F355503

General Info

Members Datasets Scaffolds Average Seq Length
243 179 486 120

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101094919|Ga0075434_1010949191
Length 133
Sequence VGPHGNLKEDDTMPTLIDGPTIVQAAGNKPKRIEEFAGRVNSGHGSVSVARMVSPGGWQEPGQRPEFEEITVVLRGVLRVEHENGFLDVRAGQAVVAEPGEWVRYSTLEAEGAEYIAICLPAFSPDTVHRDIS

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
148 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
152 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
153 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
154 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
155 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
164 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
165 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 1.23
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 24.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_101094919 3300006871 Unclassified 810
2 Ga0065712_10307136 3300005290 Unclassified 844
3 Ga0070690_100814983 3300005330 Unclassified 725
4 Ga0070670_101599865 3300005331 Bacteria 599
5 Ga0068869_100236967 3300005334 Bacteria 1452
6 Ga0068869_100434631 3300005334 Bacteria 1085
7 Ga0070666_10016625 3300005335 Unclassified 4708
8 Ga0068868_100027214 3300005338 Unclassified 4362
9 Ga0070689_100390156 3300005340 Bacteria 1175
10 Ga0070661_100648718 3300005344 Unclassified 857
11 Ga0070669_101240036 3300005353 Bacteria 645
12 Ga0070675_100328671 3300005354 Eukaryota 1352
13 Ga0070675_100658249 3300005354 Bacteria 952
14 Ga0070713_100319800 3300005436 Unclassified 1433
15 Ga0070701_10667642 3300005438 Unclassified 696
16 Ga0070711_101163993 3300005439 Bacteria 666
17 Ga0070681_10085179 3300005458 Bacteria 3113
18 Ga0070681_10639108 3300005458 Bacteria 979
19 Ga0070685_10495400 3300005466 Unclassified 864
20 Ga0070707_100437070 3300005468 Bacteria 1269
21 Ga0070679_100200426 3300005530 Unclassified 1962
22 Ga0070679_100224446 3300005530 Bacteria 1839
23 Ga0070686_101470185 3300005544 Unclassified 573
24 Ga0070665_100128376 3300005548 Unclassified 2538
25 Ga0068855_100034724 3300005563 Bacteria 6010
26 Ga0070664_101711849 3300005564 Bacteria 596
27 Ga0068857_100013677 3300005577 Bacteria 7071
28 Ga0068854_100195984 3300005578 Bacteria 1585
29 Ga0070702_100804457 3300005615 Bacteria 727
30 Ga0068859_100095263 3300005617 Unclassified 3029
31 Ga0068859_100333257 3300005617 Bacteria 1612
32 Ga0068859_101032977 3300005617 Bacteria 903
33 Ga0068864_100646479 3300005618 Unclassified 1029
34 Ga0068863_100062853 3300005841 Unclassified 3511
35 Ga0068858_100347939 3300005842 Unclassified 1419
36 Ga0068860_100269500 3300005843 Unclassified 1661
37 Ga0068860_100909626 3300005843 Bacteria 896
38 Ga0070715_10536053 3300006163 Bacteria 676
39 Ga0075366_10172724 3300006195 Bacteria 1312
40 Ga0097621_100014953 3300006237 Bacteria 5825
41 Ga0068871_100021593 3300006358 Unclassified 4950
42 Ga0075428_100033053 3300006844 Bacteria 5712
43 Ga0075428_101152366 3300006844 Bacteria 818
44 Ga0075430_100145014 3300006846 Unclassified 1978
45 Ga0075430_100406694 3300006846 Bacteria 1123
46 Ga0075430_100653539 3300006846 Bacteria 867
47 Ga0075431_100040915 3300006847 Bacteria 4778
48 Ga0075431_100052639 3300006847 Bacteria 4198
49 Ga0075431_100719538 3300006847 Unclassified 975
50 Ga0075434_100692795 3300006871 Bacteria 1036
51 Ga0075429_100006280 3300006880 Bacteria 10284
52 Ga0075429_100059153 3300006880 Bacteria 3338
53 Ga0075436_100001995 3300006914 Bacteria 14089
54 Ga0097620_100095258 3300006931 Unclassified 3029
55 Ga0097620_100333252 3300006931 Bacteria 1612
56 Ga0097620_101033299 3300006931 Bacteria 903
57 Ga0105240_12629423 3300009093 Unclassified 520
58 Ga0111539_10000524 3300009094 Bacteria 48488
59 Ga0111539_10104795 3300009094 Bacteria 3318
60 Ga0111539_10845307 3300009094 Bacteria 1065
61 Ga0111539_10993366 3300009094 Unclassified 976
62 Ga0111539_12516407 3300009094 Unclassified 597
63 Ga0105245_10008995 3300009098 Bacteria 8709
64 Ga0114129_10000575 3300009147 Bacteria 45249
65 Ga0114129_10175977 3300009147 Bacteria 2915
66 Ga0114129_10189407 3300009147 Bacteria 2794
67 Ga0114129_10200143 3300009147 Bacteria 2706
68 Ga0114129_10514799 3300009147 Bacteria 1561
69 Ga0114129_11319625 3300009147 Unclassified 893
70 Ga0105243_11586089 3300009148 Bacteria 681
71 Ga0105243_13119930 3300009148 Unclassified 502
72 Ga0105242_10006612 3300009176 Bacteria 8933
73 Ga0105242_10037735 3300009176 Bacteria 3883
74 Ga0105242_10249352 3300009176 Unclassified 1599
75 Ga0105248_10056559 3300009177 Unclassified 4401
76 Ga0105248_10653464 3300009177 Bacteria 1186
77 Ga0105249_10034934 3300009553 Bacteria 4557
78 Ga0157373_10654348 3300013100 Bacteria 768
79 Ga0157369_10464612 3300013105 Bacteria 1310
80 Ga0157378_10959022 3300013297 Bacteria 888
81 Ga0163162_10071859 3300013306 Bacteria 3514
82 Ga0163162_10112278 3300013306 Unclassified 2824
83 Ga0163163_10003772 3300014325 Bacteria 12909
84 Ga0163163_10022817 3300014325 Bacteria 5932
85 Ga0157380_10195603 3300014326 Bacteria 1789
86 Ga0157379_11838816 3300014968 Unclassified 596
87 Ga0157376_10042277 3300014969 Unclassified 3735
88 Ga0163161_11287437 3300017792 Unclassified 635
89 Ga0207680_10002974 3300025903 Bacteria 7949
90 Ga0207685_10101725 3300025905 Unclassified 1230
91 Ga0207663_10680261 3300025916 Bacteria 813
92 Ga0207652_10120638 3300025921 Unclassified 2332
93 Ga0207652_10561241 3300025921 Bacteria 1025
94 Ga0207681_10665536 3300025923 Unclassified 864
95 Ga0207650_10759837 3300025925 Bacteria 820
96 Ga0207659_10418032 3300025926 Unclassified 1124
97 Ga0207686_10023767 3300025934 Unclassified 3542
98 Ga0207711_10314875 3300025941 Unclassified 1445
99 Ga0207689_10480753 3300025942 Bacteria 1040
100 Ga0207679_11446753 3300025945 Bacteria 630
101 Ga0207667_10096344 3300025949 Bacteria 3054
102 Ga0207712_10469234 3300025961 Bacteria 1071
103 Ga0207640_10506230 3300025981 Bacteria 1007
104 Ga0207658_10732283 3300025986 Bacteria 895
105 Ga0207658_11459734 3300025986 Archaea 626
106 Ga0207677_10017664 3300026023 Unclassified 4261
107 Ga0207703_10015097 3300026035 Bacteria 6029
108 Ga0207708_10000041 3300026075 Bacteria 126142
109 Ga0207641_10366362 3300026088 Bacteria 1377
110 Ga0207648_10112639 3300026089 Bacteria 2389
111 Ga0207648_11668867 3300026089 Bacteria 599
112 Ga0207674_10010571 3300026116 Bacteria 10443
113 Ga0207428_11205403 3300027907 Bacteria 526
114 Ga0268266_10128042 3300028379 Unclassified 2268
115 Ga0268264_10273727 3300028381 Unclassified 1578
116 Ga0265326_10000549 3300028558 Bacteria 14031
117 Ga0265319_1002231 3300028563 Bacteria 10761
118 Ga0265334_10258612 3300028573 Unclassified 599
119 Ga0265318_10045273 3300028577 Bacteria 1663
120 Ga0265323_10000643 3300028653 Bacteria 19024
121 Ga0265322_10000857 3300028654 Bacteria 10832
122 Ga0265338_10029330 3300028800 Bacteria 5455
123 Ga0265324_10001507 3300029957 Bacteria 13174
124 Ga0265330_10003531 3300031235 Bacteria 8143
125 Ga0265332_10001114 3300031238 Bacteria 15684
126 Ga0265320_10001918 3300031240 Bacteria 14680
127 Ga0265325_10454827 3300031241 Unclassified 557
128 Ga0265329_10000466 3300031242 Bacteria 21132
129 Ga0265339_10001251 3300031249 Bacteria 19114
130 Ga0265331_10027230 3300031250 Bacteria 2867
131 Ga0265316_10013006 3300031344 Bacteria 7425
132 Ga0307408_100088419 3300031548 Bacteria 2333
133 Ga0316579_10226050 3300031691 Bacteria 905
134 Ga0265314_10003244 3300031711 Bacteria 15901
135 Ga0265342_10002960 3300031712 Bacteria 14289
136 Ga0316576_10399466 3300031727 Bacteria 1018
137 Ga0316576_10822485 3300031727 Unclassified 668
138 Ga0316578_10018070 3300031728 Bacteria 3854
139 Ga0307416_100041170 3300032002 Unclassified 3596
140 Ga0307411_10039198 3300032005 Bacteria 2995
141 Ga0307411_10410765 3300032005 Bacteria 1122
142 Ga0373943_0376236 3300035170 Bacteria 817
143 Ga0373947_0673544 3300035725 Bacteria 705
144 Ga0373937_0856656 3300036401 Bacteria 857
145 Ga0316582_0212549 3300036647 Bacteria 1322
146 Ga0316584_0335881 3300036712 Bacteria 1087
147 Ga0373925_0338103 3300037068 Bacteria 1221
148 Ga0395905_0261770 3300037471 Bacteria 1615
149 Ga0395905_0427179 3300037471 Bacteria 1222
150 Ga0439453_0044153 3300041408 Bacteria 883
151 Ga0439433_0010990 3300041999 Bacteria 1980
152 Ga0439448_0022998 3300042005 Unclassified 1941
153 Ga0439462_0022108 3300042015 Bacteria 1664
154 Ga0439446_0032899 3300042156 Unclassified 1506
155 Ga0439434_0067043 3300042435 Bacteria 1127
156 Ga0439435_0006083 3300042436 Bacteria 2695
157 Ga0439435_0071634 3300042436 Bacteria 1027
158 Ga0453683_1012269 3300044673 Unclassified 552
159 Ga0451576_0142236 3300045051 Unclassified 2501
160 Ga0451576_0261572 3300045051 Bacteria 1809
161 Ga0451576_1675835 3300045051 Bacteria 659
162 Ga0495662_0291642 3300046476 Bacteria 803
163 Ga0495628_0527642 3300046516 Bacteria 850
164 Ga0495645_0165403 3300046543 Bacteria 1526
165 Ga0495599_0082144 3300046678 Bacteria 2013
166 Ga0495658_0561726 3300046683 Bacteria 731
167 Ga0495613_0139651 3300046689 Bacteria 1732
168 Ga0495613_0678424 3300046689 Bacteria 680
169 Ga0495674_0770459 3300047319 Bacteria 750
170 Ga0495684_0242155 3300047471 Bacteria 1315
171 Ga0495684_0657704 3300047471 Bacteria 700
172 Ga0496105_1421384 3300048908 Unclassified 502
173 Ga0496112_1879472 3300048915 Unclassified 510
174 Ga0496115_0480388 3300048918 Unclassified 1001
175 Ga0501290_079863 3300049513 Bacteria 556
176 Ga0501300_049543 3300049523 Bacteria 646
177 Ga0501031_0151681 3300049568 Bacteria 1514
178 Ga0501036_0025964 3300049572 Bacteria 4943
179 Ga0501039_0036806 3300049575 Bacteria 3776
180 Ga0501040_0582497 3300049576 Unclassified 808
181 Ga0501041_0044624 3300049577 Bacteria 2694
182 Ga0501042_0121092 3300049578 Bacteria 1884
183 Ga0501043_0441448 3300049579 Bacteria 979
184 Ga0501067_0574216 3300049583 Unclassified 632
185 Ga0501071_0028625 3300049587 Bacteria 3928
186 Ga0501074_0120981 3300049590 Bacteria 1872
187 Ga0501075_0018691 3300049591 Bacteria 5019
188 Ga0501075_0780643 3300049591 Bacteria 727
189 Ga0501076_0067617 3300049592 Bacteria 2853
190 Ga0501076_0672063 3300049592 Bacteria 855
191 Ga0501076_1481257 3300049592 Bacteria 557
192 Ga0501202_132232 3300049652 Bacteria 637
193 Ga0501206_012335 3300049653 Bacteria 1160
194 Ga0501207_024450 3300049654 Bacteria 986
195 Ga0501209_251487 3300049656 Bacteria 552
196 Ga0501216_042843 3300049660 Bacteria 870
197 Ga0501243_098703 3300049675 Bacteria 587
198 Ga0501248_013421 3300049678 Bacteria 766
199 Ga0501252_050001 3300049682 Bacteria 629
200 Ga0501256_020708 3300049685 Bacteria 689
201 Ga0501259_091864 3300049688 Bacteria 683
202 Ga0501225_0134307 3300049705 Bacteria 744
203 Ga0501245_025473 3300049708 Bacteria 951
204 Ga0501079_0053780 3300049741 Bacteria 3106
205 Ga0501080_0188711 3300049742 Bacteria 1894
206 Ga0501080_0696832 3300049742 Unclassified 896
207 Ga0501081_0150214 3300049743 Bacteria 1673
208 Ga0501083_0223392 3300049744 Bacteria 1227
209 Ga0501263_068392 3300049760 Unclassified 569
210 Ga0501264_053639 3300049761 Bacteria 526
211 Ga0501276_019308 3300049773 Bacteria 641
212 Ga0501045_0004841 3300049824 Bacteria 9314
213 nmdc:mga05p37_117541_c2 3300050507 Bacteria 1891
214 nmdc:mga05p37_1959016_c1 3300050507 Bacteria 556
215 nmdc:mga05p37_287222_c1 3300050507 Bacteria 1959
216 nmdc:mga05p37_300367_c1 3300050507 Bacteria 1908
217 nmdc:mga05p37_340157_c1 3300050507 Bacteria 1770
218 nmdc:mga05p37_40219_c1 3300050507 Bacteria 5742
219 nmdc:mga05p37_7736_c1 3300050507 Bacteria 12683
220 nmdc:mga05p37_95107_c1 3300050507 Bacteria 3670
221 nmdc:mga09592_131660_c1 3300050508 Bacteria 2152
222 nmdc:mga09592_4785_c1 3300050508 Bacteria 10965
223 nmdc:mga09592_528753_c1 3300050508 Bacteria 1014
224 nmdc:mga0qj67_120860_c1 3300050509 Unclassified 2119
225 nmdc:mga0qj67_21248_c1 3300050509 Bacteria 4979
226 nmdc:mga0qj67_4974_c1 3300050509 Bacteria 9658
227 nmdc:mga0qj67_82811_c1 3300050509 Unclassified 2572
228 nmdc:mga06r32_1087969_c1 3300050510 Bacteria 749
229 nmdc:mga06r32_1513519_c1 3300050510 Bacteria 611
230 nmdc:mga06r32_277331_c1 3300050510 Bacteria 1664
231 nmdc:mga06r32_56421_c1 3300050510 Bacteria 3771
232 nmdc:mga06r32_91064_c1 3300050510 Bacteria 2980
233 nmdc:mga08y16_158611_c1 3300050511 Bacteria 2351
234 nmdc:mga08y16_1671871_c1 3300050511 Bacteria 593
235 nmdc:mga08y16_4968_c1 3300050511 Bacteria 13900
236 nmdc:mga0n895_778992_c1 3300050512 Bacteria 948
237 nmdc:mga0rr50_1251596_c1 3300050513 Unclassified 630
238 nmdc:mga08x19_1892_c1 3300050514 Bacteria 12821
239 nmdc:mga0a205_20311_c1 3300050515 Bacteria 6265
240 Ga0495595_0440675 3300053084 Bacteria 662
241 Ga0501082_0728565 3300060353 Bacteria 868
242 Ga0530510_0013273 3300061734 Bacteria 5791
243 2837185166 2837183177 Bacteria 4637169
244 Ga0075434_101094919
245 Ga0065712_10307136
246 Ga0070690_100814983
247 Ga0070670_101599865
248 Ga0068869_100236967
249 Ga0068869_100434631
250 Ga0070666_10016625
251 Ga0068868_100027214
252 Ga0070689_100390156
253 Ga0070661_100648718
254 Ga0070669_101240036
255 Ga0070675_100328671
256 Ga0070675_100658249
257 Ga0070713_100319800
258 Ga0070701_10667642
259 Ga0070711_101163993
260 Ga0070681_10085179
261 Ga0070681_10639108
262 Ga0070685_10495400
263 Ga0070707_100437070
264 Ga0070679_100200426
265 Ga0070679_100224446
266 Ga0070686_101470185
267 Ga0070665_100128376
268 Ga0068855_100034724
269 Ga0070664_101711849
270 Ga0068857_100013677
271 Ga0068854_100195984
272 Ga0070702_100804457
273 Ga0068859_100095263
274 Ga0068859_100333257
275 Ga0068859_101032977
276 Ga0068864_100646479
277 Ga0068863_100062853
278 Ga0068858_100347939
279 Ga0068860_100269500
280 Ga0068860_100909626
281 Ga0070715_10536053
282 Ga0075366_10172724
283 Ga0097621_100014953
284 Ga0068871_100021593
285 Ga0075428_100033053
286 Ga0075428_101152366
287 Ga0075430_100145014
288 Ga0075430_100406694
289 Ga0075430_100653539
290 Ga0075431_100040915
291 Ga0075431_100052639
292 Ga0075431_100719538
293 Ga0075434_100692795
294 Ga0075429_100006280
295 Ga0075429_100059153
296 Ga0075436_100001995
297 Ga0097620_100095258
298 Ga0097620_100333252
299 Ga0097620_101033299
300 Ga0105240_12629423
301 Ga0111539_10000524
302 Ga0111539_10104795
303 Ga0111539_10845307
304 Ga0111539_10993366
305 Ga0111539_12516407
306 Ga0105245_10008995
307 Ga0114129_10000575
308 Ga0114129_10175977
309 Ga0114129_10189407
310 Ga0114129_10200143
311 Ga0114129_10514799
312 Ga0114129_11319625
313 Ga0105243_11586089
314 Ga0105243_13119930
315 Ga0105242_10006612
316 Ga0105242_10037735
317 Ga0105242_10249352
318 Ga0105248_10056559
319 Ga0105248_10653464
320 Ga0105249_10034934
321 Ga0157373_10654348
322 Ga0157369_10464612
323 Ga0157378_10959022
324 Ga0163162_10071859
325 Ga0163162_10112278
326 Ga0163163_10003772
327 Ga0163163_10022817
328 Ga0157380_10195603
329 Ga0157379_11838816
330 Ga0157376_10042277
331 Ga0163161_11287437
332 Ga0207680_10002974
333 Ga0207685_10101725
334 Ga0207663_10680261
335 Ga0207652_10120638
336 Ga0207652_10561241
337 Ga0207681_10665536
338 Ga0207650_10759837
339 Ga0207659_10418032
340 Ga0207686_10023767
341 Ga0207711_10314875
342 Ga0207689_10480753
343 Ga0207679_11446753
344 Ga0207667_10096344
345 Ga0207712_10469234
346 Ga0207640_10506230
347 Ga0207658_10732283
348 Ga0207658_11459734
349 Ga0207677_10017664
350 Ga0207703_10015097
351 Ga0207708_10000041
352 Ga0207641_10366362
353 Ga0207648_10112639
354 Ga0207648_11668867
355 Ga0207674_10010571
356 Ga0207428_11205403
357 Ga0268266_10128042
358 Ga0268264_10273727
359 Ga0265326_10000549
360 Ga0265319_1002231
361 Ga0265334_10258612
362 Ga0265318_10045273
363 Ga0265323_10000643
364 Ga0265322_10000857
365 Ga0265338_10029330
366 Ga0265324_10001507
367 Ga0265330_10003531
368 Ga0265332_10001114
369 Ga0265320_10001918
370 Ga0265325_10454827
371 Ga0265329_10000466
372 Ga0265339_10001251
373 Ga0265331_10027230
374 Ga0265316_10013006
375 Ga0307408_100088419
376 Ga0316579_10226050
377 Ga0265314_10003244
378 Ga0265342_10002960
379 Ga0316576_10399466
380 Ga0316576_10822485
381 Ga0316578_10018070
382 Ga0307416_100041170
383 Ga0307411_10039198
384 Ga0307411_10410765
385 Ga0373943_0376236
386 Ga0373947_0673544
387 Ga0373937_0856656
388 Ga0316582_0212549
389 Ga0316584_0335881
390 Ga0373925_0338103
391 Ga0395905_0261770
392 Ga0395905_0427179
393 Ga0439453_0044153
394 Ga0439433_0010990
395 Ga0439448_0022998
396 Ga0439462_0022108
397 Ga0439446_0032899
398 Ga0439434_0067043
399 Ga0439435_0006083
400 Ga0439435_0071634
401 Ga0453683_1012269
402 Ga0451576_0142236
403 Ga0451576_0261572
404 Ga0451576_1675835
405 Ga0495662_0291642
406 Ga0495628_0527642
407 Ga0495645_0165403
408 Ga0495599_0082144
409 Ga0495658_0561726
410 Ga0495613_0139651
411 Ga0495613_0678424
412 Ga0495674_0770459
413 Ga0495684_0242155
414 Ga0495684_0657704
415 Ga0496105_1421384
416 Ga0496112_1879472
417 Ga0496115_0480388
418 Ga0501290_079863
419 Ga0501300_049543
420 Ga0501031_0151681
421 Ga0501036_0025964
422 Ga0501039_0036806
423 Ga0501040_0582497
424 Ga0501041_0044624
425 Ga0501042_0121092
426 Ga0501043_0441448
427 Ga0501067_0574216
428 Ga0501071_0028625
429 Ga0501074_0120981
430 Ga0501075_0018691
431 Ga0501075_0780643
432 Ga0501076_0067617
433 Ga0501076_0672063
434 Ga0501076_1481257
435 Ga0501202_132232
436 Ga0501206_012335
437 Ga0501207_024450
438 Ga0501209_251487
439 Ga0501216_042843
440 Ga0501243_098703
441 Ga0501248_013421
442 Ga0501252_050001
443 Ga0501256_020708
444 Ga0501259_091864
445 Ga0501225_0134307
446 Ga0501245_025473
447 Ga0501079_0053780
448 Ga0501080_0188711
449 Ga0501080_0696832
450 Ga0501081_0150214
451 Ga0501083_0223392
452 Ga0501263_068392
453 Ga0501264_053639
454 Ga0501276_019308
455 Ga0501045_0004841
456 nmdc:mga05p37_117541_c2
457 nmdc:mga05p37_1959016_c1
458 nmdc:mga05p37_287222_c1
459 nmdc:mga05p37_300367_c1
460 nmdc:mga05p37_340157_c1
461 nmdc:mga05p37_40219_c1
462 nmdc:mga05p37_7736_c1
463 nmdc:mga05p37_95107_c1
464 nmdc:mga09592_131660_c1
465 nmdc:mga09592_4785_c1
466 nmdc:mga09592_528753_c1
467 nmdc:mga0qj67_120860_c1
468 nmdc:mga0qj67_21248_c1
469 nmdc:mga0qj67_4974_c1
470 nmdc:mga0qj67_82811_c1
471 nmdc:mga06r32_1087969_c1
472 nmdc:mga06r32_1513519_c1
473 nmdc:mga06r32_277331_c1
474 nmdc:mga06r32_56421_c1
475 nmdc:mga06r32_91064_c1
476 nmdc:mga08y16_158611_c1
477 nmdc:mga08y16_1671871_c1
478 nmdc:mga08y16_4968_c1
479 nmdc:mga0n895_778992_c1
480 nmdc:mga0rr50_1251596_c1
481 nmdc:mga08x19_1892_c1
482 nmdc:mga0a205_20311_c1
483 Ga0495595_0440675
484 Ga0501082_0728565
485 Ga0530510_0013273
486 2837185166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9165 33 109
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9127 34 108
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9029 19 109
7zyb-assembly1.cif.gz_A bekdgf with ca 0.8974 8 111
4axo-assembly1.cif.gz_B structure of the clostridium difficile eutq protein 0.897 19 110
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9441 34 108 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9438 33 112 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9159 21 120 2.60.120.10
af_Q4D641_20_259_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9121 35 108 2.60.120.650
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9005 19 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3C0AUA2-F1-model_v4 Cupin 0.9996 25 109
AF-A0A7V1UML9-F1-model_v4 Cupin 0.9984 1 120
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.998 1 119
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9953 1 120
AF-Q2IDL1-F1-model_v4 Cupin domain protein 0.9934 1 120

Map