F355645

General Info

Members Datasets Scaffolds Average Seq Length
243 139 486 162

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10424540|Ga0207685_104245401
Length 183
Sequence VARVEISAARSLERDREKNQGENMISAAILTISDSVSAGTRVDRSGPAVRERLERLGWGVAVMETIPDVISEISGRLATLADGGQVAAIFTTGGTGVAPRDVTPEAARAILDREIPGFGEMMRMQGRLTTPLAVLSRSLAGTRGKVLIVTLPGSPKGAVESLDAIVELVPHVLELLRGQTEHS

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
72 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 21.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10424540 3300025905 Bacteria 686
2 rootH2_10241975 3300003320 Bacteria 1472
3 Ga0070658_10717877 3300005327 Unclassified 868
4 Ga0070676_10402967 3300005328 Bacteria 952
5 Ga0070683_100366525 3300005329 Bacteria 1372
6 Ga0070683_100398021 3300005329 Bacteria 1313
7 Ga0068869_100659263 3300005334 Unclassified 889
8 Ga0070666_10196146 3300005335 Bacteria 1420
9 Ga0070680_100020130 3300005336 Bacteria 5293
10 Ga0070660_100154415 3300005339 Bacteria 1847
11 Ga0070667_100140698 3300005367 Bacteria 2113
12 Ga0070714_100099777 3300005435 Bacteria 2556
13 Ga0070714_101393858 3300005435 Unclassified 684
14 Ga0070713_101388064 3300005436 Unclassified 681
15 Ga0070681_10019182 3300005458 Bacteria 6844
16 Ga0070681_10617794 3300005458 Bacteria 998
17 Ga0070685_11175356 3300005466 Bacteria 582
18 Ga0070706_100070075 3300005467 Bacteria 3243
19 Ga0070699_100022533 3300005518 Bacteria 5429
20 Ga0070684_100223700 3300005535 Bacteria 1717
21 Ga0070686_101103769 3300005544 Bacteria 655
22 Ga0070696_100027841 3300005546 Unclassified 3854
23 Ga0070665_100689386 3300005548 Bacteria 1035
24 Ga0070665_100857924 3300005548 Bacteria 921
25 Ga0068855_100100483 3300005563 Bacteria 3330
26 Ga0070664_100323359 3300005564 Bacteria 1398
27 Ga0068857_100499637 3300005577 Bacteria 1141
28 Ga0068856_100393633 3300005614 Bacteria 1405
29 Ga0068852_100007102 3300005616 Bacteria 8161
30 Ga0068852_102273716 3300005616 Unclassified 563
31 Ga0068864_100402711 3300005618 Bacteria 1301
32 Ga0068863_100324176 3300005841 Bacteria 1497
33 Ga0068863_101046571 3300005841 Unclassified 820
34 Ga0068863_101407295 3300005841 Bacteria 705
35 Ga0070717_10129719 3300006028 Bacteria 2167
36 Ga0070717_10137100 3300006028 Bacteria 2108
37 Ga0070715_10653118 3300006163 Bacteria 623
38 Ga0070716_100133601 3300006173 Bacteria 1572
39 Ga0068871_100537008 3300006358 Bacteria 1058
40 Ga0068871_100606332 3300006358 Bacteria 996
41 Ga0068871_100815020 3300006358 Unclassified 861
42 Ga0075430_100036376 3300006846 Bacteria 4175
43 Ga0075431_100094206 3300006847 Bacteria 3090
44 Ga0105240_10000274 3300009093 Bacteria 102157
45 Ga0105240_10003450 3300009093 Bacteria 24537
46 Ga0105240_10785571 3300009093 Bacteria 1032
47 Ga0105240_11744104 3300009093 Unclassified 649
48 Ga0111539_10537802 3300009094 Bacteria 1361
49 Ga0105245_10876107 3300009098 Bacteria 939
50 Ga0105245_11703558 3300009098 Bacteria 683
51 Ga0105247_10951502 3300009101 Bacteria 667
52 Ga0105241_10304037 3300009174 Bacteria 1370
53 Ga0105248_10046470 3300009177 Bacteria 4866
54 Ga0105248_10308029 3300009177 Bacteria 1784
55 Ga0105248_10550868 3300009177 Unclassified 1301
56 Ga0105248_10703555 3300009177 Bacteria 1140
57 Ga0105248_10750213 3300009177 Unclassified 1101
58 Ga0105248_11554509 3300009177 Unclassified 749
59 Ga0105248_11667323 3300009177 Unclassified 723
60 Ga0105239_11058755 3300010375 Bacteria 933
61 Ga0157370_10000680 3300013104 Bacteria 42288
62 Ga0157370_10833114 3300013104 Unclassified 839
63 Ga0157369_10026651 3300013105 Bacteria 6409
64 Ga0157369_11540725 3300013105 Bacteria 676
65 Ga0157374_11380015 3300013296 Unclassified 727
66 Ga0157374_11456767 3300013296 Unclassified 708
67 Ga0157374_11965097 3300013296 Bacteria 611
68 Ga0157378_10113965 3300013297 Unclassified 2483
69 Ga0163162_10537799 3300013306 Unclassified 1297
70 Ga0163162_10680566 3300013306 Bacteria 1151
71 Ga0163162_10777331 3300013306 Unclassified 1076
72 Ga0163162_10849307 3300013306 Bacteria 1028
73 Ga0163162_11218403 3300013306 Unclassified 854
74 Ga0163162_11236343 3300013306 Bacteria 848
75 Ga0157372_10322925 3300013307 Bacteria 1797
76 Ga0157375_10081896 3300013308 Unclassified 3268
77 Ga0163163_10013372 3300014325 Bacteria 7513
78 Ga0163163_10249452 3300014325 Bacteria 1825
79 Ga0163163_10601576 3300014325 Bacteria 1163
80 Ga0157377_10203582 3300014745 Bacteria 1258
81 Ga0157377_11062569 3300014745 Unclassified 617
82 Ga0157376_10026853 3300014969 Bacteria 4556
83 Ga0157376_10120414 3300014969 Bacteria 2325
84 Ga0157376_10294995 3300014969 Bacteria 1532
85 Ga0157376_10437979 3300014969 Unclassified 1272
86 Ga0157376_10461277 3300014969 Bacteria 1241
87 Ga0206356_11278958 3300020070 Bacteria 981
88 Ga0213875_10077979 3300021388 Bacteria 1546
89 Ga0207680_11024540 3300025903 Unclassified 591
90 Ga0207707_10270942 3300025912 Bacteria 1471
91 Ga0207695_10001788 3300025913 Bacteria 33918
92 Ga0207695_10857865 3300025913 Unclassified 788
93 Ga0207660_10006042 3300025917 Bacteria 7859
94 Ga0207660_11119538 3300025917 Unclassified 641
95 Ga0207700_10216495 3300025928 Bacteria 1621
96 Ga0207664_10077747 3300025929 Bacteria 2690
97 Ga0207644_10976680 3300025931 Bacteria 711
98 Ga0207691_10281285 3300025940 Bacteria 1431
99 Ga0207711_10031527 3300025941 Bacteria 4475
100 Ga0207711_10623783 3300025941 Bacteria 1006
101 Ga0207711_10651060 3300025941 Bacteria 983
102 Ga0207661_10512398 3300025944 Bacteria 1097
103 Ga0207661_10706833 3300025944 Unclassified 927
104 Ga0207661_11051474 3300025944 Bacteria 750
105 Ga0207667_10007775 3300025949 Bacteria 12816
106 Ga0207651_10257287 3300025960 Unclassified 1431
107 Ga0207677_10353724 3300026023 Bacteria 1232
108 Ga0207676_10197525 3300026095 Unclassified 1775
109 Ga0207676_10389619 3300026095 Bacteria 1299
110 Ga0207674_10526993 3300026116 Bacteria 1141
111 Ga0207698_10008513 3300026142 Bacteria 6496
112 Ga0207428_10291966 3300027907 Bacteria 1208
113 Ga0268266_10438980 3300028379 Bacteria 1240
114 Ga0268266_11031720 3300028379 Bacteria 796
115 Ga0265323_10002294 3300028653 Bacteria 8860
116 Ga0265762_1028417 3300030760 Bacteria 1053
117 Ga0265316_10011655 3300031344 Bacteria 7917
118 Ga0265316_10012766 3300031344 Bacteria 7506
119 Ga0265316_10024734 3300031344 Bacteria 5021
120 Ga0265316_10037623 3300031344 Bacteria 3904
121 Ga0265316_10078391 3300031344 Bacteria 2536
122 Ga0265316_10085222 3300031344 Bacteria 2418
123 Ga0265316_10187122 3300031344 Bacteria 1540
124 Ga0265316_10214000 3300031344 Bacteria 1424
125 Ga0265314_10054343 3300031711 Unclassified 2772
126 Ga0265342_10115240 3300031712 Bacteria 1517
127 Ga0373926_0086643 3300035083 Unclassified 1162
128 Ga0373954_0575550 3300035118 Bacteria 558
129 Ga0373943_0341173 3300035170 Bacteria 857
130 Ga0373955_0886881 3300035172 Bacteria 549
131 Ga0373935_0008083 3300035692 Bacteria 6308
132 Ga0373935_0105971 3300035692 Bacteria 1860
133 Ga0373927_0000289 3300035695 Bacteria 39668
134 Ga0373927_0092146 3300035695 Unclassified 1969
135 Ga0373933_0365634 3300035724 Bacteria 938
136 Ga0373947_0003855 3300035725 Bacteria 8827
137 Ga0373947_0187750 3300035725 Bacteria 1348
138 Ga0373947_0509431 3300035725 Bacteria 818
139 Ga0373947_0592918 3300035725 Unclassified 755
140 Ga0373937_0395139 3300036401 Bacteria 1312
141 Ga0373937_0733333 3300036401 Unclassified 935
142 Ga0373925_0001103 3300037068 Bacteria 24152
143 Ga0373925_0403873 3300037068 Bacteria 1115
144 Ga0373925_0632855 3300037068 Bacteria 881
145 Ga0395900_1313097 3300037418 Bacteria 637
146 Ga0436364_0838079 3300037853 Bacteria 6880
147 Ga0395901_0443392 3300038443 Bacteria 1329
148 Ga0436362_1020922 3300039453 Unclassified 522
149 Ga0451807_2126791 3300041486 Bacteria 608
150 Ga0451577_0167294 3300042876 Bacteria 1981
151 Ga0451577_1190714 3300042876 Bacteria 680
152 Ga0453683_0008734 3300044673 Bacteria 6793
153 Ga0466966_0416829 3300044684 Bacteria 807
154 Ga0466961_0243174 3300044693 Bacteria 1106
155 Ga0466963_0546499 3300044694 Unclassified 818
156 Ga0466971_0291116 3300044719 Bacteria 783
157 Ga0466959_0098722 3300045049 Bacteria 2092
158 Ga0451576_0001412 3300045051 Bacteria 41215
159 Ga0451576_0517394 3300045051 Bacteria 1254
160 Ga0451576_0517853 3300045051 Unclassified 1253
161 Ga0466967_0305308 3300045976 Bacteria 1532
162 Ga0495592_0525264 3300046454 Unclassified 731
163 Ga0495629_0294095 3300046459 Bacteria 1113
164 Ga0495651_0015361 3300046462 Bacteria 5920
165 Ga0495651_0075485 3300046462 Bacteria 2555
166 Ga0495653_0092896 3300046463 Bacteria 2202
167 Ga0495580_0006216 3300046472 Bacteria 9757
168 Ga0495580_0008407 3300046472 Bacteria 8211
169 Ga0495580_0059801 3300046472 Bacteria 2678
170 Ga0495580_0168141 3300046472 Bacteria 1516
171 Ga0495580_0180203 3300046472 Bacteria 1459
172 Ga0495662_0004202 3300046476 Bacteria 7250
173 Ga0495662_0060590 3300046476 Bacteria 1828
174 Ga0495664_0005176 3300046477 Bacteria 7156
175 Ga0495664_0207244 3300046477 Bacteria 1188
176 Ga0495618_0319310 3300046514 Unclassified 962
177 Ga0495628_0007182 3300046516 Bacteria 9646
178 Ga0495628_0073133 3300046516 Bacteria 2671
179 Ga0495628_0080589 3300046516 Bacteria 2530
180 Ga0495630_0093060 3300046517 Bacteria 2278
181 Ga0495630_0234854 3300046517 Bacteria 1401
182 Ga0495630_0326576 3300046517 Bacteria 1173
183 Ga0495630_0383253 3300046517 Unclassified 1077
184 Ga0495630_0591385 3300046517 Bacteria 851
185 Ga0495652_0024929 3300046529 Bacteria 5292
186 Ga0495652_0421028 3300046529 Bacteria 941
187 Ga0495665_0037083 3300046531 Bacteria 2602
188 Ga0495665_0127946 3300046531 Bacteria 1330
189 Ga0495665_0133494 3300046531 Bacteria 1299
190 Ga0495640_0003218 3300046533 Bacteria 13145
191 Ga0495586_0307729 3300046535 Bacteria 908
192 Ga0495586_0692988 3300046535 Unclassified 588
193 Ga0495645_0002230 3300046543 Bacteria 13177
194 Ga0495645_0059387 3300046543 Unclassified 2773
195 Ga0495645_0116160 3300046543 Unclassified 1889
196 Ga0495645_0130692 3300046543 Bacteria 1760
197 Ga0495645_0710733 3300046543 Unclassified 609
198 Ga0495667_0035349 3300046559 Bacteria 3339
199 Ga0495667_0413222 3300046559 Bacteria 849
200 Ga0495634_0048305 3300046642 Bacteria 2865
201 Ga0495635_0029780 3300046663 Bacteria 3797
202 Ga0495635_0116927 3300046663 Bacteria 1820
203 Ga0495635_0203353 3300046663 Bacteria 1343
204 Ga0495635_0367975 3300046663 Bacteria 958
205 Ga0495588_0308563 3300046674 Bacteria 833
206 Ga0495599_0002263 3300046678 Bacteria 11202
207 Ga0495599_0029523 3300046678 Bacteria 3438
208 Ga0495599_0545853 3300046678 Bacteria 679
209 Ga0495623_0017797 3300046679 Bacteria 4590
210 Ga0495623_0161333 3300046679 Bacteria 1317
211 Ga0495623_0343178 3300046679 Unclassified 815
212 Ga0495646_0017362 3300046680 Bacteria 4565
213 Ga0495646_0107478 3300046680 Unclassified 1592
214 Ga0495613_0152725 3300046689 Bacteria 1646
215 Ga0495624_0042733 3300046690 Bacteria 2896
216 Ga0495600_0012117 3300046809 Bacteria 5385
217 Ga0495604_0044156 3300047317 Bacteria 3485
218 Ga0495604_0084045 3300047317 Bacteria 2378
219 Ga0495604_0657077 3300047317 Bacteria 668
220 Ga0495674_0011059 3300047319 Bacteria 8521
221 Ga0495674_0062693 3300047319 Bacteria 3236
222 Ga0495674_0195657 3300047319 Bacteria 1679
223 Ga0495674_0204100 3300047319 Bacteria 1639
224 Ga0495680_0128683 3300047322 Unclassified 1862
225 Ga0495680_0182492 3300047322 Bacteria 1514
226 Ga0495680_0728114 3300047322 Bacteria 653
227 Ga0495675_0036543 3300047444 Bacteria 3132
228 Ga0495675_0420744 3300047444 Bacteria 776
229 Ga0495684_0022888 3300047471 Bacteria 4807
230 Ga0495684_0100827 3300047471 Bacteria 2183
231 Ga0495684_0215853 3300047471 Bacteria 1408
232 Ga0495602_0030813 3300048088 Bacteria 5082
233 Ga0495602_0562342 3300048088 Bacteria 789
234 Ga0496100_0679829 3300048903 Bacteria 803
235 Ga0501040_0567448 3300049576 Unclassified 819
236 Ga0501072_0190024 3300049588 Unclassified 1638
237 Ga0501075_0657513 3300049591 Unclassified 799
238 Ga0501076_0331797 3300049592 Bacteria 1248
239 Ga0501076_0986312 3300049592 Unclassified 694
240 nmdc:mga0qj67_1085573_c1 3300050509 Bacteria 626
241 nmdc:mga06r32_423236_c1 3300050510 Bacteria 1313
242 Ga0495612_0137336 3300053078 Unclassified 1059
243 Ga0500568_0001496 3300053139 Bacteria 14943
244 Ga0207685_10424540
245 rootH2_10241975
246 Ga0070658_10717877
247 Ga0070676_10402967
248 Ga0070683_100366525
249 Ga0070683_100398021
250 Ga0068869_100659263
251 Ga0070666_10196146
252 Ga0070680_100020130
253 Ga0070660_100154415
254 Ga0070667_100140698
255 Ga0070714_100099777
256 Ga0070714_101393858
257 Ga0070713_101388064
258 Ga0070681_10019182
259 Ga0070681_10617794
260 Ga0070685_11175356
261 Ga0070706_100070075
262 Ga0070699_100022533
263 Ga0070684_100223700
264 Ga0070686_101103769
265 Ga0070696_100027841
266 Ga0070665_100689386
267 Ga0070665_100857924
268 Ga0068855_100100483
269 Ga0070664_100323359
270 Ga0068857_100499637
271 Ga0068856_100393633
272 Ga0068852_100007102
273 Ga0068852_102273716
274 Ga0068864_100402711
275 Ga0068863_100324176
276 Ga0068863_101046571
277 Ga0068863_101407295
278 Ga0070717_10129719
279 Ga0070717_10137100
280 Ga0070715_10653118
281 Ga0070716_100133601
282 Ga0068871_100537008
283 Ga0068871_100606332
284 Ga0068871_100815020
285 Ga0075430_100036376
286 Ga0075431_100094206
287 Ga0105240_10000274
288 Ga0105240_10003450
289 Ga0105240_10785571
290 Ga0105240_11744104
291 Ga0111539_10537802
292 Ga0105245_10876107
293 Ga0105245_11703558
294 Ga0105247_10951502
295 Ga0105241_10304037
296 Ga0105248_10046470
297 Ga0105248_10308029
298 Ga0105248_10550868
299 Ga0105248_10703555
300 Ga0105248_10750213
301 Ga0105248_11554509
302 Ga0105248_11667323
303 Ga0105239_11058755
304 Ga0157370_10000680
305 Ga0157370_10833114
306 Ga0157369_10026651
307 Ga0157369_11540725
308 Ga0157374_11380015
309 Ga0157374_11456767
310 Ga0157374_11965097
311 Ga0157378_10113965
312 Ga0163162_10537799
313 Ga0163162_10680566
314 Ga0163162_10777331
315 Ga0163162_10849307
316 Ga0163162_11218403
317 Ga0163162_11236343
318 Ga0157372_10322925
319 Ga0157375_10081896
320 Ga0163163_10013372
321 Ga0163163_10249452
322 Ga0163163_10601576
323 Ga0157377_10203582
324 Ga0157377_11062569
325 Ga0157376_10026853
326 Ga0157376_10120414
327 Ga0157376_10294995
328 Ga0157376_10437979
329 Ga0157376_10461277
330 Ga0206356_11278958
331 Ga0213875_10077979
332 Ga0207680_11024540
333 Ga0207707_10270942
334 Ga0207695_10001788
335 Ga0207695_10857865
336 Ga0207660_10006042
337 Ga0207660_11119538
338 Ga0207700_10216495
339 Ga0207664_10077747
340 Ga0207644_10976680
341 Ga0207691_10281285
342 Ga0207711_10031527
343 Ga0207711_10623783
344 Ga0207711_10651060
345 Ga0207661_10512398
346 Ga0207661_10706833
347 Ga0207661_11051474
348 Ga0207667_10007775
349 Ga0207651_10257287
350 Ga0207677_10353724
351 Ga0207676_10197525
352 Ga0207676_10389619
353 Ga0207674_10526993
354 Ga0207698_10008513
355 Ga0207428_10291966
356 Ga0268266_10438980
357 Ga0268266_11031720
358 Ga0265323_10002294
359 Ga0265762_1028417
360 Ga0265316_10011655
361 Ga0265316_10012766
362 Ga0265316_10024734
363 Ga0265316_10037623
364 Ga0265316_10078391
365 Ga0265316_10085222
366 Ga0265316_10187122
367 Ga0265316_10214000
368 Ga0265314_10054343
369 Ga0265342_10115240
370 Ga0373926_0086643
371 Ga0373954_0575550
372 Ga0373943_0341173
373 Ga0373955_0886881
374 Ga0373935_0008083
375 Ga0373935_0105971
376 Ga0373927_0000289
377 Ga0373927_0092146
378 Ga0373933_0365634
379 Ga0373947_0003855
380 Ga0373947_0187750
381 Ga0373947_0509431
382 Ga0373947_0592918
383 Ga0373937_0395139
384 Ga0373937_0733333
385 Ga0373925_0001103
386 Ga0373925_0403873
387 Ga0373925_0632855
388 Ga0395900_1313097
389 Ga0436364_0838079
390 Ga0395901_0443392
391 Ga0436362_1020922
392 Ga0451807_2126791
393 Ga0451577_0167294
394 Ga0451577_1190714
395 Ga0453683_0008734
396 Ga0466966_0416829
397 Ga0466961_0243174
398 Ga0466963_0546499
399 Ga0466971_0291116
400 Ga0466959_0098722
401 Ga0451576_0001412
402 Ga0451576_0517394
403 Ga0451576_0517853
404 Ga0466967_0305308
405 Ga0495592_0525264
406 Ga0495629_0294095
407 Ga0495651_0015361
408 Ga0495651_0075485
409 Ga0495653_0092896
410 Ga0495580_0006216
411 Ga0495580_0008407
412 Ga0495580_0059801
413 Ga0495580_0168141
414 Ga0495580_0180203
415 Ga0495662_0004202
416 Ga0495662_0060590
417 Ga0495664_0005176
418 Ga0495664_0207244
419 Ga0495618_0319310
420 Ga0495628_0007182
421 Ga0495628_0073133
422 Ga0495628_0080589
423 Ga0495630_0093060
424 Ga0495630_0234854
425 Ga0495630_0326576
426 Ga0495630_0383253
427 Ga0495630_0591385
428 Ga0495652_0024929
429 Ga0495652_0421028
430 Ga0495665_0037083
431 Ga0495665_0127946
432 Ga0495665_0133494
433 Ga0495640_0003218
434 Ga0495586_0307729
435 Ga0495586_0692988
436 Ga0495645_0002230
437 Ga0495645_0059387
438 Ga0495645_0116160
439 Ga0495645_0130692
440 Ga0495645_0710733
441 Ga0495667_0035349
442 Ga0495667_0413222
443 Ga0495634_0048305
444 Ga0495635_0029780
445 Ga0495635_0116927
446 Ga0495635_0203353
447 Ga0495635_0367975
448 Ga0495588_0308563
449 Ga0495599_0002263
450 Ga0495599_0029523
451 Ga0495599_0545853
452 Ga0495623_0017797
453 Ga0495623_0161333
454 Ga0495623_0343178
455 Ga0495646_0017362
456 Ga0495646_0107478
457 Ga0495613_0152725
458 Ga0495624_0042733
459 Ga0495600_0012117
460 Ga0495604_0044156
461 Ga0495604_0084045
462 Ga0495604_0657077
463 Ga0495674_0011059
464 Ga0495674_0062693
465 Ga0495674_0195657
466 Ga0495674_0204100
467 Ga0495680_0128683
468 Ga0495680_0182492
469 Ga0495680_0728114
470 Ga0495675_0036543
471 Ga0495675_0420744
472 Ga0495684_0022888
473 Ga0495684_0100827
474 Ga0495684_0215853
475 Ga0495602_0030813
476 Ga0495602_0562342
477 Ga0496100_0679829
478 Ga0501040_0567448
479 Ga0501072_0190024
480 Ga0501075_0657513
481 Ga0501076_0331797
482 Ga0501076_0986312
483 nmdc:mga0qj67_1085573_c1
484 nmdc:mga06r32_423236_c1
485 Ga0495612_0137336
486 Ga0500568_0001496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

28

171

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uuy-assembly1.cif.gz_A structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism 0.9734 8 159
1o8q-assembly1.cif.gz_A the active site of the molybdenum cofactor biosenthetic protein domain cnx1g 0.9653 8 159
1o8o-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9651 8 159
1eav-assembly2.cif.gz_E crystal structures of human gephyrin and plant cnx1 g domains - comparative analysis and functional implications 0.9651 8 158
1o8n-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9628 8 161
ID Description Score Start End Superfamily
af_Q39054_458_641_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9686 8 166 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9628 8 161 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.948 1 162 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.947 6 164 3.40.980.10
2g4rC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9352 9 159 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A2V9AT34-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9957 8 161 GO:0006777
AF-A0A3N5MH46-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9891 8 165 GO:0006777
AF-A0A3D1TW10-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.988 7 161 GO:0006777
AF-A0A2V7W0H6-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9867 8 163 GO:0006777
AF-A0A7V5AKP7-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9858 7 134 GO:0006777

Map