F355355

General Info

Members Datasets Scaffolds Average Seq Length
243 123 242 320

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100260646|Ga0070667_1002606462
Length 357
Sequence LNLFQYKVKFANAQQYKGNTTILPVDCDSPSSYICSMKHISILPLYDATMTSIDSSHQILTRVNDFMKYQGKPPFYDVEIVGLEKNTKLNEGLYNIHVDKTIDQVKKTDVIIIPLLCSDFPNAILRNKKYTDWVIAQYHTNAEIVCLCVGSFFLASTGLMKNRKCAVHWAAKNEFKTMFPDVKIIDDTIITDEKGIYTCGGGYSYLNLLLYIIEKHLGREISILASKMFEIDIERKSQNPFVIFMGQKRHGDEVVLRAQEFIETNPTATFTVDELCDKFGVGRRTFERRFKKHTGNSIVEYIQRVKVEFAKKHLERGRKTVNEIIYEAGYNDIDAFRKVFKKFTDLSPIDYRKKYAV

Samples

Sample ID Description Type Environment
1 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
121 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0
Rhizoplane 0
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006913 3300003215 Bacteria 5664
2 rootH1_10039015 3300003316 Bacteria 6388
3 rootH2_10034584 3300003320 Bacteria 27131
4 rootH2_10057761 3300003320 Bacteria 11635
5 rootH2_10323498 3300003320 Unclassified 1242
6 rootL2_10090491 3300003322 Bacteria 7028
7 rootL2_10186392 3300003322 Bacteria 1909
8 rootL2_10364155 3300003322 Unclassified 1144
9 rootH1_10024310 3300003323 Bacteria 54858
10 rootH1_10152834 3300003323 Bacteria 1979
11 rootH1_10357378 3300003323 Bacteria 1182
12 Ga0055531_10000270 3300003794 Bacteria 53886
13 Ga0070676_10043018 3300005328 Bacteria 2624
14 Ga0070683_100003664 3300005329 Bacteria 12523
15 Ga0070670_100061251 3300005331 Bacteria 3231
16 Ga0070677_10026026 3300005333 Bacteria 2190
17 Ga0068869_100073082 3300005334 Bacteria 2542
18 Ga0068869_100082247 3300005334 Bacteria 2406
19 Ga0070666_10045504 3300005335 Bacteria 2942
20 Ga0070680_100044115 3300005336 Unclassified 3623
21 Ga0068868_100033046 3300005338 Bacteria 3986
22 Ga0070669_100067741 3300005353 Bacteria 2634
23 Ga0070674_100069016 3300005356 Bacteria 2492
24 Ga0070673_100034232 3300005364 Bacteria 3842
25 Ga0070667_100018915 3300005367 Bacteria 5711
26 Ga0070667_100260646 3300005367 Bacteria 1552
27 Ga0070685_10053651 3300005466 Bacteria 2336
28 Ga0070679_100059674 3300005530 Unclassified 3802
29 Ga0068853_100058102 3300005539 Bacteria 3339
30 Ga0070672_100026359 3300005543 Bacteria 4323
31 Ga0070665_100001316 3300005548 Bacteria 29624
32 Ga0070665_100138998 3300005548 Bacteria 2432
33 Ga0068855_100007754 3300005563 Bacteria 12964
34 Ga0068855_100010852 3300005563 Bacteria 10998
35 Ga0068855_100037578 3300005563 Bacteria 5757
36 Ga0068855_100078095 3300005563 Unclassified 3841
37 Ga0068855_100098255 3300005563 Bacteria 3373
38 Ga0070664_100037681 3300005564 Bacteria 4066
39 Ga0068857_100006663 3300005577 Bacteria 9925
40 Ga0068857_100240348 3300005577 Bacteria 1658
41 Ga0068854_100023971 3300005578 Bacteria 4173
42 Ga0068856_100075146 3300005614 Unclassified 3347
43 Ga0068856_100141198 3300005614 Unclassified 2416
44 Ga0068852_100001851 3300005616 Bacteria 14377
45 Ga0068852_100028518 3300005616 Bacteria 4571
46 Ga0068859_100001431 3300005617 Bacteria 24204
47 Ga0068859_100060331 3300005617 Bacteria 3822
48 Ga0068864_100100504 3300005618 Bacteria 2564
49 Ga0068861_100171395 3300005719 Bacteria 1799
50 Ga0068870_10073550 3300005840 Bacteria 1870
51 Ga0068858_100266954 3300005842 Bacteria 1628
52 Ga0068860_100001241 3300005843 Bacteria 27834
53 Ga0068860_100003789 3300005843 Bacteria 15555
54 Ga0068860_100006432 3300005843 Bacteria 11797
55 Ga0068860_100087758 3300005843 Bacteria 2961
56 Ga0068860_100125982 3300005843 Bacteria 2455
57 Ga0068862_100066167 3300005844 Bacteria 3113
58 Ga0068862_100145516 3300005844 Bacteria 2106
59 Ga0097621_100012310 3300006237 Bacteria 6334
60 Ga0097621_100203872 3300006237 Bacteria 1718
61 Ga0068871_100016038 3300006358 Bacteria 5630
62 Ga0068871_100031199 3300006358 Unclassified 4201
63 Ga0075428_100024173 3300006844 Bacteria 6722
64 Ga0068865_100010029 3300006881 Bacteria 5891
65 Ga0097620_100001431 3300006931 Bacteria 24204
66 Ga0097620_100060333 3300006931 Bacteria 3822
67 Ga0105240_10005313 3300009093 Bacteria 19214
68 Ga0105240_10009144 3300009093 Bacteria 14063
69 Ga0105240_10009399 3300009093 Bacteria 13844
70 Ga0105240_10015654 3300009093 Bacteria 10300
71 Ga0105240_10029054 3300009093 Bacteria 7210
72 Ga0105240_10038457 3300009093 Bacteria 6137
73 Ga0105240_10052981 3300009093 Bacteria 5097
74 Ga0105240_10082265 3300009093 Bacteria 3954
75 Ga0105240_10092586 3300009093 Bacteria 3691
76 Ga0105240_10145129 3300009093 Bacteria 2833
77 Ga0105240_10229874 3300009093 Bacteria 2156
78 Ga0111539_10048835 3300009094 Bacteria 5050
79 Ga0111539_10282948 3300009094 Bacteria 1930
80 Ga0111539_10628900 3300009094 Bacteria 1250
81 Ga0105245_10448543 3300009098 Bacteria 1298
82 Ga0105247_10219120 3300009101 Bacteria 1287
83 Ga0105241_10062809 3300009174 Bacteria 2864
84 Ga0105241_10069040 3300009174 Bacteria 2739
85 Ga0105241_10080504 3300009174 Plasmid 2550
86 Ga0105241_10094886 3300009174 Unclassified 2360
87 Ga0105241_10224309 3300009174 Bacteria 1581
88 Ga0105242_10050997 3300009176 Bacteria 3371
89 Ga0105237_10003056 3300009545 Bacteria 20184
90 Ga0105237_10005461 3300009545 Bacteria 14336
91 Ga0105237_10007171 3300009545 Bacteria 12245
92 Ga0105237_10012579 3300009545 Bacteria 8914
93 Ga0105237_10039424 3300009545 Bacteria 4769
94 Ga0105237_10064456 3300009545 Bacteria 3660
95 Ga0105237_10098436 3300009545 Bacteria 2916
96 Ga0105237_10121657 3300009545 Bacteria 2605
97 Ga0105238_10041595 3300009551 Bacteria 4654
98 Ga0105238_10051949 3300009551 Bacteria 4121
99 Ga0105238_10097179 3300009551 Bacteria 2931
100 Ga0105238_10116428 3300009551 Unclassified 2652
101 Ga0105238_10260525 3300009551 Bacteria 1713
102 Ga0105249_10019990 3300009553 Bacteria 5979
103 Ga0105239_10000005 3300010375 Bacteria 496066
104 Ga0105239_10000042 3300010375 Bacteria 199662
105 Ga0105239_10000907 3300010375 Bacteria 42159
106 Ga0105239_10003398 3300010375 Bacteria 19515
107 Ga0105239_10004744 3300010375 Bacteria 16140
108 Ga0105239_10014518 3300010375 Bacteria 8739
109 Ga0105239_10038020 3300010375 Bacteria 5275
110 Ga0105239_10042274 3300010375 Bacteria 4995
111 Ga0105239_10077220 3300010375 Bacteria 3665
112 Ga0105239_10223017 3300010375 Bacteria 2114
113 Ga0105239_10400296 3300010375 Bacteria 1554
114 Ga0105246_10013455 3300011119 Bacteria 5130
115 Ga0157373_10150988 3300013100 Bacteria 1634
116 Ga0157371_10011616 3300013102 Bacteria 6769
117 Ga0157370_10008198 3300013104 Bacteria 11288
118 Ga0157370_10089466 3300013104 Bacteria 2892
119 Ga0157369_10045403 3300013105 Bacteria 4779
120 Ga0157369_10309058 3300013105 Bacteria 1644
121 Ga0157374_10000013 3300013296 Bacteria 461240
122 Ga0157374_10066061 3300013296 Bacteria 3399
123 Ga0157374_10083021 3300013296 Bacteria 3043
124 Ga0157374_10108524 3300013296 Unclassified 2668
125 Ga0157374_10126365 3300013296 Unclassified 2472
126 Ga0157374_10395859 3300013296 Bacteria 1377
127 Ga0157374_10693513 3300013296 Bacteria 1031
128 Ga0157378_10105662 3300013297 Bacteria 2575
129 Ga0157378_10260322 3300013297 Bacteria 1664
130 Ga0157378_10362151 3300013297 Bacteria 1419
131 Ga0157378_10363361 3300013297 Bacteria 1417
132 Ga0163162_10000693 3300013306 Bacteria 31115
133 Ga0163162_10021550 3300013306 Bacteria 6348
134 Ga0163162_10043619 3300013306 Bacteria 4491
135 Ga0157372_10000664 3300013307 Bacteria 37802
136 Ga0157372_10009461 3300013307 Bacteria 10363
137 Ga0157372_10026794 3300013307 Bacteria 6275
138 Ga0157372_10032132 3300013307 Bacteria 5753
139 Ga0157372_10053112 3300013307 Bacteria 4515
140 Ga0157372_10084670 3300013307 Unclassified 3594
141 Ga0157375_10050323 3300013308 Bacteria 4086
142 Ga0157375_10225521 3300013308 Bacteria 2033
143 Ga0157375_10319642 3300013308 Bacteria 1717
144 Ga0157379_10080907 3300014968 Bacteria 2910
145 Ga0157379_10284657 3300014968 Bacteria 1504
146 Ga0157376_10034329 3300014969 Bacteria 4095
147 Ga0207427_100091 3300025231 Bacteria 133410
148 Ga0209437_100026 3300025233 Bacteria 542698
149 Ga0209233_1000111 3300025261 Bacteria 260262
150 Ga0209455_1001713 3300025272 Bacteria 9390
151 Ga0209564_1015364 3300025295 Bacteria 3120
152 Ga0209758_1001657 3300025297 Bacteria 25246
153 Ga0209257_1000007 3300025304 Bacteria 1564415
154 Ga0207647_10009313 3300025904 Bacteria 6982
155 Ga0207647_10011614 3300025904 Bacteria 6168
156 Ga0207645_10000168 3300025907 Bacteria 52201
157 Ga0207705_10118250 3300025909 Unclassified 1964
158 Ga0207654_10140888 3300025911 Bacteria 1537
159 Ga0207695_10013196 3300025913 Bacteria 9859
160 Ga0207695_10014235 3300025913 Bacteria 9436
161 Ga0207695_10029353 3300025913 Bacteria 6080
162 Ga0207695_10037125 3300025913 Bacteria 5258
163 Ga0207695_10055312 3300025913 Bacteria 4136
164 Ga0207695_10075838 3300025913 Bacteria 3420
165 Ga0207695_10147633 3300025913 Bacteria 2294
166 Ga0207695_10382020 3300025913 Bacteria 1294
167 Ga0207671_10001820 3300025914 Bacteria 23785
168 Ga0207671_10006926 3300025914 Bacteria 9993
169 Ga0207671_10008633 3300025914 Bacteria 8609
170 Ga0207671_10045978 3300025914 Bacteria 3228
171 Ga0207671_10061880 3300025914 Bacteria 2778
172 Ga0207671_10062606 3300025914 Unclassified 2763
173 Ga0207671_10067729 3300025914 Unclassified 2659
174 Ga0207657_10303818 3300025919 Bacteria 1264
175 Ga0207652_10001615 3300025921 Bacteria 19812
176 Ga0207681_10029752 3300025923 Bacteria 3553
177 Ga0207694_10122627 3300025924 Bacteria 2076
178 Ga0207694_10190967 3300025924 Bacteria 1664
179 Ga0207694_10264339 3300025924 Bacteria 1410
180 Ga0207650_10043575 3300025925 Bacteria 3294
181 Ga0207704_10010577 3300025938 Unclassified 4507
182 Ga0207691_10042753 3300025940 Bacteria 4176
183 Ga0207689_10003307 3300025942 Bacteria 14760
184 Ga0207689_10027906 3300025942 Bacteria 4722
185 Ga0207689_10065713 3300025942 Unclassified 2983
186 Ga0207661_10073627 3300025944 Bacteria 2798
187 Ga0207679_10122971 3300025945 Bacteria 2069
188 Ga0207667_10004032 3300025949 Bacteria 18045
189 Ga0207667_10020144 3300025949 Bacteria 7426
190 Ga0207667_10068790 3300025949 Unclassified 3686
191 Ga0207651_10023149 3300025960 Bacteria 3814
192 Ga0207712_10041037 3300025961 Bacteria 3178
193 Ga0207640_10034243 3300025981 Bacteria 3168
194 Ga0207658_10049560 3300025986 Unclassified 3087
195 Ga0207639_10023850 3300026041 Unclassified 4421
196 Ga0207639_10198722 3300026041 Bacteria 1718
197 Ga0207639_10444630 3300026041 Bacteria 1176
198 Ga0207678_10125789 3300026067 Bacteria 2187
199 Ga0207702_10074319 3300026078 Bacteria 2933
200 Ga0207702_10089663 3300026078 Bacteria 2689
201 Ga0207648_10007146 3300026089 Bacteria 11012
202 Ga0207676_10064044 3300026095 Bacteria 2922
203 Ga0207674_10003426 3300026116 Bacteria 19418
204 Ga0207674_10015777 3300026116 Bacteria 8287
205 Ga0207675_100041948 3300026118 Bacteria 4272
206 Ga0207675_100191519 3300026118 Bacteria 1961
207 Ga0207683_10000339 3300026121 Bacteria 42571
208 Ga0207698_10000918 3300026142 Bacteria 17129
209 Ga0207698_10016309 3300026142 Bacteria 5004
210 Ga0207698_10017643 3300026142 Bacteria 4850
211 Ga0207428_10040960 3300027907 Bacteria 3752
212 Ga0268266_10016666 3300028379 Bacteria 6279
213 Ga0268266_10020703 3300028379 Bacteria 5607
214 Ga0268265_10106118 3300028380 Bacteria 2281
215 Ga0268265_10151454 3300028380 Bacteria 1957
216 Ga0268264_10003564 3300028381 Bacteria 13403
217 Ga0268264_10003586 3300028381 Bacteria 13365
218 Ga0268264_10011518 3300028381 Bacteria 7305
219 Ga0268264_10030466 3300028381 Unclassified 4422
220 Ga0268264_10112997 3300028381 Bacteria 2382
221 Ga0307515_10212896 3300028794 Bacteria 1772
222 Ga0307516_10010136 3300031730 Bacteria 10402
223 Ga0395901_0249947 3300038443 Bacteria 1848
224 Ga0466957_0069740 3300044842 Bacteria 2172
225 Ga0495651_0132132 3300046462 Bacteria 1821
226 Ga0495650_0030781 3300046471 Bacteria 2425
227 Ga0495668_0001452 3300046616 Bacteria 22860
228 Ga0495611_0000009 3300046648 Bacteria 160002
229 Ga0495649_0052578 3300046694 Bacteria 2207
230 Ga0495686_0015592 3300047472 Bacteria 5183
231 Ga0501047_0047479 3300049581 Bacteria 4148
232 Ga0501047_0159118 3300049581 Bacteria 2131
233 Ga0501047_0201515 3300049581 Bacteria 1851
234 Ga0501035_0360068 3300049822 Bacteria 1216
235 nmdc:mga08y16_130723_c1 3300050511 Bacteria 2611
236 Ga0500578_0064601 3300053086 Bacteria 2334
237 Ga0500652_007310 3300053131 Bacteria 3608
238 Ga0500604_0009771 3300053151 Bacteria 2557
239 Ga0500616_0045453 3300053153 Bacteria 2339
240 Ga0500622_0000003 3300053156 Bacteria 613483
241 Ga0500622_0000008 3300053156 Bacteria 423636
242 Ga0500622_0030247 3300053156 Bacteria 2844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10125789 Ga0207678_101257894 265
2 3300053086 Ga0500578_0064601 Ga0500578_0064601_709_1674 273
3 3300013296 Ga0157374_10083021 Ga0157374_100830213 274
4 3300046648 Ga0495611_0000009 Ga0495611_0000009_116832_117797 276
5 3300046616 Ga0495668_0001452 Ga0495668_0001452_18874_19839 285
6 3300009094 Ga0111539_10048835 Ga0111539_100488353 286
7 3300027907 Ga0207428_10040960 Ga0207428_100409603 286
8 3300013104 Ga0157370_10089466 Ga0157370_100894663 289
9 3300013307 Ga0157372_10009461 Ga0157372_1000946110 289
10 3300025919 Ga0207657_10303818 Ga0207657_103038181 289
11 3300003794 Ga0055531_10000270 Ga0055531_1000027029 290
12 3300005614 Ga0068856_100141198 Ga0068856_1001411982 290
13 3300006844 Ga0075428_100024173 Ga0075428_1000241734 290
14 3300009093 Ga0105240_10015654 Ga0105240_100156545 290
15 3300009094 Ga0111539_10282948 Ga0111539_102829482 290
16 3300009545 Ga0105237_10064456 Ga0105237_100644562 290
17 3300013105 Ga0157369_10309058 Ga0157369_103090582 290
18 3300025304 Ga0209257_1000007 Ga0209257_1000007572 290
19 3300025913 Ga0207695_10037125 Ga0207695_100371256 290
20 3300025914 Ga0207671_10001820 Ga0207671_1000182026 290
21 3300026078 Ga0207702_10089663 Ga0207702_100896632 290
22 3300031730 Ga0307516_10010136 Ga0307516_100101365 290
23 3300050511 nmdc:mga08y16_130723_c1 nmdc:mga08y16_130723_c1_1226_2188 290
24 3300003316 rootH1_10039015 rootH1_100390154 291
25 3300003320 rootH2_10034584 rootH2_1003458428 291
26 3300003320 rootH2_10057761 rootH2_100577616 291
27 3300003320 rootH2_10323498 rootH2_103234981 291
28 3300003322 rootL2_10090491 rootL2_100904911 291
29 3300003323 rootH1_10024310 rootH1_100243108 291
30 3300003323 rootH1_10152834 rootH1_101528343 291
31 3300003323 rootH1_10357378 rootH1_103573781 291
32 3300005328 Ga0070676_10043018 Ga0070676_100430182 291
33 3300005329 Ga0070683_100003664 Ga0070683_1000036645 291
34 3300005331 Ga0070670_100061251 Ga0070670_1000612512 291
35 3300005333 Ga0070677_10026026 Ga0070677_100260262 291
36 3300005334 Ga0068869_100073082 Ga0068869_1000730824 291
37 3300005334 Ga0068869_100082247 Ga0068869_1000822473 291
38 3300005335 Ga0070666_10045504 Ga0070666_100455042 291
39 3300005338 Ga0068868_100033046 Ga0068868_1000330463 291
40 3300005353 Ga0070669_100067741 Ga0070669_1000677412 291
41 3300005356 Ga0070674_100069016 Ga0070674_1000690162 291
42 3300005364 Ga0070673_100034232 Ga0070673_1000342323 291
43 3300005367 Ga0070667_100018915 Ga0070667_1000189152 291
44 3300005367 Ga0070667_100260646 Ga0070667_1002606462 291
45 3300005466 Ga0070685_10053651 Ga0070685_100536512 291
46 3300005539 Ga0068853_100058102 Ga0068853_1000581022 291
47 3300005543 Ga0070672_100026359 Ga0070672_1000263592 291
48 3300005548 Ga0070665_100001316 Ga0070665_10000131618 291
49 3300005548 Ga0070665_100138998 Ga0070665_1001389983 291
50 3300005563 Ga0068855_100078095 Ga0068855_1000780953 291
51 3300005563 Ga0068855_100098255 Ga0068855_1000982552 291
52 3300005564 Ga0070664_100037681 Ga0070664_1000376815 291
53 3300005577 Ga0068857_100240348 Ga0068857_1002403482 291
54 3300005616 Ga0068852_100028518 Ga0068852_1000285182 291
55 3300005617 Ga0068859_100001431 Ga0068859_1000014315 291
56 3300005617 Ga0068859_100060331 Ga0068859_1000603316 291
57 3300005618 Ga0068864_100100504 Ga0068864_1001005043 291
58 3300005719 Ga0068861_100171395 Ga0068861_1001713951 291
59 3300005840 Ga0068870_10073550 Ga0068870_100735502 291
60 3300005842 Ga0068858_100266954 Ga0068858_1002669542 291
61 3300005843 Ga0068860_100003789 Ga0068860_10000378910 291
62 3300005843 Ga0068860_100006432 Ga0068860_1000064323 291
63 3300005843 Ga0068860_100087758 Ga0068860_1000877582 291
64 3300005843 Ga0068860_100125982 Ga0068860_1001259823 291
65 3300005844 Ga0068862_100066167 Ga0068862_1000661673 291
66 3300005844 Ga0068862_100145516 Ga0068862_1001455162 291
67 3300006237 Ga0097621_100012310 Ga0097621_1000123106 291
68 3300006358 Ga0068871_100016038 Ga0068871_1000160389 291
69 3300006358 Ga0068871_100031199 Ga0068871_1000311992 291
70 3300006881 Ga0068865_100010029 Ga0068865_1000100292 291
71 3300006931 Ga0097620_100001431 Ga0097620_1000014315 291
72 3300006931 Ga0097620_100060333 Ga0097620_1000603336 291
73 3300009093 Ga0105240_10038457 Ga0105240_100384574 291
74 3300009093 Ga0105240_10052981 Ga0105240_100529813 291
75 3300009093 Ga0105240_10082265 Ga0105240_100822654 291
76 3300009093 Ga0105240_10092586 Ga0105240_100925863 291
77 3300009093 Ga0105240_10145129 Ga0105240_101451292 291
78 3300009094 Ga0111539_10628900 Ga0111539_106289001 291
79 3300009098 Ga0105245_10448543 Ga0105245_104485432 291
80 3300009101 Ga0105247_10219120 Ga0105247_102191201 291
81 3300009174 Ga0105241_10080504 Ga0105241_100805043 291
82 3300009174 Ga0105241_10094886 Ga0105241_100948862 291
83 3300009176 Ga0105242_10050997 Ga0105242_100509972 291
84 3300009545 Ga0105237_10003056 Ga0105237_1000305618 291
85 3300009545 Ga0105237_10007171 Ga0105237_100071717 291
86 3300009545 Ga0105237_10039424 Ga0105237_100394245 291
87 3300009545 Ga0105237_10121657 Ga0105237_101216573 291
88 3300009551 Ga0105238_10097179 Ga0105238_100971792 291
89 3300009553 Ga0105249_10019990 Ga0105249_100199902 291
90 3300010375 Ga0105239_10000005 Ga0105239_10000005426 291
91 3300010375 Ga0105239_10000042 Ga0105239_1000004218 291
92 3300010375 Ga0105239_10000907 Ga0105239_1000090725 291
93 3300010375 Ga0105239_10004744 Ga0105239_100047443 291
94 3300010375 Ga0105239_10014518 Ga0105239_100145186 291
95 3300010375 Ga0105239_10038020 Ga0105239_100380202 291
96 3300010375 Ga0105239_10042274 Ga0105239_100422743 291
97 3300010375 Ga0105239_10077220 Ga0105239_100772202 291
98 3300010375 Ga0105239_10400296 Ga0105239_104002962 291
99 3300011119 Ga0105246_10013455 Ga0105246_100134554 291
100 3300013296 Ga0157374_10000013 Ga0157374_1000001341 291
101 3300013296 Ga0157374_10066061 Ga0157374_100660613 291
102 3300013296 Ga0157374_10108524 Ga0157374_101085242 291
103 3300013296 Ga0157374_10126365 Ga0157374_101263653 291
104 3300013296 Ga0157374_10395859 Ga0157374_103958592 291
105 3300013296 Ga0157374_10693513 Ga0157374_106935131 291
106 3300013297 Ga0157378_10105662 Ga0157378_101056623 291
107 3300013297 Ga0157378_10260322 Ga0157378_102603221 291
108 3300013297 Ga0157378_10362151 Ga0157378_103621511 291
109 3300013297 Ga0157378_10363361 Ga0157378_103633611 291
110 3300013306 Ga0163162_10000693 Ga0163162_100006935 291
111 3300013306 Ga0163162_10043619 Ga0163162_100436195 291
112 3300013307 Ga0157372_10053112 Ga0157372_100531123 291
113 3300013308 Ga0157375_10050323 Ga0157375_100503233 291
114 3300013308 Ga0157375_10225521 Ga0157375_102255211 291
115 3300013308 Ga0157375_10319642 Ga0157375_103196422 291
116 3300014968 Ga0157379_10080907 Ga0157379_100809074 291
117 3300014968 Ga0157379_10284657 Ga0157379_102846572 291
118 3300014969 Ga0157376_10034329 Ga0157376_100343294 291
119 3300025272 Ga0209455_1001713 Ga0209455_10017138 291
120 3300025904 Ga0207647_10011614 Ga0207647_100116143 291
121 3300025907 Ga0207645_10000168 Ga0207645_1000016815 291
122 3300025913 Ga0207695_10013196 Ga0207695_100131968 291
123 3300025913 Ga0207695_10382020 Ga0207695_103820202 291
124 3300025914 Ga0207671_10008633 Ga0207671_100086335 291
125 3300025914 Ga0207671_10061880 Ga0207671_100618803 291
126 3300025914 Ga0207671_10062606 Ga0207671_100626062 291
127 3300025914 Ga0207671_10067729 Ga0207671_100677292 291
128 3300025923 Ga0207681_10029752 Ga0207681_100297522 291
129 3300025925 Ga0207650_10043575 Ga0207650_100435752 291
130 3300025938 Ga0207704_10010577 Ga0207704_100105772 291
131 3300025940 Ga0207691_10042753 Ga0207691_100427533 291
132 3300025942 Ga0207689_10003307 Ga0207689_100033073 291
133 3300025942 Ga0207689_10027906 Ga0207689_100279064 291
134 3300025942 Ga0207689_10065713 Ga0207689_100657131 291
135 3300025944 Ga0207661_10073627 Ga0207661_100736271 291
136 3300025945 Ga0207679_10122971 Ga0207679_101229713 291
137 3300025949 Ga0207667_10068790 Ga0207667_100687903 291
138 3300025960 Ga0207651_10023149 Ga0207651_100231493 291
139 3300025961 Ga0207712_10041037 Ga0207712_100410374 291
140 3300025986 Ga0207658_10049560 Ga0207658_100495603 291
141 3300026041 Ga0207639_10023850 Ga0207639_100238502 291
142 3300026041 Ga0207639_10198722 Ga0207639_101987223 291
143 3300026041 Ga0207639_10444630 Ga0207639_104446301 291
144 3300026089 Ga0207648_10007146 Ga0207648_100071462 291
145 3300026095 Ga0207676_10064044 Ga0207676_100640443 291
146 3300026116 Ga0207674_10015777 Ga0207674_100157777 291
147 3300026118 Ga0207675_100041948 Ga0207675_1000419486 291
148 3300026118 Ga0207675_100191519 Ga0207675_1001915191 291
149 3300026121 Ga0207683_10000339 Ga0207683_1000033914 291
150 3300026142 Ga0207698_10016309 Ga0207698_100163095 291
151 3300028379 Ga0268266_10016666 Ga0268266_100166666 291
152 3300028379 Ga0268266_10020703 Ga0268266_100207032 291
153 3300028380 Ga0268265_10106118 Ga0268265_101061182 291
154 3300028380 Ga0268265_10151454 Ga0268265_101514542 291
155 3300028381 Ga0268264_10003564 Ga0268264_100035644 291
156 3300028381 Ga0268264_10003586 Ga0268264_100035865 291
157 3300028381 Ga0268264_10030466 Ga0268264_100304662 291
158 3300028381 Ga0268264_10112997 Ga0268264_101129973 291
159 3300028794 Ga0307515_10212896 Ga0307515_102128962 291
160 3300038443 Ga0395901_0249947 Ga0395901_0249947_16_1074 291
161 3300044842 Ga0466957_0069740 Ga0466957_0069740_924_1889 291
162 3300046462 Ga0495651_0132132 Ga0495651_0132132_43_918 291
163 3300046694 Ga0495649_0052578 Ga0495649_0052578_511_1476 291
164 3300047472 Ga0495686_0015592 Ga0495686_0015592_3034_3960 291
165 3300049581 Ga0501047_0047479 Ga0501047_0047479_587_1552 291
166 3300049581 Ga0501047_0201515 Ga0501047_0201515_586_1551 291
167 3300049822 Ga0501035_0360068 Ga0501035_0360068_21_986 291
168 3300053131 Ga0500652_007310 Ga0500652_007310_2418_3383 291
169 3300053151 Ga0500604_0009771 Ga0500604_0009771_549_1517 291
170 3300053156 Ga0500622_0000003 Ga0500622_0000003_463942_464910 291
171 3300053156 Ga0500622_0000008 Ga0500622_0000008_277313_278281 291
172 3300053156 Ga0500622_0030247 Ga0500622_0030247_1297_2262 291
173 3300005336 Ga0070680_100044115 Ga0070680_1000441151 292
174 3300005530 Ga0070679_100059674 Ga0070679_1000596745 292
175 3300005563 Ga0068855_100037578 Ga0068855_1000375786 292
176 3300013102 Ga0157371_10011616 Ga0157371_100116165 292
177 3300013307 Ga0157372_10026794 Ga0157372_100267945 292
178 3300013307 Ga0157372_10032132 Ga0157372_100321324 292
179 3300013307 Ga0157372_10084670 Ga0157372_100846703 292
180 3300025909 Ga0207705_10118250 Ga0207705_101182503 292
181 3300025921 Ga0207652_10001615 Ga0207652_100016158 292
182 3300026142 Ga0207698_10017643 Ga0207698_100176434 292
183 3300003322 rootL2_10364155 rootL2_103641551 293
184 3300009545 Ga0105237_10005461 Ga0105237_100054618 293
185 3300025231 Ga0207427_100091 Ga0207427_10009169 293
186 3300025233 Ga0209437_100026 Ga0209437_100026176 293
187 3300025261 Ga0209233_1000111 Ga0209233_100011170 293
188 3300049581 Ga0501047_0159118 Ga0501047_0159118_787_1758 293
189 iso_pu_bacteria 2852627209 2852627660 293
190 3300003215 JGI25153J46596_10006913 JGI25153J46596_100069133 295
191 3300003322 rootL2_10186392 rootL2_101863922 295
192 3300005563 Ga0068855_100007754 Ga0068855_10000775410 295
193 3300005563 Ga0068855_100010852 Ga0068855_1000108523 295
194 3300005577 Ga0068857_100006663 Ga0068857_1000066637 295
195 3300005578 Ga0068854_100023971 Ga0068854_1000239713 295
196 3300005614 Ga0068856_100075146 Ga0068856_1000751463 295
197 3300005616 Ga0068852_100001851 Ga0068852_1000018519 295
198 3300005843 Ga0068860_100001241 Ga0068860_10000124113 295
199 3300006237 Ga0097621_100203872 Ga0097621_1002038723 295
200 3300009093 Ga0105240_10005313 Ga0105240_1000531310 295
201 3300009093 Ga0105240_10009144 Ga0105240_100091447 295
202 3300009093 Ga0105240_10009399 Ga0105240_1000939914 295
203 3300009093 Ga0105240_10029054 Ga0105240_100290545 295
204 3300009093 Ga0105240_10229874 Ga0105240_102298741 295
205 3300009174 Ga0105241_10062809 Ga0105241_100628093 295
206 3300009174 Ga0105241_10069040 Ga0105241_100690402 295
207 3300009174 Ga0105241_10224309 Ga0105241_102243091 295
208 3300009545 Ga0105237_10012579 Ga0105237_100125797 295
209 3300009545 Ga0105237_10098436 Ga0105237_100984364 295
210 3300009551 Ga0105238_10041595 Ga0105238_100415953 295
211 3300009551 Ga0105238_10051949 Ga0105238_100519492 295
212 3300009551 Ga0105238_10116428 Ga0105238_101164283 295
213 3300009551 Ga0105238_10260525 Ga0105238_102605251 295
214 3300010375 Ga0105239_10003398 Ga0105239_100033986 295
215 3300010375 Ga0105239_10223017 Ga0105239_102230172 295
216 3300013100 Ga0157373_10150988 Ga0157373_101509882 295
217 3300013104 Ga0157370_10008198 Ga0157370_100081987 295
218 3300013105 Ga0157369_10045403 Ga0157369_100454035 295
219 3300013306 Ga0163162_10021550 Ga0163162_100215503 295
220 3300013307 Ga0157372_10000664 Ga0157372_1000066410 295
221 3300025295 Ga0209564_1015364 Ga0209564_10153642 295
222 3300025297 Ga0209758_1001657 Ga0209758_100165711 295
223 3300025904 Ga0207647_10009313 Ga0207647_100093135 295
224 3300025911 Ga0207654_10140888 Ga0207654_101408882 295
225 3300025913 Ga0207695_10014235 Ga0207695_100142354 295
226 3300025913 Ga0207695_10029353 Ga0207695_100293535 295
227 3300025913 Ga0207695_10055312 Ga0207695_100553123 295
228 3300025913 Ga0207695_10075838 Ga0207695_100758384 295
229 3300025913 Ga0207695_10147633 Ga0207695_101476331 295
230 3300025914 Ga0207671_10006926 Ga0207671_100069267 295
231 3300025914 Ga0207671_10045978 Ga0207671_100459782 295
232 3300025924 Ga0207694_10122627 Ga0207694_101226273 295
233 3300025924 Ga0207694_10190967 Ga0207694_101909672 295
234 3300025924 Ga0207694_10264339 Ga0207694_102643391 295
235 3300025949 Ga0207667_10004032 Ga0207667_1000403213 295
236 3300025949 Ga0207667_10020144 Ga0207667_100201446 295
237 3300025981 Ga0207640_10034243 Ga0207640_100342433 295
238 3300026078 Ga0207702_10074319 Ga0207702_100743193 295
239 3300026116 Ga0207674_10003426 Ga0207674_100034269 295
240 3300026142 Ga0207698_10000918 Ga0207698_100009189 295
241 3300028381 Ga0268264_10011518 Ga0268264_100115183 295
242 3300046471 Ga0495650_0030781 Ga0495650_0030781_1240_2217 295
243 3300053153 Ga0500616_0045453 Ga0500616_0045453_1259_2245 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

275

354

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

262

303

0.95

PF01965

DJ-1_PfpI

DJ-1/PfpI family

74

215

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9476 186 288
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9278 191 286
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9189 186 295
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9096 186 289
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9035 186 295
ID Description Score Start End Superfamily
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.955 188 289 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9325 241 292 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9323 231 289 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9296 186 288 1.10.10.60
af_P06134_78_136_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9266 187 239 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1X1D3I0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9605 188 291 GO:0003700
GO:0043565
AF-A0A538R932-F1-model_v4 Helix-turn-helix transcriptional regulator 0.959 188 289 GO:0003700
GO:0043565
AF-A0A7X8G6G6-F1-model_v4 AraC family transcriptional regulator 0.9582 187 287 GO:0003700
GO:0043565
AF-A0A2N5I3E9-F1-model_v4 AraC family transcriptional regulator 0.9557 187 289 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A318ABT8-F1-model_v4 deleted 0.9555 188 289

Feature Viewer

pLDDT pTM Quality
84.19 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map