F355313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 143 | 243 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100991107|Ga0068869_1009911072 |
| Length | 88 |
| Sequence | MISARFFVAEVMDEKVDEKAQRVPKLISVSERNLQSAAIRLLPKHNKLVSSEVDYLRRVLGDRATQAQIDEKVLLVRTLPWREIVGET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 116 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 122 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 139 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 2.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5946352 | 2162886012 | Bacteria | 1031 |
| 2 | JGI24743J22301_10150875 | 3300001991 | Bacteria | 521 |
| 3 | JGI24033J26618_1032471 | 3300002155 | Unclassified | 706 |
| 4 | Ga0065715_10240824 | 3300005293 | Unclassified | 1200 |
| 5 | Ga0070676_10477679 | 3300005328 | Unclassified | 881 |
| 6 | Ga0070683_100000017 | 3300005329 | Bacteria | 207189 |
| 7 | Ga0070690_100135335 | 3300005330 | Bacteria | 1668 |
| 8 | Ga0070677_10045833 | 3300005333 | Bacteria | 1746 |
| 9 | Ga0070677_10230107 | 3300005333 | Unclassified | 910 |
| 10 | Ga0068869_100991107 | 3300005334 | Bacteria | 731 |
| 11 | Ga0068869_101037756 | 3300005334 | Bacteria | 715 |
| 12 | Ga0070680_100016466 | 3300005336 | Bacteria | 5819 |
| 13 | Ga0070682_100000006 | 3300005337 | Bacteria | 369078 |
| 14 | Ga0068868_100010699 | 3300005338 | Bacteria | 6650 |
| 15 | Ga0068868_100630971 | 3300005338 | Unclassified | 952 |
| 16 | Ga0070689_100000475 | 3300005340 | Bacteria | 23663 |
| 17 | Ga0070689_100279279 | 3300005340 | Unclassified | 1385 |
| 18 | Ga0070689_101515190 | 3300005340 | Unclassified | 608 |
| 19 | Ga0070689_101586602 | 3300005340 | Unclassified | 594 |
| 20 | Ga0070687_100184125 | 3300005343 | Bacteria | 1253 |
| 21 | Ga0070687_100227685 | 3300005343 | Bacteria | 1145 |
| 22 | Ga0070692_10018177 | 3300005345 | Bacteria | 3375 |
| 23 | Ga0070692_10738236 | 3300005345 | Unclassified | 666 |
| 24 | Ga0070675_100000042 | 3300005354 | Bacteria | 78277 |
| 25 | Ga0070671_100106895 | 3300005355 | Bacteria | 2349 |
| 26 | Ga0070671_101645008 | 3300005355 | Unclassified | 569 |
| 27 | Ga0070674_100251112 | 3300005356 | Bacteria | 1389 |
| 28 | Ga0070659_101310181 | 3300005366 | Unclassified | 642 |
| 29 | Ga0070713_100001162 | 3300005436 | Bacteria | 16813 |
| 30 | Ga0070701_10000082 | 3300005438 | Bacteria | 26358 |
| 31 | Ga0070711_101639265 | 3300005439 | Unclassified | 563 |
| 32 | Ga0070705_101473303 | 3300005440 | Unclassified | 569 |
| 33 | Ga0070700_100000037 | 3300005441 | Bacteria | 109998 |
| 34 | Ga0070708_100046989 | 3300005445 | Bacteria | 3811 |
| 35 | Ga0070708_100091008 | 3300005445 | Bacteria | 2778 |
| 36 | Ga0070678_100083307 | 3300005456 | Bacteria | 2431 |
| 37 | Ga0070678_101675033 | 3300005456 | Bacteria | 598 |
| 38 | Ga0070685_10007137 | 3300005466 | Bacteria | 5705 |
| 39 | Ga0070706_100034484 | 3300005467 | Bacteria | 4676 |
| 40 | Ga0070706_100058376 | 3300005467 | Bacteria | 3562 |
| 41 | Ga0070706_100060061 | 3300005467 | Bacteria | 3509 |
| 42 | Ga0070706_100488774 | 3300005467 | Unclassified | 1145 |
| 43 | Ga0070706_101369100 | 3300005467 | Unclassified | 648 |
| 44 | Ga0070707_100003657 | 3300005468 | Bacteria | 14497 |
| 45 | Ga0070707_100034245 | 3300005468 | Bacteria | 4844 |
| 46 | Ga0070707_100131126 | 3300005468 | Unclassified | 2437 |
| 47 | Ga0070707_100201206 | 3300005468 | Bacteria | 1942 |
| 48 | Ga0070707_100399164 | 3300005468 | Bacteria | 1335 |
| 49 | Ga0070707_100713055 | 3300005468 | Unclassified | 966 |
| 50 | Ga0070698_100039738 | 3300005471 | Unclassified | 4839 |
| 51 | Ga0070698_100053898 | 3300005471 | Bacteria | 4085 |
| 52 | Ga0070698_100301460 | 3300005471 | Bacteria | 1533 |
| 53 | Ga0070698_100418412 | 3300005471 | Bacteria | 1274 |
| 54 | Ga0070699_100006816 | 3300005518 | Bacteria | 9940 |
| 55 | Ga0070699_100078928 | 3300005518 | Unclassified | 2867 |
| 56 | Ga0070699_100164843 | 3300005518 | Bacteria | 1962 |
| 57 | Ga0070699_101125689 | 3300005518 | Unclassified | 720 |
| 58 | Ga0070684_100000016 | 3300005535 | Bacteria | 139439 |
| 59 | Ga0070684_100172897 | 3300005535 | Bacteria | 1962 |
| 60 | Ga0070697_100058036 | 3300005536 | Bacteria | 3149 |
| 61 | Ga0070697_100130702 | 3300005536 | Bacteria | 2105 |
| 62 | Ga0070697_101917116 | 3300005536 | Unclassified | 530 |
| 63 | Ga0068853_100030119 | 3300005539 | Unclassified | 4582 |
| 64 | Ga0070672_100000978 | 3300005543 | Bacteria | 17270 |
| 65 | Ga0070686_100069783 | 3300005544 | Bacteria | 2296 |
| 66 | Ga0070696_101639586 | 3300005546 | Unclassified | 553 |
| 67 | Ga0070696_101712463 | 3300005546 | Unclassified | 542 |
| 68 | Ga0070693_100664402 | 3300005547 | Unclassified | 759 |
| 69 | Ga0070704_100546651 | 3300005549 | Unclassified | 1011 |
| 70 | Ga0068854_100001343 | 3300005578 | Bacteria | 14816 |
| 71 | Ga0068854_100012550 | 3300005578 | Bacteria | 5550 |
| 72 | Ga0068854_100135619 | 3300005578 | Bacteria | 1884 |
| 73 | Ga0068854_102277556 | 3300005578 | Unclassified | 502 |
| 74 | Ga0070702_101789470 | 3300005615 | Unclassified | 513 |
| 75 | Ga0068852_101434186 | 3300005616 | Bacteria | 713 |
| 76 | Ga0068852_102742635 | 3300005616 | Unclassified | 512 |
| 77 | Ga0068859_101645754 | 3300005617 | Bacteria | 709 |
| 78 | Ga0068864_100000037 | 3300005618 | Bacteria | 188796 |
| 79 | Ga0068861_100231967 | 3300005719 | Bacteria | 1566 |
| 80 | Ga0068851_10125151 | 3300005834 | Bacteria | 1385 |
| 81 | Ga0068870_10032047 | 3300005840 | Unclassified | 2668 |
| 82 | Ga0068858_100000110 | 3300005842 | Bacteria | 86502 |
| 83 | Ga0070717_10000405 | 3300006028 | Bacteria | 27596 |
| 84 | Ga0070717_10847614 | 3300006028 | Bacteria | 832 |
| 85 | Ga0070717_11044945 | 3300006028 | Bacteria | 744 |
| 86 | Ga0070717_11085895 | 3300006028 | Unclassified | 729 |
| 87 | Ga0070717_11433015 | 3300006028 | Unclassified | 627 |
| 88 | Ga0070716_100012975 | 3300006173 | Bacteria | 4235 |
| 89 | Ga0070716_100509449 | 3300006173 | Unclassified | 889 |
| 90 | Ga0097621_100880401 | 3300006237 | Bacteria | 833 |
| 91 | Ga0068871_100342687 | 3300006358 | Unclassified | 1320 |
| 92 | Ga0075434_100444502 | 3300006871 | Bacteria | 1318 |
| 93 | Ga0075434_100492583 | 3300006871 | Unclassified | 1246 |
| 94 | Ga0075429_100975022 | 3300006880 | Unclassified | 741 |
| 95 | Ga0097620_101645972 | 3300006931 | Bacteria | 709 |
| 96 | Ga0075435_101342259 | 3300007076 | Unclassified | 626 |
| 97 | Ga0105244_10026483 | 3300009036 | Bacteria | 3138 |
| 98 | Ga0105240_10053472 | 3300009093 | Bacteria | 5068 |
| 99 | Ga0105245_10000497 | 3300009098 | Bacteria | 36061 |
| 100 | Ga0105245_10017027 | 3300009098 | Bacteria | 6345 |
| 101 | Ga0105245_11091313 | 3300009098 | Bacteria | 844 |
| 102 | Ga0105245_11600408 | 3300009098 | Bacteria | 703 |
| 103 | Ga0114129_10544400 | 3300009147 | Unclassified | 1510 |
| 104 | Ga0114129_10581845 | 3300009147 | Bacteria | 1453 |
| 105 | Ga0114129_12266935 | 3300009147 | Unclassified | 652 |
| 106 | Ga0114129_12278767 | 3300009147 | Unclassified | 650 |
| 107 | Ga0105242_10010127 | 3300009176 | Bacteria | 7221 |
| 108 | Ga0105242_12564257 | 3300009176 | Bacteria | 558 |
| 109 | Ga0105248_12680047 | 3300009177 | Unclassified | 568 |
| 110 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 111 | Ga0105239_10884201 | 3300010375 | Bacteria | 1025 |
| 112 | Ga0105246_11424778 | 3300011119 | Unclassified | 647 |
| 113 | Ga0157369_10498832 | 3300013105 | Bacteria | 1259 |
| 114 | Ga0157374_10000010 | 3300013296 | Bacteria | 505635 |
| 115 | Ga0157378_10191282 | 3300013297 | Bacteria | 1930 |
| 116 | Ga0157378_10751041 | 3300013297 | Bacteria | 998 |
| 117 | Ga0157378_10956771 | 3300013297 | Bacteria | 889 |
| 118 | Ga0157378_11159874 | 3300013297 | Unclassified | 811 |
| 119 | Ga0157378_11324027 | 3300013297 | Unclassified | 762 |
| 120 | Ga0163162_10086610 | 3300013306 | Bacteria | 3210 |
| 121 | Ga0157375_10000013 | 3300013308 | Bacteria | 323500 |
| 122 | Ga0157375_10746389 | 3300013308 | Bacteria | 1130 |
| 123 | Ga0157375_11308055 | 3300013308 | Bacteria | 852 |
| 124 | Ga0157380_10076255 | 3300014326 | Bacteria | 2728 |
| 125 | Ga0157380_12899970 | 3300014326 | Bacteria | 546 |
| 126 | Ga0157377_10000017 | 3300014745 | Bacteria | 188087 |
| 127 | Ga0157377_10155471 | 3300014745 | Unclassified | 1418 |
| 128 | Ga0157377_10542961 | 3300014745 | Bacteria | 820 |
| 129 | Ga0157377_11022918 | 3300014745 | Bacteria | 627 |
| 130 | Ga0157379_10416297 | 3300014968 | Unclassified | 1237 |
| 131 | Ga0157376_11222547 | 3300014969 | Unclassified | 780 |
| 132 | Ga0182005_1307777 | 3300015265 | Bacteria | 501 |
| 133 | Ga0213873_10000003 | 3300021358 | Bacteria | 973849 |
| 134 | Ga0213876_10000003 | 3300021384 | Bacteria | 973849 |
| 135 | Ga0213876_10000012 | 3300021384 | Bacteria | 396530 |
| 136 | Ga0213876_10003866 | 3300021384 | Bacteria | 8466 |
| 137 | Ga0213876_10116815 | 3300021384 | Bacteria | 1416 |
| 138 | Ga0207656_10173822 | 3300025321 | Bacteria | 1031 |
| 139 | Ga0207655_1024039 | 3300025728 | Bacteria | 2998 |
| 140 | Ga0207682_10122711 | 3300025893 | Unclassified | 1154 |
| 141 | Ga0207682_10243911 | 3300025893 | Unclassified | 835 |
| 142 | Ga0207699_10986687 | 3300025906 | Bacteria | 623 |
| 143 | Ga0207645_11179343 | 3300025907 | Bacteria | 515 |
| 144 | Ga0207643_10032453 | 3300025908 | Unclassified | 2917 |
| 145 | Ga0207643_10109424 | 3300025908 | Unclassified | 1627 |
| 146 | Ga0207684_10049730 | 3300025910 | Bacteria | 3556 |
| 147 | Ga0207684_10222450 | 3300025910 | Bacteria | 1629 |
| 148 | Ga0207684_10277005 | 3300025910 | Bacteria | 1447 |
| 149 | Ga0207684_10444817 | 3300025910 | Unclassified | 1113 |
| 150 | Ga0207684_10841042 | 3300025910 | Unclassified | 774 |
| 151 | Ga0207695_10433558 | 3300025913 | Unclassified | 1198 |
| 152 | Ga0207660_10280177 | 3300025917 | Bacteria | 1323 |
| 153 | Ga0207662_10424598 | 3300025918 | Unclassified | 905 |
| 154 | Ga0207662_10483730 | 3300025918 | Bacteria | 850 |
| 155 | Ga0207662_10505653 | 3300025918 | Bacteria | 832 |
| 156 | Ga0207646_10013774 | 3300025922 | Bacteria | 7718 |
| 157 | Ga0207646_10063188 | 3300025922 | Bacteria | 3305 |
| 158 | Ga0207646_10428933 | 3300025922 | Unclassified | 1193 |
| 159 | Ga0207646_10464667 | 3300025922 | Bacteria | 1141 |
| 160 | Ga0207646_10917611 | 3300025922 | Unclassified | 776 |
| 161 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 162 | Ga0207659_10000045 | 3300025926 | Bacteria | 88264 |
| 163 | Ga0207687_10000443 | 3300025927 | Bacteria | 28146 |
| 164 | Ga0207687_10001279 | 3300025927 | Bacteria | 17204 |
| 165 | Ga0207687_10769111 | 3300025927 | Bacteria | 820 |
| 166 | Ga0207700_10018296 | 3300025928 | Bacteria | 4704 |
| 167 | Ga0207664_10720680 | 3300025929 | Unclassified | 897 |
| 168 | Ga0207644_10480939 | 3300025931 | Unclassified | 1023 |
| 169 | Ga0207686_10200315 | 3300025934 | Bacteria | 1429 |
| 170 | Ga0207670_10000261 | 3300025936 | Bacteria | 33083 |
| 171 | Ga0207670_10502648 | 3300025936 | Unclassified | 984 |
| 172 | Ga0207670_11392102 | 3300025936 | Unclassified | 595 |
| 173 | Ga0207665_10136041 | 3300025939 | Unclassified | 1748 |
| 174 | Ga0207665_10270651 | 3300025939 | Bacteria | 1261 |
| 175 | Ga0207691_10002718 | 3300025940 | Bacteria | 17285 |
| 176 | Ga0207689_10306962 | 3300025942 | Bacteria | 1315 |
| 177 | Ga0207689_11358414 | 3300025942 | Bacteria | 596 |
| 178 | Ga0207661_10000004 | 3300025944 | Bacteria | 606391 |
| 179 | Ga0207661_10031556 | 3300025944 | Bacteria | 4095 |
| 180 | Ga0207640_10003800 | 3300025981 | Bacteria | 8135 |
| 181 | Ga0207640_10038299 | 3300025981 | Bacteria | 3024 |
| 182 | Ga0207677_10000015 | 3300026023 | Bacteria | 173792 |
| 183 | Ga0207703_10000008 | 3300026035 | Bacteria | 373718 |
| 184 | Ga0207703_11731469 | 3300026035 | Unclassified | 601 |
| 185 | Ga0207639_10000015 | 3300026041 | Bacteria | 265362 |
| 186 | Ga0207708_10000007 | 3300026075 | Bacteria | 264612 |
| 187 | Ga0207648_10306863 | 3300026089 | Unclassified | 1424 |
| 188 | Ga0207648_10580168 | 3300026089 | Bacteria | 1032 |
| 189 | Ga0207676_10000067 | 3300026095 | Bacteria | 104863 |
| 190 | Ga0207674_10577313 | 3300026116 | Bacteria | 1086 |
| 191 | Ga0207675_100021105 | 3300026118 | Bacteria | 6069 |
| 192 | Ga0207683_10103590 | 3300026121 | Bacteria | 2542 |
| 193 | Ga0207698_10782011 | 3300026142 | Bacteria | 955 |
| 194 | Ga0307413_11522466 | 3300031824 | Unclassified | 592 |
| 195 | Ga0307416_100651944 | 3300032002 | Bacteria | 1138 |
| 196 | Ga0307416_102630731 | 3300032002 | Unclassified | 600 |
| 197 | Ga0307411_11536284 | 3300032005 | Bacteria | 613 |
| 198 | Ga0373929_0240075 | 3300035085 | Unclassified | 522 |
| 199 | Ga0373941_0011616 | 3300035115 | Bacteria | 2280 |
| 200 | Ga0373941_0085094 | 3300035115 | Unclassified | 1075 |
| 201 | Ga0373941_0344171 | 3300035115 | Unclassified | 605 |
| 202 | Ga0373943_0064122 | 3300035170 | Bacteria | 1844 |
| 203 | Ga0373942_0062046 | 3300035207 | Bacteria | 1073 |
| 204 | Ga0436364_0451345 | 3300037853 | Bacteria | 1354 |
| 205 | Ga0436365_0120716 | 3300039437 | Bacteria | 90169 |
| 206 | Ga0436365_0605555 | 3300039437 | Bacteria | 1190 |
| 207 | Ga0436365_0907894 | 3300039437 | Bacteria | 12637 |
| 208 | Ga0436365_1074593 | 3300039437 | Bacteria | 9969 |
| 209 | Ga0436365_1186993 | 3300039437 | Bacteria | 180001 |
| 210 | Ga0436365_1433868 | 3300039437 | Bacteria | 936 |
| 211 | Ga0436363_0287128 | 3300039450 | Unclassified | 1169 |
| 212 | Ga0436363_1513556 | 3300039450 | Unclassified | 508 |
| 213 | Ga0436362_0233778 | 3300039453 | Unclassified | 547 |
| 214 | Ga0436362_1233885 | 3300039453 | Bacteria | 23331 |
| 215 | Ga0436362_1234996 | 3300039453 | Bacteria | 292548 |
| 216 | Ga0451853_0131886 | 3300041512 | Unclassified | 736 |
| 217 | Ga0453683_0889800 | 3300044673 | Unclassified | 588 |
| 218 | Ga0451576_0485451 | 3300045051 | Bacteria | 1298 |
| 219 | Ga0495621_0046223 | 3300046539 | Bacteria | 1544 |
| 220 | Ga0495621_0424919 | 3300046539 | Bacteria | 566 |
| 221 | Ga0495588_0558112 | 3300046674 | Unclassified | 600 |
| 222 | Ga0501073_0001012 | 3300049589 | Bacteria | 20307 |
| 223 | Ga0501080_0015363 | 3300049742 | Bacteria | 7056 |
| 224 | nmdc:mga05p37_509371_c1 | 3300050507 | Bacteria | 1379 |
| 225 | nmdc:mga05p37_779131_c1 | 3300050507 | Unclassified | 1050 |
| 226 | nmdc:mga05p37_994673_c1 | 3300050507 | Unclassified | 892 |
| 227 | nmdc:mga09592_352776_c1 | 3300050508 | Bacteria | 1273 |
| 228 | nmdc:mga0qj67_1049698_c1 | 3300050509 | Bacteria | 638 |
| 229 | nmdc:mga06r32_1441439_c1 | 3300050510 | Unclassified | 630 |
| 230 | nmdc:mga0n895_205242_c1 | 3300050512 | Bacteria | 2001 |
| 231 | nmdc:mga0n895_267573_c1 | 3300050512 | Bacteria | 1734 |
| 232 | nmdc:mga0rr50_58502_c1 | 3300050513 | Bacteria | 2889 |
| 233 | nmdc:mga0rr50_6337_c1 | 3300050513 | Bacteria | 7191 |
| 234 | nmdc:mga0rr50_75_c1 | 3300050513 | Bacteria | 56801 |
| 235 | nmdc:mga08x19_1010_c1 | 3300050514 | Bacteria | 17579 |
| 236 | nmdc:mga08x19_356797_c1 | 3300050514 | Bacteria | 1021 |
| 237 | Ga0495655_0000562 | 3300053083 | Bacteria | 6121 |
| 238 | Ga0590075_096872 | 3300059424 | Unclassified | 767 |
| 239 | Ga0587066_225687 | 3300059490 | Unclassified | 504 |
| 240 | Ga0587070_169800 | 3300059491 | Eukaryota | 560 |
| 241 | Ga0587073_0302586 | 3300059492 | Unclassified | 521 |
| 242 | Ga0587085_105086 | 3300059506 | Unclassified | 601 |
| 243 | Ga0587091_176042 | 3300059511 | Unclassified | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100135335 | Ga0070690_1001353351 | 71 |
| 2 | 3300005355 | Ga0070671_101645008 | Ga0070671_1016450082 | 71 |
| 3 | 3300005578 | Ga0068854_102277556 | Ga0068854_1022775561 | 71 |
| 4 | 3300001991 | JGI24743J22301_10150875 | JGI24743J22301_101508751 | 72 |
| 5 | 3300005329 | Ga0070683_100000017 | Ga0070683_10000001776 | 72 |
| 6 | 3300005333 | Ga0070677_10230107 | Ga0070677_102301072 | 72 |
| 7 | 3300005338 | Ga0068868_100630971 | Ga0068868_1006309711 | 72 |
| 8 | 3300005343 | Ga0070687_100227685 | Ga0070687_1002276852 | 72 |
| 9 | 3300005345 | Ga0070692_10018177 | Ga0070692_100181774 | 72 |
| 10 | 3300005355 | Ga0070671_100106895 | Ga0070671_1001068952 | 72 |
| 11 | 3300005356 | Ga0070674_100251112 | Ga0070674_1002511122 | 72 |
| 12 | 3300005436 | Ga0070713_100001162 | Ga0070713_1000011627 | 72 |
| 13 | 3300005438 | Ga0070701_10000082 | Ga0070701_100000825 | 72 |
| 14 | 3300005439 | Ga0070711_101639265 | Ga0070711_1016392651 | 72 |
| 15 | 3300005445 | Ga0070708_100046989 | Ga0070708_1000469893 | 72 |
| 16 | 3300005445 | Ga0070708_100091008 | Ga0070708_1000910082 | 72 |
| 17 | 3300005456 | Ga0070678_100083307 | Ga0070678_1000833072 | 72 |
| 18 | 3300005467 | Ga0070706_100034484 | Ga0070706_1000344842 | 72 |
| 19 | 3300005467 | Ga0070706_100058376 | Ga0070706_1000583762 | 72 |
| 20 | 3300005467 | Ga0070706_100060061 | Ga0070706_1000600613 | 72 |
| 21 | 3300005467 | Ga0070706_100488774 | Ga0070706_1004887742 | 72 |
| 22 | 3300005467 | Ga0070706_101369100 | Ga0070706_1013691002 | 72 |
| 23 | 3300005468 | Ga0070707_100003657 | Ga0070707_1000036575 | 72 |
| 24 | 3300005468 | Ga0070707_100034245 | Ga0070707_1000342453 | 72 |
| 25 | 3300005468 | Ga0070707_100131126 | Ga0070707_1001311263 | 72 |
| 26 | 3300005468 | Ga0070707_100201206 | Ga0070707_1002012062 | 72 |
| 27 | 3300005468 | Ga0070707_100399164 | Ga0070707_1003991642 | 72 |
| 28 | 3300005468 | Ga0070707_100713055 | Ga0070707_1007130552 | 72 |
| 29 | 3300005471 | Ga0070698_100039738 | Ga0070698_1000397382 | 72 |
| 30 | 3300005471 | Ga0070698_100053898 | Ga0070698_1000538982 | 72 |
| 31 | 3300005471 | Ga0070698_100418412 | Ga0070698_1004184122 | 72 |
| 32 | 3300005518 | Ga0070699_100006816 | Ga0070699_1000068166 | 72 |
| 33 | 3300005518 | Ga0070699_100078928 | Ga0070699_1000789283 | 72 |
| 34 | 3300005518 | Ga0070699_100164843 | Ga0070699_1001648432 | 72 |
| 35 | 3300005535 | Ga0070684_100000016 | Ga0070684_10000001630 | 72 |
| 36 | 3300005535 | Ga0070684_100172897 | Ga0070684_1001728973 | 72 |
| 37 | 3300005536 | Ga0070697_100058036 | Ga0070697_1000580363 | 72 |
| 38 | 3300005536 | Ga0070697_100130702 | Ga0070697_1001307022 | 72 |
| 39 | 3300005536 | Ga0070697_101917116 | Ga0070697_1019171161 | 72 |
| 40 | 3300005539 | Ga0068853_100030119 | Ga0068853_1000301193 | 72 |
| 41 | 3300005546 | Ga0070696_101639586 | Ga0070696_1016395861 | 72 |
| 42 | 3300005546 | Ga0070696_101712463 | Ga0070696_1017124631 | 72 |
| 43 | 3300005549 | Ga0070704_100546651 | Ga0070704_1005466513 | 72 |
| 44 | 3300005578 | Ga0068854_100001343 | Ga0068854_10000134316 | 72 |
| 45 | 3300005578 | Ga0068854_100012550 | Ga0068854_1000125504 | 72 |
| 46 | 3300005578 | Ga0068854_100135619 | Ga0068854_1001356191 | 72 |
| 47 | 3300005834 | Ga0068851_10125151 | Ga0068851_101251513 | 72 |
| 48 | 3300006028 | Ga0070717_10000405 | Ga0070717_100004054 | 72 |
| 49 | 3300006028 | Ga0070717_10847614 | Ga0070717_108476141 | 72 |
| 50 | 3300006028 | Ga0070717_11044945 | Ga0070717_110449452 | 72 |
| 51 | 3300006028 | Ga0070717_11085895 | Ga0070717_110858952 | 72 |
| 52 | 3300006028 | Ga0070717_11433015 | Ga0070717_114330152 | 72 |
| 53 | 3300006173 | Ga0070716_100012975 | Ga0070716_1000129754 | 72 |
| 54 | 3300006237 | Ga0097621_100880401 | Ga0097621_1008804013 | 72 |
| 55 | 3300006358 | Ga0068871_100342687 | Ga0068871_1003426872 | 72 |
| 56 | 3300007076 | Ga0075435_101342259 | Ga0075435_1013422592 | 72 |
| 57 | 3300009093 | Ga0105240_10053472 | Ga0105240_100534723 | 72 |
| 58 | 3300009098 | Ga0105245_10000497 | Ga0105245_100004974 | 72 |
| 59 | 3300009098 | Ga0105245_11091313 | Ga0105245_110913132 | 72 |
| 60 | 3300009098 | Ga0105245_11600408 | Ga0105245_116004081 | 72 |
| 61 | 3300009147 | Ga0114129_12266935 | Ga0114129_122669351 | 72 |
| 62 | 3300009147 | Ga0114129_12278767 | Ga0114129_122787672 | 72 |
| 63 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001197 | 72 |
| 64 | 3300010375 | Ga0105239_10884201 | Ga0105239_108842012 | 72 |
| 65 | 3300013105 | Ga0157369_10498832 | Ga0157369_104988322 | 72 |
| 66 | 3300013296 | Ga0157374_10000010 | Ga0157374_10000010192 | 72 |
| 67 | 3300013297 | Ga0157378_10751041 | Ga0157378_107510412 | 72 |
| 68 | 3300013306 | Ga0163162_10086610 | Ga0163162_100866103 | 72 |
| 69 | 3300013308 | Ga0157375_11308055 | Ga0157375_113080552 | 72 |
| 70 | 3300014745 | Ga0157377_10000017 | Ga0157377_1000001760 | 72 |
| 71 | 3300014745 | Ga0157377_10155471 | Ga0157377_101554711 | 72 |
| 72 | 3300014969 | Ga0157376_11222547 | Ga0157376_112225471 | 72 |
| 73 | 3300015265 | Ga0182005_1307777 | Ga0182005_13077772 | 72 |
| 74 | 3300021384 | Ga0213876_10000012 | Ga0213876_1000001274 | 72 |
| 75 | 3300021384 | Ga0213876_10003866 | Ga0213876_100038661 | 72 |
| 76 | 3300021384 | Ga0213876_10116815 | Ga0213876_101168152 | 72 |
| 77 | 3300025321 | Ga0207656_10173822 | Ga0207656_101738222 | 72 |
| 78 | 3300025893 | Ga0207682_10243911 | Ga0207682_102439111 | 72 |
| 79 | 3300025906 | Ga0207699_10986687 | Ga0207699_109866871 | 72 |
| 80 | 3300025907 | Ga0207645_11179343 | Ga0207645_111793431 | 72 |
| 81 | 3300025910 | Ga0207684_10049730 | Ga0207684_100497303 | 72 |
| 82 | 3300025910 | Ga0207684_10222450 | Ga0207684_102224501 | 72 |
| 83 | 3300025910 | Ga0207684_10277005 | Ga0207684_102770052 | 72 |
| 84 | 3300025910 | Ga0207684_10444817 | Ga0207684_104448171 | 72 |
| 85 | 3300025910 | Ga0207684_10841042 | Ga0207684_108410421 | 72 |
| 86 | 3300025913 | Ga0207695_10433558 | Ga0207695_104335582 | 72 |
| 87 | 3300025918 | Ga0207662_10483730 | Ga0207662_104837302 | 72 |
| 88 | 3300025918 | Ga0207662_10505653 | Ga0207662_105056531 | 72 |
| 89 | 3300025922 | Ga0207646_10013774 | Ga0207646_100137743 | 72 |
| 90 | 3300025922 | Ga0207646_10063188 | Ga0207646_100631883 | 72 |
| 91 | 3300025922 | Ga0207646_10428933 | Ga0207646_104289332 | 72 |
| 92 | 3300025922 | Ga0207646_10464667 | Ga0207646_104646672 | 72 |
| 93 | 3300025922 | Ga0207646_10917611 | Ga0207646_109176112 | 72 |
| 94 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011241 | 72 |
| 95 | 3300025927 | Ga0207687_10000443 | Ga0207687_100004433 | 72 |
| 96 | 3300025927 | Ga0207687_10769111 | Ga0207687_107691112 | 72 |
| 97 | 3300025928 | Ga0207700_10018296 | Ga0207700_100182963 | 72 |
| 98 | 3300025929 | Ga0207664_10720680 | Ga0207664_107206802 | 72 |
| 99 | 3300025931 | Ga0207644_10480939 | Ga0207644_104809392 | 72 |
| 100 | 3300025939 | Ga0207665_10136041 | Ga0207665_101360412 | 72 |
| 101 | 3300025939 | Ga0207665_10270651 | Ga0207665_102706512 | 72 |
| 102 | 3300025942 | Ga0207689_10306962 | Ga0207689_103069621 | 72 |
| 103 | 3300025942 | Ga0207689_11358414 | Ga0207689_113584142 | 72 |
| 104 | 3300025944 | Ga0207661_10000004 | Ga0207661_10000004276 | 72 |
| 105 | 3300025981 | Ga0207640_10003800 | Ga0207640_1000380010 | 72 |
| 106 | 3300025981 | Ga0207640_10038299 | Ga0207640_100382994 | 72 |
| 107 | 3300026041 | Ga0207639_10000015 | Ga0207639_1000001538 | 72 |
| 108 | 3300026116 | Ga0207674_10577313 | Ga0207674_105773132 | 72 |
| 109 | 3300026121 | Ga0207683_10103590 | Ga0207683_101035902 | 72 |
| 110 | 3300031824 | Ga0307413_11522466 | Ga0307413_115224662 | 72 |
| 111 | 3300032002 | Ga0307416_100651944 | Ga0307416_1006519442 | 72 |
| 112 | 3300032005 | Ga0307411_11536284 | Ga0307411_115362842 | 72 |
| 113 | 3300035085 | Ga0373929_0240075 | Ga0373929_0240075_49_267 | 72 |
| 114 | 3300035115 | Ga0373941_0011616 | Ga0373941_0011616_1014_1271 | 72 |
| 115 | 3300035115 | Ga0373941_0085094 | Ga0373941_0085094_197_415 | 72 |
| 116 | 3300035115 | Ga0373941_0344171 | Ga0373941_0344171_269_487 | 72 |
| 117 | 3300035170 | Ga0373943_0064122 | Ga0373943_0064122_1214_1432 | 72 |
| 118 | 3300035207 | Ga0373942_0062046 | Ga0373942_0062046_788_1006 | 72 |
| 119 | 3300037853 | Ga0436364_0451345 | Ga0436364_0451345_1058_1276 | 72 |
| 120 | 3300039437 | Ga0436365_0120716 | Ga0436365_0120716_76304_76522 | 72 |
| 121 | 3300039437 | Ga0436365_0605555 | Ga0436365_0605555_877_1095 | 72 |
| 122 | 3300039437 | Ga0436365_0907894 | Ga0436365_0907894_11689_11907 | 72 |
| 123 | 3300039437 | Ga0436365_1074593 | Ga0436365_1074593_804_1025 | 72 |
| 124 | 3300039437 | Ga0436365_1433868 | Ga0436365_1433868_631_849 | 72 |
| 125 | 3300039450 | Ga0436363_0287128 | Ga0436363_0287128_246_464 | 72 |
| 126 | 3300039453 | Ga0436362_0233778 | Ga0436362_0233778_311_529 | 72 |
| 127 | 3300039453 | Ga0436362_1233885 | Ga0436362_1233885_10427_10645 | 72 |
| 128 | 3300041512 | Ga0451853_0131886 | Ga0451853_0131886_368_592 | 72 |
| 129 | 3300044673 | Ga0453683_0889800 | Ga0453683_0889800_288_506 | 72 |
| 130 | 3300045051 | Ga0451576_0485451 | Ga0451576_0485451_903_1124 | 72 |
| 131 | 3300046539 | Ga0495621_0046223 | Ga0495621_0046223_196_414 | 72 |
| 132 | 3300046539 | Ga0495621_0424919 | Ga0495621_0424919_316_534 | 72 |
| 133 | 3300046674 | Ga0495588_0558112 | Ga0495588_0558112_163_381 | 72 |
| 134 | 3300050507 | nmdc:mga05p37_779131_c1 | nmdc:mga05p37_779131_c1_204_425 | 72 |
| 135 | 3300050509 | nmdc:mga0qj67_1049698_c1 | nmdc:mga0qj67_1049698_c1_369_587 | 72 |
| 136 | 3300050512 | nmdc:mga0n895_205242_c1 | nmdc:mga0n895_205242_c1_946_1164 | 72 |
| 137 | 3300050513 | nmdc:mga0rr50_58502_c1 | nmdc:mga0rr50_58502_c1_883_1140 | 72 |
| 138 | 3300050513 | nmdc:mga0rr50_6337_c1 | nmdc:mga0rr50_6337_c1_3738_3959 | 72 |
| 139 | 3300050513 | nmdc:mga0rr50_75_c1 | nmdc:mga0rr50_75_c1_16361_16582 | 72 |
| 140 | 3300050514 | nmdc:mga08x19_1010_c1 | nmdc:mga08x19_1010_c1_15497_15718 | 72 |
| 141 | 3300050514 | nmdc:mga08x19_356797_c1 | nmdc:mga08x19_356797_c1_624_845 | 72 |
| 142 | 3300053083 | Ga0495655_0000562 | Ga0495655_0000562_473_691 | 72 |
| 143 | 3300059424 | Ga0590075_096872 | Ga0590075_096872_287_505 | 72 |
| 144 | 3300059490 | Ga0587066_225687 | Ga0587066_225687_208_426 | 72 |
| 145 | 3300059491 | Ga0587070_169800 | Ga0587070_169800_41_259 | 72 |
| 146 | 3300059492 | Ga0587073_0302586 | Ga0587073_0302586_226_444 | 72 |
| 147 | 3300059506 | Ga0587085_105086 | Ga0587085_105086_158_376 | 72 |
| 148 | 3300059511 | Ga0587091_176042 | Ga0587091_176042_86_304 | 72 |
| 149 | 3300002155 | JGI24033J26618_1032471 | JGI24033J26618_10324712 | 73 |
| 150 | 3300005293 | Ga0065715_10240824 | Ga0065715_102408242 | 73 |
| 151 | 3300005328 | Ga0070676_10477679 | Ga0070676_104776791 | 73 |
| 152 | 3300005333 | Ga0070677_10045833 | Ga0070677_100458333 | 73 |
| 153 | 3300005334 | Ga0068869_101037756 | Ga0068869_1010377562 | 73 |
| 154 | 3300005337 | Ga0070682_100000006 | Ga0070682_100000006191 | 73 |
| 155 | 3300005338 | Ga0068868_100010699 | Ga0068868_1000106994 | 73 |
| 156 | 3300005340 | Ga0070689_100000475 | Ga0070689_10000047515 | 73 |
| 157 | 3300005340 | Ga0070689_100279279 | Ga0070689_1002792792 | 73 |
| 158 | 3300005340 | Ga0070689_101515190 | Ga0070689_1015151902 | 73 |
| 159 | 3300005343 | Ga0070687_100184125 | Ga0070687_1001841252 | 73 |
| 160 | 3300005345 | Ga0070692_10738236 | Ga0070692_107382361 | 73 |
| 161 | 3300005366 | Ga0070659_101310181 | Ga0070659_1013101811 | 73 |
| 162 | 3300005440 | Ga0070705_101473303 | Ga0070705_1014733032 | 73 |
| 163 | 3300005456 | Ga0070678_101675033 | Ga0070678_1016750332 | 73 |
| 164 | 3300005471 | Ga0070698_100301460 | Ga0070698_1003014603 | 73 |
| 165 | 3300005543 | Ga0070672_100000978 | Ga0070672_10000097820 | 73 |
| 166 | 3300005544 | Ga0070686_100069783 | Ga0070686_1000697832 | 73 |
| 167 | 3300005547 | Ga0070693_100664402 | Ga0070693_1006644021 | 73 |
| 168 | 3300005616 | Ga0068852_101434186 | Ga0068852_1014341861 | 73 |
| 169 | 3300005616 | Ga0068852_102742635 | Ga0068852_1027426351 | 73 |
| 170 | 3300005618 | Ga0068864_100000037 | Ga0068864_10000003767 | 73 |
| 171 | 3300005840 | Ga0068870_10032047 | Ga0068870_100320472 | 73 |
| 172 | 3300005842 | Ga0068858_100000110 | Ga0068858_10000011049 | 73 |
| 173 | 3300006173 | Ga0070716_100509449 | Ga0070716_1005094491 | 73 |
| 174 | 3300006871 | Ga0075434_100444502 | Ga0075434_1004445022 | 73 |
| 175 | 3300009098 | Ga0105245_10017027 | Ga0105245_100170273 | 73 |
| 176 | 3300009147 | Ga0114129_10581845 | Ga0114129_105818453 | 73 |
| 177 | 3300009176 | Ga0105242_10010127 | Ga0105242_100101272 | 73 |
| 178 | 3300009176 | Ga0105242_12564257 | Ga0105242_125642571 | 73 |
| 179 | 3300009177 | Ga0105248_12680047 | Ga0105248_126800471 | 73 |
| 180 | 3300011119 | Ga0105246_11424778 | Ga0105246_114247781 | 73 |
| 181 | 3300013297 | Ga0157378_10191282 | Ga0157378_101912824 | 73 |
| 182 | 3300013297 | Ga0157378_10956771 | Ga0157378_109567711 | 73 |
| 183 | 3300013297 | Ga0157378_11159874 | Ga0157378_111598741 | 73 |
| 184 | 3300013297 | Ga0157378_11324027 | Ga0157378_113240272 | 73 |
| 185 | 3300013308 | Ga0157375_10000013 | Ga0157375_10000013144 | 73 |
| 186 | 3300013308 | Ga0157375_10746389 | Ga0157375_107463892 | 73 |
| 187 | 3300014326 | Ga0157380_10076255 | Ga0157380_100762554 | 73 |
| 188 | 3300014326 | Ga0157380_12899970 | Ga0157380_128999701 | 73 |
| 189 | 3300014745 | Ga0157377_10542961 | Ga0157377_105429612 | 73 |
| 190 | 3300014968 | Ga0157379_10416297 | Ga0157379_104162971 | 73 |
| 191 | 3300025893 | Ga0207682_10122711 | Ga0207682_101227111 | 73 |
| 192 | 3300025908 | Ga0207643_10032453 | Ga0207643_100324532 | 73 |
| 193 | 3300025908 | Ga0207643_10109424 | Ga0207643_101094242 | 73 |
| 194 | 3300025918 | Ga0207662_10424598 | Ga0207662_104245982 | 73 |
| 195 | 3300025927 | Ga0207687_10001279 | Ga0207687_1000127916 | 73 |
| 196 | 3300025934 | Ga0207686_10200315 | Ga0207686_102003151 | 73 |
| 197 | 3300025936 | Ga0207670_10000261 | Ga0207670_1000026119 | 73 |
| 198 | 3300025936 | Ga0207670_10502648 | Ga0207670_105026482 | 73 |
| 199 | 3300025936 | Ga0207670_11392102 | Ga0207670_113921022 | 73 |
| 200 | 3300025940 | Ga0207691_10002718 | Ga0207691_100027183 | 73 |
| 201 | 3300025944 | Ga0207661_10031556 | Ga0207661_100315563 | 73 |
| 202 | 3300026023 | Ga0207677_10000015 | Ga0207677_10000015147 | 73 |
| 203 | 3300026035 | Ga0207703_10000008 | Ga0207703_1000000844 | 73 |
| 204 | 3300026035 | Ga0207703_11731469 | Ga0207703_117314691 | 73 |
| 205 | 3300026089 | Ga0207648_10306863 | Ga0207648_103068632 | 73 |
| 206 | 3300026089 | Ga0207648_10580168 | Ga0207648_105801681 | 73 |
| 207 | 3300026095 | Ga0207676_10000067 | Ga0207676_1000006740 | 73 |
| 208 | 3300026142 | Ga0207698_10782011 | Ga0207698_107820112 | 73 |
| 209 | 3300032002 | Ga0307416_102630731 | Ga0307416_1026307312 | 73 |
| 210 | 3300049589 | Ga0501073_0001012 | Ga0501073_0001012_12305_12526 | 73 |
| 211 | 3300049742 | Ga0501080_0015363 | Ga0501080_0015363_3012_3233 | 73 |
| 212 | 3300050507 | nmdc:mga05p37_994673_c1 | nmdc:mga05p37_994673_c1_300_521 | 73 |
| 213 | 3300050512 | nmdc:mga0n895_267573_c1 | nmdc:mga0n895_267573_c1_989_1210 | 73 |
| 214 | 3300005340 | Ga0070689_101586602 | Ga0070689_1015866022 | 74 |
| 215 | 3300005354 | Ga0070675_100000042 | Ga0070675_10000004240 | 74 |
| 216 | 3300005617 | Ga0068859_101645754 | Ga0068859_1016457542 | 74 |
| 217 | 3300006931 | Ga0097620_101645972 | Ga0097620_1016459722 | 74 |
| 218 | 3300009036 | Ga0105244_10026483 | Ga0105244_100264835 | 74 |
| 219 | 3300025728 | Ga0207655_1024039 | Ga0207655_10240394 | 74 |
| 220 | 3300025926 | Ga0207659_10000045 | Ga0207659_1000004540 | 74 |
| 221 | 3300005336 | Ga0070680_100016466 | Ga0070680_1000164665 | 75 |
| 222 | 3300005615 | Ga0070702_101789470 | Ga0070702_1017894701 | 75 |
| 223 | 3300005719 | Ga0068861_100231967 | Ga0068861_1002319672 | 75 |
| 224 | 3300025917 | Ga0207660_10280177 | Ga0207660_102801771 | 75 |
| 225 | 3300026118 | Ga0207675_100021105 | Ga0207675_1000211053 | 75 |
| 226 | 3300006880 | Ga0075429_100975022 | Ga0075429_1009750222 | 79 |
| 227 | 3300009147 | Ga0114129_10544400 | Ga0114129_105444002 | 79 |
| 228 | 3300050507 | nmdc:mga05p37_509371_c1 | nmdc:mga05p37_509371_c1_346_585 | 79 |
| 229 | 3300050508 | nmdc:mga09592_352776_c1 | nmdc:mga09592_352776_c1_641_880 | 79 |
| 230 | 3300050510 | nmdc:mga06r32_1441439_c1 | nmdc:mga06r32_1441439_c1_331_570 | 79 |
| 231 | 3300014745 | Ga0157377_11022918 | Ga0157377_110229181 | 83 |
| 232 | 3300005334 | Ga0068869_100991107 | Ga0068869_1009911072 | 84 |
| 233 | 3300005441 | Ga0070700_100000037 | Ga0070700_10000003760 | 84 |
| 234 | 3300005466 | Ga0070685_10007137 | Ga0070685_100071375 | 84 |
| 235 | 3300005518 | Ga0070699_101125689 | Ga0070699_1011256892 | 84 |
| 236 | 3300006871 | Ga0075434_100492583 | Ga0075434_1004925831 | 84 |
| 237 | 3300021358 | Ga0213873_10000003 | Ga0213873_10000003507 | 84 |
| 238 | 3300021384 | Ga0213876_10000003 | Ga0213876_10000003361 | 84 |
| 239 | 3300026075 | Ga0207708_10000007 | Ga0207708_10000007208 | 84 |
| 240 | 3300039437 | Ga0436365_1186993 | Ga0436365_1186993_173468_173722 | 84 |
| 241 | 3300039450 | Ga0436363_1513556 | Ga0436363_1513556_124_378 | 84 |
| 242 | 3300039453 | Ga0436362_1234996 | Ga0436362_1234996_97204_97458 | 84 |
| 243 | 2162886012 | MBSR1b_contig_5946352 | MBSR1b_0200.00005250 | 85 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mzk-assembly1.cif.gz_A | crystal structure of mtip from plasmodium falciparum in complex with pgly[807,811], a stapled myoa tail peptide | 0.6558 | 21 | 73 |
| 3wfn-assembly2.cif.gz_C | crystal structure of nav1.6 iq motif in complex with apo-cam | 0.6461 | 23 | 74 |
| 5i0i-assembly2.cif.gz_E | crystal structure of myosin x motor domain with 2iq motifs in pre-powerstroke state | 0.6257 | 17 | 75 |
| 7wr3-assembly2.cif.gz_D | crystal structure of mbp-fused ospc3 in complex with calmodulin | 0.613 | 14 | 77 |
| 1y6w-assembly1.cif.gz_A | trapped intermediate of calmodulin | 0.5876 | 14 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14008_3_71_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.6281 | 17 | 73 | 1.10.238.10 |
| af_A0A0R0J9A4_351_432_1.10.8.430 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Helical domain of apoptotic protease-activating factors | 0.6247 | 27 | 85 | 1.10.8.430 |
| af_C6KTA8_1_70_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.6165 | 20 | 74 | 1.10.238.10 |
| 2aucB01 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5834 | 31 | 73 | 1.10.238.10 |
| 1a2xA00 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5803 | 23 | 74 | 1.10.238.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7YJJ6-F1-model_v4 | Uncharacterized protein | 0.9722 | 17 | 81 |
|
| AF-A0A2V7YG09-F1-model_v4 | Uncharacterized protein | 0.9695 | 17 | 84 |
|
| AF-A0A2V7W094-F1-model_v4 | Uncharacterized protein | 0.9588 | 22 | 79 |
|
| AF-A0A2V7VYM3-F1-model_v4 | Uncharacterized protein | 0.9171 | 17 | 82 |
|
| AF-A0A2V7YG09-F1-model_v4 | Uncharacterized protein | 0.9041 | 17 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar