria 13166
59 Ga0068860_100141319 3300005843 Bacteria 2314
60 Ga0068862_100159238 3300005844 Bacteria 2014
61 Ga0081455_10007027 3300005937 Bacteria 11954
62 Ga0070717_10642473 3300006028 Unclassified 963
63 Ga0097621_100003902 3300006237 Bacteria 10338
64 Ga0068871_100036066 3300006358 Bacteria 3934
65 Ga0075428_100903089 3300006844 Bacteria 937
66 Ga0075428_101047932 3300006844 Bacteria 862
67 Ga0075431_100236832 3300006847 Bacteria 1858
68 Ga0075429_100098095 3300006880 Bacteria 2557
69 Ga0097620_100050262 3300006931 Bacteria 4188
70 Ga0097620_100065429 3300006931 Bacteria 3670
71 Ga0105240_10000001 3300009093 Bacteria 2887840
72 Ga0105240_10000763 3300009093 Bacteria 58506
73 Ga0105240_10001274 3300009093 Bacteria 43595
74 Ga0105240_10001769 3300009093 Bacteria 36484
75 Ga0105240_10026665 3300009093 Bacteria 7582
76 Ga0105240_10038857 3300009093 Bacteria 6102
77 Ga0105240_10180836 3300009093 Bacteria 2489
78 Ga0105240_10496056 3300009093 Bacteria 1358
79 Ga0105240_10563921 3300009093 Unclassified 1258
80 Ga0111539_10062343 3300009094 Bacteria 4414
81 Ga0111539_10113656 3300009094 Bacteria 3176
82 Ga0105245_10011639 3300009098 Bacteria 7657
83 Ga0114129_10142802 3300009147 Bacteria 3280
84 Ga0105241_10000378 3300009174 Bacteria 33925
85 Ga0105241_10003050 3300009174 Bacteria 12495
86 Ga0105241_10028606 3300009174 Bacteria 4154
87 Ga0105241_10049189 3300009174 Bacteria 3210
88 Ga0105248_10000937 3300009177 Bacteria 32500
89 Ga0105248_10022376 3300009177 Bacteria 7012
90 Ga0105237_10007374 3300009545 Bacteria 12045
91 Ga0105237_10074569 3300009545 Bacteria 3385
92 Ga0105237_10582399 3300009545 Unclassified 1126
93 Ga0105238_10049873 3300009551 Bacteria 4214
94 Ga0105238_10069582 3300009551 Bacteria 3520
95 Ga0105238_10099487 3300009551 Bacteria 2891
96 Ga0105238_10358997 3300009551 Bacteria 1446
97 Ga0105238_11941055 3300009551 Bacteria 622
98 Ga0105249_10424122 3300009553 Bacteria 1365
99 Ga0105239_10183787 3300010375 Bacteria 2339
100 Ga0105239_10460457 3300010375 Unclassified 1443
101 Ga0105246_10002371 3300011119 Bacteria 11368
102 Ga0157373_10231220 3300013100 Unclassified 1306
103 Ga0157373_10330648 3300013100 Unclassified 1085
104 Ga0157370_10000525 3300013104 Bacteria 47845
105 Ga0157370_10401575 3300013104 Bacteria 1261
106 Ga0157369_10000586 3300013105 Bacteria 47526
107 Ga0157369_10042599 3300013105 Bacteria 4951
108 Ga0157369_10045363 3300013105 Bacteria 4782
109 Ga0157369_10049839 3300013105 Bacteria 4537
110 Ga0157369_10101609 3300013105 Bacteria 3064
111 Ga0157369_10131709 3300013105 Bacteria 2649
112 Ga0157369_11518009 3300013105 Unclassified 681
113 Ga0157374_10044377 3300013296 Bacteria 4110
114 Ga0157374_10087178 3300013296 Bacteria 2971
115 Ga0157378_10011315 3300013297 Bacteria 7810
116 Ga0157378_10419962 3300013297 Unclassified 1322
117 Ga0157378_10597873 3300013297 Bacteria 1114
118 Ga0157378_10775182 3300013297 Bacteria 983
119 Ga0163162_10570371 3300013306 Bacteria 1259
120 Ga0157372_10000259 3300013307 Bacteria 58487
121 Ga0157372_10041893 3300013307 Bacteria 5063
122 Ga0157372_10069591 3300013307 Bacteria 3958
123 Ga0157372_10461412 3300013307 Bacteria 1480
124 Ga0157372_10802952 3300013307 Bacteria 1093
125 Ga0157375_10034949 3300013308 Bacteria 4793
126 Ga0157375_11017551 3300013308 Unclassified 968
127 Ga0163163_10012029 3300014325 Bacteria 7875
128 Ga0157379_10002128 3300014968 Bacteria 16417
129 Ga0157376_10005577 3300014969 Bacteria 8803
130 Ga0206350_11599680 3300020080 Unclassified 929
131 Ga0224572_1032871 3300024225 Bacteria 987
132 Ga0207710_10001734 3300025900 Bacteria 10544
133 Ga0207647_10511511 3300025904 Unclassified 669
134 Ga0207654_10000505 3300025911 Bacteria 22302
135 Ga0207654_10004231 3300025911 Bacteria 7241
136 Ga0207695_10000798 3300025913 Bacteria 59005
137 Ga0207695_10001290 3300025913 Bacteria 42540
138 Ga0207695_10007849 3300025913 Bacteria 13487
139 Ga0207695_10028035 3300025913 Bacteria 6255
140 Ga0207695_10251612 3300025913 Bacteria 1666
141 Ga0207695_10324211 3300025913 Bacteria 1430
142 Ga0207695_10600132 3300025913 Unclassified 982
143 Ga0207671_10002663 3300025914 Bacteria 18728
144 Ga0207671_10003863 3300025914 Bacteria 14650
145 Ga0207649_10141373 3300025920 Bacteria 1647
146 Ga0207694_10141818 3300025924 Bacteria 1933
147 Ga0207694_10151056 3300025924 Bacteria 1871
148 Ga0207694_10642021 3300025924 Bacteria 894
149 Ga0207650_10018432 3300025925 Bacteria 4898
150 Ga0207687_10024789 3300025927 Bacteria 4010
151 Ga0207687_10073040 3300025927 Bacteria 2455
152 Ga0207664_10038130 3300025929 Bacteria 3725
153 Ga0207644_10065996 3300025931 Bacteria 2633
154 Ga0207711_10010657 3300025941 Bacteria 7644
155 Ga0207689_10008079 3300025942 Bacteria 9177
156 Ga0207661_10004420 3300025944 Bacteria 9862
157 Ga0207661_10030979 3300025944 Bacteria 4126
158 Ga0207661_10479410 3300025944 Bacteria 1135
159 Ga0207661_10740963 3300025944 Bacteria 904
160 Ga0207667_10004451 3300025949 Bacteria 17156
161 Ga0207667_10031476 3300025949 Bacteria 5727
162 Ga0207667_10033923 3300025949 Bacteria 5483
163 Ga0207667_10038367 3300025949 Bacteria 5117
164 Ga0207667_10186762 3300025949 Bacteria 2127
165 Ga0207667_10437411 3300025949 Bacteria 1330
166 Ga0207712_10396194 3300025961 Bacteria 1159
167 Ga0207640_10257842 3300025981 Bacteria 1357
168 Ga0207658_10016266 3300025986 Bacteria 5115
169 Ga0207677_10002842 3300026023 Bacteria 9128
170 Ga0207703_10100338 3300026035 Bacteria 2452
171 Ga0207639_10000402 3300026041 Bacteria 29850
172 Ga0207639_10094842 3300026041 Bacteria 2396
173 Ga0207639_10168726 3300026041 Bacteria 1851
174 Ga0207702_10008361 3300026078 Bacteria 8734
175 Ga0207702_10371379 3300026078 Bacteria 1373
176 Ga0207702_10764176 3300026078 Unclassified 954
177 Ga0207641_10007031 3300026088 Bacteria 9403
178 Ga0207676_10045858 3300026095 Bacteria 3379
179 Ga0207674_10007317 3300026116 Bacteria 12862
180 Ga0207674_10009495 3300026116 Bacteria 11107
181 Ga0207674_10213340 3300026116 Unclassified 1879
182 Ga0207674_10342327 3300026116 Bacteria 1446
183 Ga0207698_10000345 3300026142 Bacteria 27416
184 Ga0207698_10017751 3300026142 Bacteria 4836
185 Ga0207698_10428491 3300026142 Unclassified 1271
186 Ga0207698_10495763 3300026142 Bacteria 1188
187 Ga0207698_10633411 3300026142 Bacteria 1057
188 Ga0207428_10195489 3300027907 Bacteria 1523
189 Ga0268266_10355268 3300028379 Bacteria 1378
190 Ga0268265_10132310 3300028380 Bacteria 2075
191 Ga0268264_10002160 3300028381 Bacteria 17530
192 Ga0265330_10010043 3300031235 Bacteria 4477
193 Ga0265330_10016403 3300031235 Bacteria 3418
194 Ga0265332_10000676 3300031238 Bacteria 21955
195 Ga0265328_10001613 3300031239 Bacteria 10376
196 Ga0265329_10005633 3300031242 Bacteria 5040
197 Ga0265340_10088793 3300031247 Bacteria 1448
198 Ga0265339_10238957 3300031249 Bacteria 883
199 Ga0265331_10000200 3300031250 Bacteria 73158
200 Ga0265327_10001679 3300031251 Bacteria 26538
201 Ga0265316_10000343 3300031344 Bacteria 52330
202 Ga0265316_10062498 3300031344 Bacteria 2889
203 Ga0265314_10000287 3300031711 Bacteria 73159
204 Ga0265314_10244975 3300031711 Bacteria 1032
205 Ga0265342_10288346 3300031712 Bacteria 867
206 Ga0316576_10152857 3300031727 Bacteria 1739
207 Ga0316574_0123128 3300035398 Bacteria 1666
208 Ga0373937_0175337 3300036401 Bacteria 2012
209 Ga0395899_0034269 3300037312 Bacteria 3812
210 Ga0400484_21236 3300038725 Bacteria 3338
211 Ga0400490_38524 3300038726 Bacteria 4907
212 Ga0439448_0157295 3300042005 Unclassified 790
213 Ga0439451_038764 3300042009 Unclassified 957
214 Ga0439454_008745 3300042011 Bacteria 1300
215 Ga0439435_0028331 3300042436 Bacteria 1505
216 Ga0439460_0099580 3300042461 Unclassified 932
217 Ga0451576_0132924 3300045051 Bacteria 2594
218 Ga0451576_0402620 3300045051 Bacteria 1435
219 Ga0466967_0530157 3300045976 Bacteria 1158
220 Ga0495651_0235448 3300046462 Bacteria 1259
221 Ga0495653_0195196 3300046463 Bacteria 1378
222 Ga0495630_0119271 3300046517 Unclassified 2001
223 Ga0495599_0221652 3300046678 Bacteria 1157
224 Ga0495646_0091732 3300046680 Unclassified 1753
225 Ga0495658_0773880 3300046683 Bacteria 615
226 Ga0495624_0042531 3300046690 Unclassified 2903
227 Ga0495674_0202095 3300047319 Bacteria 1648
228 Ga0496101_0400136 3300048904 Bacteria 1081
229 Ga0496105_0084192 3300048908 Bacteria 2627
230 Ga0496108_0298881 3300048911 Bacteria 1402
231 Ga0501070_0193699 3300049586 Bacteria 1670
232 Ga0501080_0067897 3300049742 Bacteria 3316
233 Ga0501083_0000519 3300049744 Bacteria 24598
234 Ga0501083_0264107 3300049744 Bacteria 1120
235 nmdc:mga07m45_420642_c1 3300050496 Bacteria 775
236 nmdc:mga05p37_420916_c1 3300050507 Bacteria 1554
237 nmdc:mga09592_435536_c1 3300050508 Bacteria 1132
238 nmdc:mga06r32_1405274_c1 3300050510 Bacteria 640
239 nmdc:mga06r32_358361_c1 3300050510 Bacteria 1443
240 nmdc:mga08y16_147613_c1 3300050511 Bacteria 2444
241 nmdc:mga08y16_35281_c1 3300050511 Bacteria 3522
242 Ga0501084_0000253 3300054114 Bacteria 40477
243 2837187248 2837183177 Bacteria 4637169
244 Ga0207695_10000001
245 JGI24743J22301_10024772
246 rootH1_10266558
247 Ga0070658_10004784
248 Ga0070658_10040937
249 Ga0070658_10117208
250 Ga0070658_10819156
251 Ga0070683_100015174
252 Ga0070683_100027125
253 Ga0070683_100095521
254 Ga0070683_100792535
255 Ga0070670_100003603
256 Ga0070682_100375669
257 Ga0070682_100534693
258 Ga0068868_100007533
259 Ga0070661_100133760
260 Ga0070661_100172248
261 Ga0070671_100032180
262 Ga0070667_100014331
263 Ga0070714_100019390
264 Ga0070714_100653845
265 Ga0070694_100051024
266 Ga0070694_100506887
267 Ga0070684_100039691
268 Ga0070684_100085968
269 Ga0070684_100298122
270 Ga0068853_100001622
271 Ga0068853_100010477
272 Ga0068853_100015787
273 Ga0070686_100075301
274 Ga0070695_100264682
275 Ga0070665_100087327
276 Ga0068855_100030625
277 Ga0068855_100050901
278 Ga0068855_100122204
279 Ga0068855_100219351
280 Ga0068855_100573021
281 Ga0068855_100638390
282 Ga0070664_100035345
283 Ga0070664_100141169
284 Ga0068857_100001794
285 Ga0068857_100014110
286 Ga0068856_100001460
287 Ga0068856_100038946
288 Ga0068856_100057669
289 Ga0068856_100173357
290 Ga0068856_100206064
291 Ga0068852_100000099
292 Ga0068852_100124038
293 Ga0068852_100273437
294 Ga0068859_100050267
295 Ga0068859_100065429
296 Ga0068864_100080920
297 Ga0068851_10005476
298 Ga0068851_10031249
299 Ga0068863_100021131
300 Ga0068858_100208765
301 Ga0068860_100005242
302 Ga0068860_100141319
303 Ga0068862_100159238
304 Ga0081455_10007027
305 Ga0070717_10642473
306 Ga0097621_100003902
307 Ga0068871_100036066
308 Ga0075428_100903089
309 Ga0075428_101047932
310 Ga0075431_100236832
311 Ga0075429_100098095
312 Ga0097620_100050262
313 Ga0097620_100065429
314 Ga0105240_10000001
315 Ga0105240_10000763
316 Ga0105240_10001274
317 Ga0105240_10001769
318 Ga0105240_10026665
319 Ga0105240_10038857
320 Ga0105240_10180836
321 Ga0105240_10496056
322 Ga0105240_10563921
323 Ga0111539_10062343
324 Ga0111539_10113656
325 Ga0105245_10011639
326 Ga0114129_10142802
327 Ga0105241_10000378
328 Ga0105241_10003050
329 Ga0105241_10028606
330 Ga0105241_10049189
331 Ga0105248_10000937
332 Ga0105248_10022376
333 Ga0105237_10007374
334 Ga0105237_10074569
335 Ga0105237_10582399
336 Ga0105238_10049873
337 Ga0105238_10069582
338 Ga0105238_10099487
339 Ga0105238_10358997
340 Ga0105238_11941055
341 Ga0105249_10424122
342 Ga0105239_10183787
343 Ga0105239_10460457
344 Ga0105246_10002371
345 Ga0157373_10231220
346 Ga0157373_10330648
347 Ga0157370_10000525
348 Ga0157370_10401575
349 Ga0157369_10000586
350 Ga0157369_10042599
351 Ga0157369_10045363
352 Ga0157369_10049839
353 Ga0157369_10101609
354 Ga0157369_10131709
355 Ga0157369_11518009
356 Ga0157374_10044377
357 Ga0157374_10087178
358 Ga0157378_10011315
359 Ga0157378_10419962
360 Ga0157378_10597873
361 Ga0157378_10775182
362 Ga0163162_10570371
363 Ga0157372_10000259
364 Ga0157372_10041893
365 Ga0157372_10069591
366 Ga0157372_10461412
367 Ga0157372_10802952
368 Ga0157375_10034949
369 Ga0157375_11017551
370 Ga0163163_10012029
371 Ga0157379_10002128
372 Ga0157376_10005577
373 Ga0206350_11599680
374 Ga0224572_1032871
375 Ga0207710_10001734
376 Ga0207647_10511511
377 Ga0207654_10000505
378 Ga0207654_10004231
379 Ga0207695_10000798
380 Ga0207695_10001290
381 Ga0207695_10007849
382 Ga0207695_10028035
383 Ga0207695_10251612
384 Ga0207695_10324211
385 Ga0207695_10600132
386 Ga0207671_10002663
387 Ga0207671_10003863
388 Ga0207649_10141373
389 Ga0207694_10141818
390 Ga0207694_10151056
391 Ga0207694_10642021
392 Ga0207650_10018432
393 Ga0207687_10024789
394 Ga0207687_10073040
395 Ga0207664_10038130
396 Ga0207644_10065996
397 Ga0207711_10010657
398 Ga0207689_10008079
399 Ga0207661_10004420
400 Ga0207661_10030979
401 Ga0207661_10479410
402 Ga0207661_10740963
403 Ga0207667_10004451
404 Ga0207667_10031476
405 Ga0207667_10033923
406 Ga0207667_10038367
407 Ga0207667_10186762
408 Ga0207667_10437411
409 Ga0207712_10396194
410 Ga0207640_10257842
411 Ga0207658_10016266
412 Ga0207677_10002842
413 Ga0207703_10100338
414 Ga0207639_10000402
415 Ga0207639_10094842
416 Ga0207639_10168726
417 Ga0207702_10008361
418 Ga0207702_10371379
419 Ga0207702_10764176
420 Ga0207641_10007031
421 Ga0207676_10045858
422 Ga0207674_10007317
423 Ga0207674_10009495
424 Ga0207674_10213340
425 Ga0207674_10342327
426 Ga0207698_10000345
427 Ga0207698_10017751
428 Ga0207698_10428491
429 Ga0207698_10495763
430 Ga0207698_10633411
431 Ga0207428_10195489
432 Ga0268266_10355268
433 Ga0268265_10132310
434 Ga0268264_10002160
435 Ga0265330_10010043
436 Ga0265330_10016403
437 Ga0265332_10000676
438 Ga0265328_10001613
439 Ga0265329_10005633
440 Ga0265340_10088793
441 Ga0265339_10238957
442 Ga0265331_10000200
443 Ga0265327_10001679
444 Ga0265316_10000343
445 Ga0265316_10062498
446 Ga0265314_10000287
447 Ga0265314_10244975
448 Ga0265342_10288346
449 Ga0316576_10152857
450 Ga0316574_0123128
451 Ga0373937_0175337
452 Ga0395899_0034269
453 Ga0400484_21236
454 Ga0400490_38524
455 Ga0439448_0157295
456 Ga0439451_038764
457 Ga0439454_008745
458 Ga0439435_0028331
459 Ga0439460_0099580
460 Ga0451576_0132924
461 Ga0451576_0402620
462 Ga0466967_0530157
463 Ga0495651_0235448
464 Ga0495653_0195196
465 Ga0495630_0119271
466 Ga0495599_0221652
467 Ga0495646_0091732
468 Ga0495658_0773880
469 Ga0495624_0042531
470 Ga0495674_0202095
471 Ga0496101_0400136
472 Ga0496105_0084192
473 Ga0496108_0298881
474 Ga0501070_0193699
475 Ga0501080_0067897
476 Ga0501083_0000519
477 Ga0501083_0264107
478 nmdc:mga07m45_420642_c1
479 nmdc:mga05p37_420916_c1
480 nmdc:mga09592_435536_c1
481 nmdc:mga06r32_1405274_c1
482 nmdc:mga06r32_358361_c1
483 nmdc:mga08y16_147613_c1
484 nmdc:mga08y16_35281_c1
485 Ga0501084_0000253
486 2837187248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

11

161

0.8

PF08534

Redoxin

Redoxin

10

178

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9818 4 184
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9757 1 183
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9659 4 184
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9653 1 183
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.9286 7 183
ID Description Score Start End Superfamily
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9799 2 183 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9783 2 183 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9731 2 183 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9642 2 183 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9287 7 183 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3S1YF74-F1-model_v4 Thioredoxin family protein 0.9949 42 183 GO:0016491
AF-A0A846FSI1-F1-model_v4 deleted 0.9946 37 183
AF-A0A1Z4EJ21-F1-model_v4 Thioredoxin family protein 0.9939 73 183 GO:0016209
GO:0016491
AF-A0A679HQE1-F1-model_v4 Thioredoxin family protein 0.9921 2 183 GO:0016209
GO:0016491
AF-A0A1Z4FVE8-F1-model_v4 deleted 0.992 1 183

Map