F355313

General Info

Members Datasets Scaffolds Average Seq Length
243 143 243 74

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100991107|Ga0068869_1009911072
Length 88
Sequence MISARFFVAEVMDEKVDEKAQRVPKLISVSERNLQSAAIRLLPKHNKLVSSEVDYLRRVLGDRATQAQIDEKVLLVRTLPWREIVGET

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
138 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5946352 2162886012 Bacteria 1031
2 JGI24743J22301_10150875 3300001991 Bacteria 521
3 JGI24033J26618_1032471 3300002155 Unclassified 706
4 Ga0065715_10240824 3300005293 Unclassified 1200
5 Ga0070676_10477679 3300005328 Unclassified 881
6 Ga0070683_100000017 3300005329 Bacteria 207189
7 Ga0070690_100135335 3300005330 Bacteria 1668
8 Ga0070677_10045833 3300005333 Bacteria 1746
9 Ga0070677_10230107 3300005333 Unclassified 910
10 Ga0068869_100991107 3300005334 Bacteria 731
11 Ga0068869_101037756 3300005334 Bacteria 715
12 Ga0070680_100016466 3300005336 Bacteria 5819
13 Ga0070682_100000006 3300005337 Bacteria 369078
14 Ga0068868_100010699 3300005338 Bacteria 6650
15 Ga0068868_100630971 3300005338 Unclassified 952
16 Ga0070689_100000475 3300005340 Bacteria 23663
17 Ga0070689_100279279 3300005340 Unclassified 1385
18 Ga0070689_101515190 3300005340 Unclassified 608
19 Ga0070689_101586602 3300005340 Unclassified 594
20 Ga0070687_100184125 3300005343 Bacteria 1253
21 Ga0070687_100227685 3300005343 Bacteria 1145
22 Ga0070692_10018177 3300005345 Bacteria 3375
23 Ga0070692_10738236 3300005345 Unclassified 666
24 Ga0070675_100000042 3300005354 Bacteria 78277
25 Ga0070671_100106895 3300005355 Bacteria 2349
26 Ga0070671_101645008 3300005355 Unclassified 569
27 Ga0070674_100251112 3300005356 Bacteria 1389
28 Ga0070659_101310181 3300005366 Unclassified 642
29 Ga0070713_100001162 3300005436 Bacteria 16813
30 Ga0070701_10000082 3300005438 Bacteria 26358
31 Ga0070711_101639265 3300005439 Unclassified 563
32 Ga0070705_101473303 3300005440 Unclassified 569
33 Ga0070700_100000037 3300005441 Bacteria 109998
34 Ga0070708_100046989 3300005445 Bacteria 3811
35 Ga0070708_100091008 3300005445 Bacteria 2778
36 Ga0070678_100083307 3300005456 Bacteria 2431
37 Ga0070678_101675033 3300005456 Bacteria 598
38 Ga0070685_10007137 3300005466 Bacteria 5705
39 Ga0070706_100034484 3300005467 Bacteria 4676
40 Ga0070706_100058376 3300005467 Bacteria 3562
41 Ga0070706_100060061 3300005467 Bacteria 3509
42 Ga0070706_100488774 3300005467 Unclassified 1145
43 Ga0070706_101369100 3300005467 Unclassified 648
44 Ga0070707_100003657 3300005468 Bacteria 14497
45 Ga0070707_100034245 3300005468 Bacteria 4844
46 Ga0070707_100131126 3300005468 Unclassified 2437
47 Ga0070707_100201206 3300005468 Bacteria 1942
48 Ga0070707_100399164 3300005468 Bacteria 1335
49 Ga0070707_100713055 3300005468 Unclassified 966
50 Ga0070698_100039738 3300005471 Unclassified 4839
51 Ga0070698_100053898 3300005471 Bacteria 4085
52 Ga0070698_100301460 3300005471 Bacteria 1533
53 Ga0070698_100418412 3300005471 Bacteria 1274
54 Ga0070699_100006816 3300005518 Bacteria 9940
55 Ga0070699_100078928 3300005518 Unclassified 2867
56 Ga0070699_100164843 3300005518 Bacteria 1962
57 Ga0070699_101125689 3300005518 Unclassified 720
58 Ga0070684_100000016 3300005535 Bacteria 139439
59 Ga0070684_100172897 3300005535 Bacteria 1962
60 Ga0070697_100058036 3300005536 Bacteria 3149
61 Ga0070697_100130702 3300005536 Bacteria 2105
62 Ga0070697_101917116 3300005536 Unclassified 530
63 Ga0068853_100030119 3300005539 Unclassified 4582
64 Ga0070672_100000978 3300005543 Bacteria 17270
65 Ga0070686_100069783 3300005544 Bacteria 2296
66 Ga0070696_101639586 3300005546 Unclassified 553
67 Ga0070696_101712463 3300005546 Unclassified 542
68 Ga0070693_100664402 3300005547 Unclassified 759
69 Ga0070704_100546651 3300005549 Unclassified 1011
70 Ga0068854_100001343 3300005578 Bacteria 14816
71 Ga0068854_100012550 3300005578 Bacteria 5550
72 Ga0068854_100135619 3300005578 Bacteria 1884
73 Ga0068854_102277556 3300005578 Unclassified 502
74 Ga0070702_101789470 3300005615 Unclassified 513
75 Ga0068852_101434186 3300005616 Bacteria 713
76 Ga0068852_102742635 3300005616 Unclassified 512
77 Ga0068859_101645754 3300005617 Bacteria 709
78 Ga0068864_100000037 3300005618 Bacteria 188796
79 Ga0068861_100231967 3300005719 Bacteria 1566
80 Ga0068851_10125151 3300005834 Bacteria 1385
81 Ga0068870_10032047 3300005840 Unclassified 2668
82 Ga0068858_100000110 3300005842 Bacteria 86502
83 Ga0070717_10000405 3300006028 Bacteria 27596
84 Ga0070717_10847614 3300006028 Bacteria 832
85 Ga0070717_11044945 3300006028 Bacteria 744
86 Ga0070717_11085895 3300006028 Unclassified 729
87 Ga0070717_11433015 3300006028 Unclassified 627
88 Ga0070716_100012975 3300006173 Bacteria 4235
89 Ga0070716_100509449 3300006173 Unclassified 889
90 Ga0097621_100880401 3300006237 Bacteria 833
91 Ga0068871_100342687 3300006358 Unclassified 1320
92 Ga0075434_100444502 3300006871 Bacteria 1318
93 Ga0075434_100492583 3300006871 Unclassified 1246
94 Ga0075429_100975022 3300006880 Unclassified 741
95 Ga0097620_101645972 3300006931 Bacteria 709
96 Ga0075435_101342259 3300007076 Unclassified 626
97 Ga0105244_10026483 3300009036 Bacteria 3138
98 Ga0105240_10053472 3300009093 Bacteria 5068
99 Ga0105245_10000497 3300009098 Bacteria 36061
100 Ga0105245_10017027 3300009098 Bacteria 6345
101 Ga0105245_11091313 3300009098 Bacteria 844
102 Ga0105245_11600408 3300009098 Bacteria 703
103 Ga0114129_10544400 3300009147 Unclassified 1510
104 Ga0114129_10581845 3300009147 Bacteria 1453
105 Ga0114129_12266935 3300009147 Unclassified 652
106 Ga0114129_12278767 3300009147 Unclassified 650
107 Ga0105242_10010127 3300009176 Bacteria 7221
108 Ga0105242_12564257 3300009176 Bacteria 558
109 Ga0105248_12680047 3300009177 Unclassified 568
110 Ga0105238_10000001 3300009551 Bacteria 2036163
111 Ga0105239_10884201 3300010375 Bacteria 1025
112 Ga0105246_11424778 3300011119 Unclassified 647
113 Ga0157369_10498832 3300013105 Bacteria 1259
114 Ga0157374_10000010 3300013296 Bacteria 505635
115 Ga0157378_10191282 3300013297 Bacteria 1930
116 Ga0157378_10751041 3300013297 Bacteria 998
117 Ga0157378_10956771 3300013297 Bacteria 889
118 Ga0157378_11159874 3300013297 Unclassified 811
119 Ga0157378_11324027 3300013297 Unclassified 762
120 Ga0163162_10086610 3300013306 Bacteria 3210
121 Ga0157375_10000013 3300013308 Bacteria 323500
122 Ga0157375_10746389 3300013308 Bacteria 1130
123 Ga0157375_11308055 3300013308 Bacteria 852
124 Ga0157380_10076255 3300014326 Bacteria 2728
125 Ga0157380_12899970 3300014326 Bacteria 546
126 Ga0157377_10000017 3300014745 Bacteria 188087
127 Ga0157377_10155471 3300014745 Unclassified 1418
128 Ga0157377_10542961 3300014745 Bacteria 820
129 Ga0157377_11022918 3300014745 Bacteria 627
130 Ga0157379_10416297 3300014968 Unclassified 1237
131 Ga0157376_11222547 3300014969 Unclassified 780
132 Ga0182005_1307777 3300015265 Bacteria 501
133 Ga0213873_10000003 3300021358 Bacteria 973849
134 Ga0213876_10000003 3300021384 Bacteria 973849
135 Ga0213876_10000012 3300021384 Bacteria 396530
136 Ga0213876_10003866 3300021384 Bacteria 8466
137 Ga0213876_10116815 3300021384 Bacteria 1416
138 Ga0207656_10173822 3300025321 Bacteria 1031
139 Ga0207655_1024039 3300025728 Bacteria 2998
140 Ga0207682_10122711 3300025893 Unclassified 1154
141 Ga0207682_10243911 3300025893 Unclassified 835
142 Ga0207699_10986687 3300025906 Bacteria 623
143 Ga0207645_11179343 3300025907 Bacteria 515
144 Ga0207643_10032453 3300025908 Unclassified 2917
145 Ga0207643_10109424 3300025908 Unclassified 1627
146 Ga0207684_10049730 3300025910 Bacteria 3556
147 Ga0207684_10222450 3300025910 Bacteria 1629
148 Ga0207684_10277005 3300025910 Bacteria 1447
149 Ga0207684_10444817 3300025910 Unclassified 1113
150 Ga0207684_10841042 3300025910 Unclassified 774
151 Ga0207695_10433558 3300025913 Unclassified 1198
152 Ga0207660_10280177 3300025917 Bacteria 1323
153 Ga0207662_10424598 3300025918 Unclassified 905
154 Ga0207662_10483730 3300025918 Bacteria 850
155 Ga0207662_10505653 3300025918 Bacteria 832
156 Ga0207646_10013774 3300025922 Bacteria 7718
157 Ga0207646_10063188 3300025922 Bacteria 3305
158 Ga0207646_10428933 3300025922 Unclassified 1193
159 Ga0207646_10464667 3300025922 Bacteria 1141
160 Ga0207646_10917611 3300025922 Unclassified 776
161 Ga0207694_10000001 3300025924 Bacteria 4078485
162 Ga0207659_10000045 3300025926 Bacteria 88264
163 Ga0207687_10000443 3300025927 Bacteria 28146
164 Ga0207687_10001279 3300025927 Bacteria 17204
165 Ga0207687_10769111 3300025927 Bacteria 820
166 Ga0207700_10018296 3300025928 Bacteria 4704
167 Ga0207664_10720680 3300025929 Unclassified 897
168 Ga0207644_10480939 3300025931 Unclassified 1023
169 Ga0207686_10200315 3300025934 Bacteria 1429
170 Ga0207670_10000261 3300025936 Bacteria 33083
171 Ga0207670_10502648 3300025936 Unclassified 984
172 Ga0207670_11392102 3300025936 Unclassified 595
173 Ga0207665_10136041 3300025939 Unclassified 1748
174 Ga0207665_10270651 3300025939 Bacteria 1261
175 Ga0207691_10002718 3300025940 Bacteria 17285
176 Ga0207689_10306962 3300025942 Bacteria 1315
177 Ga0207689_11358414 3300025942 Bacteria 596
178 Ga0207661_10000004 3300025944 Bacteria 606391
179 Ga0207661_10031556 3300025944 Bacteria 4095
180 Ga0207640_10003800 3300025981 Bacteria 8135
181 Ga0207640_10038299 3300025981 Bacteria 3024
182 Ga0207677_10000015 3300026023 Bacteria 173792
183 Ga0207703_10000008 3300026035 Bacteria 373718
184 Ga0207703_11731469 3300026035 Unclassified 601
185 Ga0207639_10000015 3300026041 Bacteria 265362
186 Ga0207708_10000007 3300026075 Bacteria 264612
187 Ga0207648_10306863 3300026089 Unclassified 1424
188 Ga0207648_10580168 3300026089 Bacteria 1032
189 Ga0207676_10000067 3300026095 Bacteria 104863
190 Ga0207674_10577313 3300026116 Bacteria 1086
191 Ga0207675_100021105 3300026118 Bacteria 6069
192 Ga0207683_10103590 3300026121 Bacteria 2542
193 Ga0207698_10782011 3300026142 Bacteria 955
194 Ga0307413_11522466 3300031824 Unclassified 592
195 Ga0307416_100651944 3300032002 Bacteria 1138
196 Ga0307416_102630731 3300032002 Unclassified 600
197 Ga0307411_11536284 3300032005 Bacteria 613
198 Ga0373929_0240075 3300035085 Unclassified 522
199 Ga0373941_0011616 3300035115 Bacteria 2280
200 Ga0373941_0085094 3300035115 Unclassified 1075
201 Ga0373941_0344171 3300035115 Unclassified 605
202 Ga0373943_0064122 3300035170 Bacteria 1844
203 Ga0373942_0062046 3300035207 Bacteria 1073
204 Ga0436364_0451345 3300037853 Bacteria 1354
205 Ga0436365_0120716 3300039437 Bacteria 90169
206 Ga0436365_0605555 3300039437 Bacteria 1190
207 Ga0436365_0907894 3300039437 Bacteria 12637
208 Ga0436365_1074593 3300039437 Bacteria 9969
209 Ga0436365_1186993 3300039437 Bacteria 180001
210 Ga0436365_1433868 3300039437 Bacteria 936
211 Ga0436363_0287128 3300039450 Unclassified 1169
212 Ga0436363_1513556 3300039450 Unclassified 508
213 Ga0436362_0233778 3300039453 Unclassified 547
214 Ga0436362_1233885 3300039453 Bacteria 23331
215 Ga0436362_1234996 3300039453 Bacteria 292548
216 Ga0451853_0131886 3300041512 Unclassified 736
217 Ga0453683_0889800 3300044673 Unclassified 588
218 Ga0451576_0485451 3300045051 Bacteria 1298
219 Ga0495621_0046223 3300046539 Bacteria 1544
220 Ga0495621_0424919 3300046539 Bacteria 566
221 Ga0495588_0558112 3300046674 Unclassified 600
222 Ga0501073_0001012 3300049589 Bacteria 20307
223 Ga0501080_0015363 3300049742 Bacteria 7056
224 nmdc:mga05p37_509371_c1 3300050507 Bacteria 1379
225 nmdc:mga05p37_779131_c1 3300050507 Unclassified 1050
226 nmdc:mga05p37_994673_c1 3300050507 Unclassified 892
227 nmdc:mga09592_352776_c1 3300050508 Bacteria 1273
228 nmdc:mga0qj67_1049698_c1 3300050509 Bacteria 638
229 nmdc:mga06r32_1441439_c1 3300050510 Unclassified 630
230 nmdc:mga0n895_205242_c1 3300050512 Bacteria 2001
231 nmdc:mga0n895_267573_c1 3300050512 Bacteria 1734
232 nmdc:mga0rr50_58502_c1 3300050513 Bacteria 2889
233 nmdc:mga0rr50_6337_c1 3300050513 Bacteria 7191
234 nmdc:mga0rr50_75_c1 3300050513 Bacteria 56801
235 nmdc:mga08x19_1010_c1 3300050514 Bacteria 17579
236 nmdc:mga08x19_356797_c1 3300050514 Bacteria 1021
237 Ga0495655_0000562 3300053083 Bacteria 6121
238 Ga0590075_096872 3300059424 Unclassified 767
239 Ga0587066_225687 3300059490 Unclassified 504
240 Ga0587070_169800 3300059491 Eukaryota 560
241 Ga0587073_0302586 3300059492 Unclassified 521
242 Ga0587085_105086 3300059506 Unclassified 601
243 Ga0587091_176042 3300059511 Unclassified 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100135335 Ga0070690_1001353351 71
2 3300005355 Ga0070671_101645008 Ga0070671_1016450082 71
3 3300005578 Ga0068854_102277556 Ga0068854_1022775561 71
4 3300001991 JGI24743J22301_10150875 JGI24743J22301_101508751 72
5 3300005329 Ga0070683_100000017 Ga0070683_10000001776 72
6 3300005333 Ga0070677_10230107 Ga0070677_102301072 72
7 3300005338 Ga0068868_100630971 Ga0068868_1006309711 72
8 3300005343 Ga0070687_100227685 Ga0070687_1002276852 72
9 3300005345 Ga0070692_10018177 Ga0070692_100181774 72
10 3300005355 Ga0070671_100106895 Ga0070671_1001068952 72
11 3300005356 Ga0070674_100251112 Ga0070674_1002511122 72
12 3300005436 Ga0070713_100001162 Ga0070713_1000011627 72
13 3300005438 Ga0070701_10000082 Ga0070701_100000825 72
14 3300005439 Ga0070711_101639265 Ga0070711_1016392651 72
15 3300005445 Ga0070708_100046989 Ga0070708_1000469893 72
16 3300005445 Ga0070708_100091008 Ga0070708_1000910082 72
17 3300005456 Ga0070678_100083307 Ga0070678_1000833072 72
18 3300005467 Ga0070706_100034484 Ga0070706_1000344842 72
19 3300005467 Ga0070706_100058376 Ga0070706_1000583762 72
20 3300005467 Ga0070706_100060061 Ga0070706_1000600613 72
21 3300005467 Ga0070706_100488774 Ga0070706_1004887742 72
22 3300005467 Ga0070706_101369100 Ga0070706_1013691002 72
23 3300005468 Ga0070707_100003657 Ga0070707_1000036575 72
24 3300005468 Ga0070707_100034245 Ga0070707_1000342453 72
25 3300005468 Ga0070707_100131126 Ga0070707_1001311263 72
26 3300005468 Ga0070707_100201206 Ga0070707_1002012062 72
27 3300005468 Ga0070707_100399164 Ga0070707_1003991642 72
28 3300005468 Ga0070707_100713055 Ga0070707_1007130552 72
29 3300005471 Ga0070698_100039738 Ga0070698_1000397382 72
30 3300005471 Ga0070698_100053898 Ga0070698_1000538982 72
31 3300005471 Ga0070698_100418412 Ga0070698_1004184122 72
32 3300005518 Ga0070699_100006816 Ga0070699_1000068166 72
33 3300005518 Ga0070699_100078928 Ga0070699_1000789283 72
34 3300005518 Ga0070699_100164843 Ga0070699_1001648432 72
35 3300005535 Ga0070684_100000016 Ga0070684_10000001630 72
36 3300005535 Ga0070684_100172897 Ga0070684_1001728973 72
37 3300005536 Ga0070697_100058036 Ga0070697_1000580363 72
38 3300005536 Ga0070697_100130702 Ga0070697_1001307022 72
39 3300005536 Ga0070697_101917116 Ga0070697_1019171161 72
40 3300005539 Ga0068853_100030119 Ga0068853_1000301193 72
41 3300005546 Ga0070696_101639586 Ga0070696_1016395861 72
42 3300005546 Ga0070696_101712463 Ga0070696_1017124631 72
43 3300005549 Ga0070704_100546651 Ga0070704_1005466513 72
44 3300005578 Ga0068854_100001343 Ga0068854_10000134316 72
45 3300005578 Ga0068854_100012550 Ga0068854_1000125504 72
46 3300005578 Ga0068854_100135619 Ga0068854_1001356191 72
47 3300005834 Ga0068851_10125151 Ga0068851_101251513 72
48 3300006028 Ga0070717_10000405 Ga0070717_100004054 72
49 3300006028 Ga0070717_10847614 Ga0070717_108476141 72
50 3300006028 Ga0070717_11044945 Ga0070717_110449452 72
51 3300006028 Ga0070717_11085895 Ga0070717_110858952 72
52 3300006028 Ga0070717_11433015 Ga0070717_114330152 72
53 3300006173 Ga0070716_100012975 Ga0070716_1000129754 72
54 3300006237 Ga0097621_100880401 Ga0097621_1008804013 72
55 3300006358 Ga0068871_100342687 Ga0068871_1003426872 72
56 3300007076 Ga0075435_101342259 Ga0075435_1013422592 72
57 3300009093 Ga0105240_10053472 Ga0105240_100534723 72
58 3300009098 Ga0105245_10000497 Ga0105245_100004974 72
59 3300009098 Ga0105245_11091313 Ga0105245_110913132 72
60 3300009098 Ga0105245_11600408 Ga0105245_116004081 72
61 3300009147 Ga0114129_12266935 Ga0114129_122669351 72
62 3300009147 Ga0114129_12278767 Ga0114129_122787672 72
63 3300009551 Ga0105238_10000001 Ga0105238_10000001197 72
64 3300010375 Ga0105239_10884201 Ga0105239_108842012 72
65 3300013105 Ga0157369_10498832 Ga0157369_104988322 72
66 3300013296 Ga0157374_10000010 Ga0157374_10000010192 72
67 3300013297 Ga0157378_10751041 Ga0157378_107510412 72
68 3300013306 Ga0163162_10086610 Ga0163162_100866103 72
69 3300013308 Ga0157375_11308055 Ga0157375_113080552 72
70 3300014745 Ga0157377_10000017 Ga0157377_1000001760 72
71 3300014745 Ga0157377_10155471 Ga0157377_101554711 72
72 3300014969 Ga0157376_11222547 Ga0157376_112225471 72
73 3300015265 Ga0182005_1307777 Ga0182005_13077772 72
74 3300021384 Ga0213876_10000012 Ga0213876_1000001274 72
75 3300021384 Ga0213876_10003866 Ga0213876_100038661 72
76 3300021384 Ga0213876_10116815 Ga0213876_101168152 72
77 3300025321 Ga0207656_10173822 Ga0207656_101738222 72
78 3300025893 Ga0207682_10243911 Ga0207682_102439111 72
79 3300025906 Ga0207699_10986687 Ga0207699_109866871 72
80 3300025907 Ga0207645_11179343 Ga0207645_111793431 72
81 3300025910 Ga0207684_10049730 Ga0207684_100497303 72
82 3300025910 Ga0207684_10222450 Ga0207684_102224501 72
83 3300025910 Ga0207684_10277005 Ga0207684_102770052 72
84 3300025910 Ga0207684_10444817 Ga0207684_104448171 72
85 3300025910 Ga0207684_10841042 Ga0207684_108410421 72
86 3300025913 Ga0207695_10433558 Ga0207695_104335582 72
87 3300025918 Ga0207662_10483730 Ga0207662_104837302 72
88 3300025918 Ga0207662_10505653 Ga0207662_105056531 72
89 3300025922 Ga0207646_10013774 Ga0207646_100137743 72
90 3300025922 Ga0207646_10063188 Ga0207646_100631883 72
91 3300025922 Ga0207646_10428933 Ga0207646_104289332 72
92 3300025922 Ga0207646_10464667 Ga0207646_104646672 72
93 3300025922 Ga0207646_10917611 Ga0207646_109176112 72
94 3300025924 Ga0207694_10000001 Ga0207694_100000011241 72
95 3300025927 Ga0207687_10000443 Ga0207687_100004433 72
96 3300025927 Ga0207687_10769111 Ga0207687_107691112 72
97 3300025928 Ga0207700_10018296 Ga0207700_100182963 72
98 3300025929 Ga0207664_10720680 Ga0207664_107206802 72
99 3300025931 Ga0207644_10480939 Ga0207644_104809392 72
100 3300025939 Ga0207665_10136041 Ga0207665_101360412 72
101 3300025939 Ga0207665_10270651 Ga0207665_102706512 72
102 3300025942 Ga0207689_10306962 Ga0207689_103069621 72
103 3300025942 Ga0207689_11358414 Ga0207689_113584142 72
104 3300025944 Ga0207661_10000004 Ga0207661_10000004276 72
105 3300025981 Ga0207640_10003800 Ga0207640_1000380010 72
106 3300025981 Ga0207640_10038299 Ga0207640_100382994 72
107 3300026041 Ga0207639_10000015 Ga0207639_1000001538 72
108 3300026116 Ga0207674_10577313 Ga0207674_105773132 72
109 3300026121 Ga0207683_10103590 Ga0207683_101035902 72
110 3300031824 Ga0307413_11522466 Ga0307413_115224662 72
111 3300032002 Ga0307416_100651944 Ga0307416_1006519442 72
112 3300032005 Ga0307411_11536284 Ga0307411_115362842 72
113 3300035085 Ga0373929_0240075 Ga0373929_0240075_49_267 72
114 3300035115 Ga0373941_0011616 Ga0373941_0011616_1014_1271 72
115 3300035115 Ga0373941_0085094 Ga0373941_0085094_197_415 72
116 3300035115 Ga0373941_0344171 Ga0373941_0344171_269_487 72
117 3300035170 Ga0373943_0064122 Ga0373943_0064122_1214_1432 72
118 3300035207 Ga0373942_0062046 Ga0373942_0062046_788_1006 72
119 3300037853 Ga0436364_0451345 Ga0436364_0451345_1058_1276 72
120 3300039437 Ga0436365_0120716 Ga0436365_0120716_76304_76522 72
121 3300039437 Ga0436365_0605555 Ga0436365_0605555_877_1095 72
122 3300039437 Ga0436365_0907894 Ga0436365_0907894_11689_11907 72
123 3300039437 Ga0436365_1074593 Ga0436365_1074593_804_1025 72
124 3300039437 Ga0436365_1433868 Ga0436365_1433868_631_849 72
125 3300039450 Ga0436363_0287128 Ga0436363_0287128_246_464 72
126 3300039453 Ga0436362_0233778 Ga0436362_0233778_311_529 72
127 3300039453 Ga0436362_1233885 Ga0436362_1233885_10427_10645 72
128 3300041512 Ga0451853_0131886 Ga0451853_0131886_368_592 72
129 3300044673 Ga0453683_0889800 Ga0453683_0889800_288_506 72
130 3300045051 Ga0451576_0485451 Ga0451576_0485451_903_1124 72
131 3300046539 Ga0495621_0046223 Ga0495621_0046223_196_414 72
132 3300046539 Ga0495621_0424919 Ga0495621_0424919_316_534 72
133 3300046674 Ga0495588_0558112 Ga0495588_0558112_163_381 72
134 3300050507 nmdc:mga05p37_779131_c1 nmdc:mga05p37_779131_c1_204_425 72
135 3300050509 nmdc:mga0qj67_1049698_c1 nmdc:mga0qj67_1049698_c1_369_587 72
136 3300050512 nmdc:mga0n895_205242_c1 nmdc:mga0n895_205242_c1_946_1164 72
137 3300050513 nmdc:mga0rr50_58502_c1 nmdc:mga0rr50_58502_c1_883_1140 72
138 3300050513 nmdc:mga0rr50_6337_c1 nmdc:mga0rr50_6337_c1_3738_3959 72
139 3300050513 nmdc:mga0rr50_75_c1 nmdc:mga0rr50_75_c1_16361_16582 72
140 3300050514 nmdc:mga08x19_1010_c1 nmdc:mga08x19_1010_c1_15497_15718 72
141 3300050514 nmdc:mga08x19_356797_c1 nmdc:mga08x19_356797_c1_624_845 72
142 3300053083 Ga0495655_0000562 Ga0495655_0000562_473_691 72
143 3300059424 Ga0590075_096872 Ga0590075_096872_287_505 72
144 3300059490 Ga0587066_225687 Ga0587066_225687_208_426 72
145 3300059491 Ga0587070_169800 Ga0587070_169800_41_259 72
146 3300059492 Ga0587073_0302586 Ga0587073_0302586_226_444 72
147 3300059506 Ga0587085_105086 Ga0587085_105086_158_376 72
148 3300059511 Ga0587091_176042 Ga0587091_176042_86_304 72
149 3300002155 JGI24033J26618_1032471 JGI24033J26618_10324712 73
150 3300005293 Ga0065715_10240824 Ga0065715_102408242 73
151 3300005328 Ga0070676_10477679 Ga0070676_104776791 73
152 3300005333 Ga0070677_10045833 Ga0070677_100458333 73
153 3300005334 Ga0068869_101037756 Ga0068869_1010377562 73
154 3300005337 Ga0070682_100000006 Ga0070682_100000006191 73
155 3300005338 Ga0068868_100010699 Ga0068868_1000106994 73
156 3300005340 Ga0070689_100000475 Ga0070689_10000047515 73
157 3300005340 Ga0070689_100279279 Ga0070689_1002792792 73
158 3300005340 Ga0070689_101515190 Ga0070689_1015151902 73
159 3300005343 Ga0070687_100184125 Ga0070687_1001841252 73
160 3300005345 Ga0070692_10738236 Ga0070692_107382361 73
161 3300005366 Ga0070659_101310181 Ga0070659_1013101811 73
162 3300005440 Ga0070705_101473303 Ga0070705_1014733032 73
163 3300005456 Ga0070678_101675033 Ga0070678_1016750332 73
164 3300005471 Ga0070698_100301460 Ga0070698_1003014603 73
165 3300005543 Ga0070672_100000978 Ga0070672_10000097820 73
166 3300005544 Ga0070686_100069783 Ga0070686_1000697832 73
167 3300005547 Ga0070693_100664402 Ga0070693_1006644021 73
168 3300005616 Ga0068852_101434186 Ga0068852_1014341861 73
169 3300005616 Ga0068852_102742635 Ga0068852_1027426351 73
170 3300005618 Ga0068864_100000037 Ga0068864_10000003767 73
171 3300005840 Ga0068870_10032047 Ga0068870_100320472 73
172 3300005842 Ga0068858_100000110 Ga0068858_10000011049 73
173 3300006173 Ga0070716_100509449 Ga0070716_1005094491 73
174 3300006871 Ga0075434_100444502 Ga0075434_1004445022 73
175 3300009098 Ga0105245_10017027 Ga0105245_100170273 73
176 3300009147 Ga0114129_10581845 Ga0114129_105818453 73
177 3300009176 Ga0105242_10010127 Ga0105242_100101272 73
178 3300009176 Ga0105242_12564257 Ga0105242_125642571 73
179 3300009177 Ga0105248_12680047 Ga0105248_126800471 73
180 3300011119 Ga0105246_11424778 Ga0105246_114247781 73
181 3300013297 Ga0157378_10191282 Ga0157378_101912824 73
182 3300013297 Ga0157378_10956771 Ga0157378_109567711 73
183 3300013297 Ga0157378_11159874 Ga0157378_111598741 73
184 3300013297 Ga0157378_11324027 Ga0157378_113240272 73
185 3300013308 Ga0157375_10000013 Ga0157375_10000013144 73
186 3300013308 Ga0157375_10746389 Ga0157375_107463892 73
187 3300014326 Ga0157380_10076255 Ga0157380_100762554 73
188 3300014326 Ga0157380_12899970 Ga0157380_128999701 73
189 3300014745 Ga0157377_10542961 Ga0157377_105429612 73
190 3300014968 Ga0157379_10416297 Ga0157379_104162971 73
191 3300025893 Ga0207682_10122711 Ga0207682_101227111 73
192 3300025908 Ga0207643_10032453 Ga0207643_100324532 73
193 3300025908 Ga0207643_10109424 Ga0207643_101094242 73
194 3300025918 Ga0207662_10424598 Ga0207662_104245982 73
195 3300025927 Ga0207687_10001279 Ga0207687_1000127916 73
196 3300025934 Ga0207686_10200315 Ga0207686_102003151 73
197 3300025936 Ga0207670_10000261 Ga0207670_1000026119 73
198 3300025936 Ga0207670_10502648 Ga0207670_105026482 73
199 3300025936 Ga0207670_11392102 Ga0207670_113921022 73
200 3300025940 Ga0207691_10002718 Ga0207691_100027183 73
201 3300025944 Ga0207661_10031556 Ga0207661_100315563 73
202 3300026023 Ga0207677_10000015 Ga0207677_10000015147 73
203 3300026035 Ga0207703_10000008 Ga0207703_1000000844 73
204 3300026035 Ga0207703_11731469 Ga0207703_117314691 73
205 3300026089 Ga0207648_10306863 Ga0207648_103068632 73
206 3300026089 Ga0207648_10580168 Ga0207648_105801681 73
207 3300026095 Ga0207676_10000067 Ga0207676_1000006740 73
208 3300026142 Ga0207698_10782011 Ga0207698_107820112 73
209 3300032002 Ga0307416_102630731 Ga0307416_1026307312 73
210 3300049589 Ga0501073_0001012 Ga0501073_0001012_12305_12526 73
211 3300049742 Ga0501080_0015363 Ga0501080_0015363_3012_3233 73
212 3300050507 nmdc:mga05p37_994673_c1 nmdc:mga05p37_994673_c1_300_521 73
213 3300050512 nmdc:mga0n895_267573_c1 nmdc:mga0n895_267573_c1_989_1210 73
214 3300005340 Ga0070689_101586602 Ga0070689_1015866022 74
215 3300005354 Ga0070675_100000042 Ga0070675_10000004240 74
216 3300005617 Ga0068859_101645754 Ga0068859_1016457542 74
217 3300006931 Ga0097620_101645972 Ga0097620_1016459722 74
218 3300009036 Ga0105244_10026483 Ga0105244_100264835 74
219 3300025728 Ga0207655_1024039 Ga0207655_10240394 74
220 3300025926 Ga0207659_10000045 Ga0207659_1000004540 74
221 3300005336 Ga0070680_100016466 Ga0070680_1000164665 75
222 3300005615 Ga0070702_101789470 Ga0070702_1017894701 75
223 3300005719 Ga0068861_100231967 Ga0068861_1002319672 75
224 3300025917 Ga0207660_10280177 Ga0207660_102801771 75
225 3300026118 Ga0207675_100021105 Ga0207675_1000211053 75
226 3300006880 Ga0075429_100975022 Ga0075429_1009750222 79
227 3300009147 Ga0114129_10544400 Ga0114129_105444002 79
228 3300050507 nmdc:mga05p37_509371_c1 nmdc:mga05p37_509371_c1_346_585 79
229 3300050508 nmdc:mga09592_352776_c1 nmdc:mga09592_352776_c1_641_880 79
230 3300050510 nmdc:mga06r32_1441439_c1 nmdc:mga06r32_1441439_c1_331_570 79
231 3300014745 Ga0157377_11022918 Ga0157377_110229181 83
232 3300005334 Ga0068869_100991107 Ga0068869_1009911072 84
233 3300005441 Ga0070700_100000037 Ga0070700_10000003760 84
234 3300005466 Ga0070685_10007137 Ga0070685_100071375 84
235 3300005518 Ga0070699_101125689 Ga0070699_1011256892 84
236 3300006871 Ga0075434_100492583 Ga0075434_1004925831 84
237 3300021358 Ga0213873_10000003 Ga0213873_10000003507 84
238 3300021384 Ga0213876_10000003 Ga0213876_10000003361 84
239 3300026075 Ga0207708_10000007 Ga0207708_10000007208 84
240 3300039437 Ga0436365_1186993 Ga0436365_1186993_173468_173722 84
241 3300039450 Ga0436363_1513556 Ga0436363_1513556_124_378 84
242 3300039453 Ga0436362_1234996 Ga0436362_1234996_97204_97458 84
243 2162886012 MBSR1b_contig_5946352 MBSR1b_0200.00005250 85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzk-assembly1.cif.gz_A crystal structure of mtip from plasmodium falciparum in complex with pgly[807,811], a stapled myoa tail peptide 0.6558 21 73
3wfn-assembly2.cif.gz_C crystal structure of nav1.6 iq motif in complex with apo-cam 0.6461 23 74
5i0i-assembly2.cif.gz_E crystal structure of myosin x motor domain with 2iq motifs in pre-powerstroke state 0.6257 17 75
7wr3-assembly2.cif.gz_D crystal structure of mbp-fused ospc3 in complex with calmodulin 0.613 14 77
1y6w-assembly1.cif.gz_A trapped intermediate of calmodulin 0.5876 14 75
ID Description Score Start End Superfamily
af_O14008_3_71_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6281 17 73 1.10.238.10
af_A0A0R0J9A4_351_432_1.10.8.430 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Helical domain of apoptotic protease-activating factors 0.6247 27 85 1.10.8.430
af_C6KTA8_1_70_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6165 20 74 1.10.238.10
2aucB01 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5834 31 73 1.10.238.10
1a2xA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5803 23 74 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A2V7YJJ6-F1-model_v4 Uncharacterized protein 0.9722 17 81
AF-A0A2V7YG09-F1-model_v4 Uncharacterized protein 0.9695 17 84
AF-A0A2V7W094-F1-model_v4 Uncharacterized protein 0.9588 22 79
AF-A0A2V7VYM3-F1-model_v4 Uncharacterized protein 0.9171 17 82
AF-A0A2V7YG09-F1-model_v4 Uncharacterized protein 0.9041 17 84

Feature Viewer

pLDDT pTM Quality
84.49 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map