F355170

General Info

Members Datasets Scaffolds Average Seq Length
242 179 484 129

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2936002035|2936011149
Length 150
Sequence ARDPWRTTKVWTLCDGSNESMIHHVSVGTNDVRRARAFYDPLMALIGFRILKSSGRAVHYGASDIVFSLETSVNGEPASAGNGVHIAFQAPDRETVRRFHGAALANGGRDEGAPGIREQYSANYYGAFVRDPDGNKIEAVTYTARESFGL

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
174 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
175 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
176 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
177 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
178 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
179 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.22
Nodule 2.48
Rhizoplane 1.65
Rhizosphere 74.79
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005112 3300003214 Bacteria 2605
2 JGI25165J46597_1027128 3300003214 Bacteria 741
3 rootH2_10045638 3300003320 Bacteria 2816
4 rootH1_10114714 3300003323 Bacteria 3383
5 Ga0055529_1024191 3300003763 Bacteria 752
6 Ga0055526_1000177 3300003771 Bacteria 56674
7 Ga0055524_1012701 3300003775 Bacteria 3218
8 Ga0055543_1002687 3300004625 Bacteria 5696
9 Ga0065165_1000044 3300005262 Bacteria 203774
10 Ga0065165_1000309 3300005262 Bacteria 80166
11 Ga0065704_10436914 3300005289 Bacteria 717
12 Ga0070676_10476832 3300005328 Bacteria 882
13 Ga0070690_100085589 3300005330 Bacteria 2068
14 Ga0070670_100306596 3300005331 Bacteria 1389
15 Ga0070670_100416280 3300005331 Bacteria 1188
16 Ga0070670_100881604 3300005331 Bacteria 811
17 Ga0070677_10001317 3300005333 Bacteria 7940
18 Ga0070677_10366765 3300005333 Bacteria 750
19 Ga0070666_10618371 3300005335 Bacteria 791
20 Ga0070680_100130589 3300005336 Unclassified 2101
21 Ga0068868_101925756 3300005338 Bacteria 560
22 Ga0070661_100121528 3300005344 Bacteria 1957
23 Ga0070668_100406628 3300005347 Bacteria 1163
24 Ga0070668_101258790 3300005347 Bacteria 671
25 Ga0070669_100113943 3300005353 Bacteria 2055
26 Ga0070669_100333147 3300005353 Bacteria 1228
27 Ga0070669_100669659 3300005353 Bacteria 874
28 Ga0070675_100006396 3300005354 Bacteria 9040
29 Ga0070675_100018717 3300005354 Bacteria 5513
30 Ga0070675_100030852 3300005354 Bacteria 4329
31 Ga0070671_100038718 3300005355 Bacteria 3957
32 Ga0070671_100400798 3300005355 Bacteria 1174
33 Ga0070673_100004779 3300005364 Bacteria 8605
34 Ga0070688_100732571 3300005365 Bacteria 768
35 Ga0070659_100805412 3300005366 Bacteria 817
36 Ga0070667_100065897 3300005367 Bacteria 3076
37 Ga0070709_10431582 3300005434 Unclassified 989
38 Ga0070701_10550293 3300005438 Bacteria 757
39 Ga0070678_100004055 3300005456 Bacteria 8246
40 Ga0070678_100053086 3300005456 Bacteria 2946
41 Ga0070678_102238610 3300005456 Bacteria 518
42 Ga0070662_100027793 3300005457 Bacteria 3932
43 Ga0070681_10050890 3300005458 Bacteria 4132
44 Ga0068867_100449341 3300005459 Bacteria 1098
45 Ga0070685_10082338 3300005466 Bacteria 1931
46 Ga0070684_100010905 3300005535 Bacteria 7221
47 Ga0068853_100443107 3300005539 Bacteria 1221
48 Ga0070672_100001123 3300005543 Bacteria 16338
49 Ga0070672_100092496 3300005543 Bacteria 2442
50 Ga0070665_100307628 3300005548 Bacteria 1588
51 Ga0070664_100023502 3300005564 Bacteria 5092
52 Ga0068857_101245030 3300005577 Unclassified 721
53 Ga0068852_100085963 3300005616 Bacteria 2802
54 Ga0068852_100401761 3300005616 Bacteria 1348
55 Ga0068864_100011724 3300005618 Bacteria 7238
56 Ga0068864_101383205 3300005618 Bacteria 705
57 Ga0068861_100136440 3300005719 Bacteria 1997
58 Ga0068851_10441846 3300005834 Bacteria 772
59 Ga0068870_10076623 3300005840 Bacteria 1837
60 Ga0068863_100186557 3300005841 Bacteria 1992
61 Ga0068863_100456114 3300005841 Unclassified 1255
62 Ga0068858_100625464 3300005842 Bacteria 1045
63 Ga0081538_10119465 3300005981 Bacteria 1270
64 Ga0075369_10650295 3300006186 Bacteria 506
65 Ga0075370_10307565 3300006353 Bacteria 943
66 Ga0068871_100009741 3300006358 Bacteria 6972
67 Ga0075428_100259736 3300006844 Bacteria 1870
68 Ga0075428_100918936 3300006844 Bacteria 928
69 Ga0075429_100335903 3300006880 Bacteria 1322
70 Ga0105240_10009089 3300009093 Bacteria 14108
71 Ga0105240_10368320 3300009093 Unclassified 1625
72 Ga0111539_12010833 3300009094 Bacteria 670
73 Ga0105245_10982226 3300009098 Bacteria 888
74 Ga0105241_10156853 3300009174 Bacteria 1867
75 Ga0105241_11086849 3300009174 Bacteria 752
76 Ga0105248_11380775 3300009177 Bacteria 797
77 Ga0105238_10474939 3300009551 Bacteria 1249
78 Ga0105249_11182935 3300009553 Bacteria 835
79 Ga0105239_10191866 3300010375 Bacteria 2287
80 Ga0157369_10683015 3300013105 Bacteria 1058
81 Ga0171462_1016 3300013250 Bacteria 164601
82 Ga0157374_10772902 3300013296 Bacteria 976
83 Ga0157374_11755350 3300013296 Bacteria 645
84 Ga0163162_13087803 3300013306 Bacteria 535
85 Ga0157377_10031907 3300014745 Bacteria 2865
86 Ga0157379_11998217 3300014968 Bacteria 573
87 Ga0157376_10066071 3300014969 Bacteria 3056
88 Ga0213876_10101286 3300021384 Bacteria 1527
89 Ga0213876_10205794 3300021384 Bacteria 1046
90 Ga0209677_101098 3300025253 Bacteria 12714
91 Ga0209148_1009660 3300025254 Bacteria 1866
92 Ga0209148_1014912 3300025254 Bacteria 1367
93 Ga0209233_1003789 3300025261 Bacteria 5279
94 Ga0209233_1009202 3300025261 Bacteria 3016
95 Ga0209455_1004607 3300025272 Bacteria 4463
96 Ga0209455_1008190 3300025272 Bacteria 2867
97 Ga0209130_1000089 3300025284 Bacteria 152711
98 Ga0209025_1008978 3300025294 Bacteria 7067
99 Ga0209025_1013843 3300025294 Bacteria 5028
100 Ga0209564_1000366 3300025295 Bacteria 83994
101 Ga0209256_1000808 3300025299 Bacteria 40121
102 Ga0207426_1006577 3300025302 Bacteria 5019
103 Ga0209257_1030188 3300025304 Bacteria 1754
104 Ga0207697_10184321 3300025315 Bacteria 915
105 Ga0207656_10096815 3300025321 Bacteria 1348
106 Ga0207682_10022868 3300025893 Bacteria 2466
107 Ga0207682_10065884 3300025893 Bacteria 1525
108 Ga0207682_10104300 3300025893 Bacteria 1242
109 Ga0207699_10882617 3300025906 Unclassified 659
110 Ga0207705_10526954 3300025909 Bacteria 918
111 Ga0207695_10002860 3300025913 Bacteria 25097
112 Ga0207695_10662594 3300025913 Unclassified 924
113 Ga0207649_10964560 3300025920 Bacteria 670
114 Ga0207652_10486940 3300025921 Bacteria 1111
115 Ga0207681_10454668 3300025923 Bacteria 1042
116 Ga0207694_10144414 3300025924 Bacteria 1915
117 Ga0207650_10040063 3300025925 Bacteria 3426
118 Ga0207650_10303573 3300025925 Bacteria 1304
119 Ga0207650_10588108 3300025925 Bacteria 935
120 Ga0207650_11700509 3300025925 Bacteria 535
121 Ga0207659_10009917 3300025926 Bacteria 5960
122 Ga0207659_10015958 3300025926 Bacteria 4880
123 Ga0207659_10017731 3300025926 Bacteria 4654
124 Ga0207659_11780837 3300025926 Bacteria 523
125 Ga0207644_10108670 3300025931 Bacteria 2094
126 Ga0207644_10650333 3300025931 Bacteria 877
127 Ga0207706_10061093 3300025933 Bacteria 3318
128 Ga0207706_11318632 3300025933 Bacteria 596
129 Ga0207669_11522501 3300025937 Bacteria 570
130 Ga0207691_10005714 3300025940 Bacteria 12029
131 Ga0207691_10021951 3300025940 Bacteria 6023
132 Ga0207661_10195510 3300025944 Bacteria 1776
133 Ga0207679_10057565 3300025945 Bacteria 2875
134 Ga0207651_10003102 3300025960 Bacteria 8083
135 Ga0207651_10008657 3300025960 Bacteria 5512
136 Ga0207712_11805148 3300025961 Bacteria 548
137 Ga0207668_10391972 3300025972 Bacteria 1172
138 Ga0207668_10744340 3300025972 Bacteria 864
139 Ga0207658_10259917 3300025986 Bacteria 1479
140 Ga0207677_10230377 3300026023 Bacteria 1492
141 Ga0207639_10770898 3300026041 Bacteria 895
142 Ga0207678_10129922 3300026067 Bacteria 2148
143 Ga0207678_10178415 3300026067 Bacteria 1814
144 Ga0207708_11381627 3300026075 Bacteria 618
145 Ga0207702_12141892 3300026078 Unclassified 548
146 Ga0207641_10092951 3300026088 Bacteria 2643
147 Ga0207641_10732607 3300026088 Unclassified 975
148 Ga0207648_10230299 3300026089 Bacteria 1648
149 Ga0207676_10119998 3300026095 Bacteria 2215
150 Ga0207675_100815656 3300026118 Bacteria 947
151 Ga0207683_10016301 3300026121 Bacteria 6324
152 Ga0207683_10023219 3300026121 Bacteria 5331
153 Ga0207698_10899018 3300026142 Bacteria 892
154 Ga0209981_1023076 3300027378 Bacteria 894
155 Ga0209971_1087565 3300027682 Bacteria 759
156 Ga0209998_10105733 3300027717 Bacteria 700
157 Ga0268266_10009726 3300028379 Bacteria 8453
158 Ga0268266_10999622 3300028379 Bacteria 809
159 Ga0307408_100050047 3300031548 Bacteria 3003
160 Ga0307408_100159117 3300031548 Bacteria 1792
161 Ga0307413_10324877 3300031824 Bacteria 1177
162 Ga0307413_10560191 3300031824 Unclassified 929
163 Ga0307413_12154766 3300031824 Bacteria 505
164 Ga0307410_10221272 3300031852 Bacteria 1456
165 Ga0307410_10582774 3300031852 Bacteria 931
166 Ga0307407_10323951 3300031903 Bacteria 1082
167 Ga0307412_10196609 3300031911 Bacteria 1528
168 Ga0307409_100341748 3300031995 Bacteria 1409
169 Ga0307409_101778314 3300031995 Bacteria 645
170 Ga0307409_102011298 3300031995 Bacteria 607
171 Ga0307416_100002634 3300032002 Bacteria 10377
172 Ga0307415_100026559 3300032126 Bacteria 3654
173 Ga0307415_102157467 3300032126 Unclassified 545
174 Ga0373925_0613091 3300037068 Bacteria 896
175 Ga0395905_1355673 3300037471 Unclassified 615
176 Ga0436364_0196196 3300037853 Bacteria 2238
177 Ga0237819_20553 3300038705 Bacteria 687
178 Ga0436365_0688712 3300039437 Unclassified 905
179 Ga0436365_1171120 3300039437 Bacteria 875
180 Ga0436365_1246191 3300039437 Bacteria 1375
181 Ga0436365_1637262 3300039437 Bacteria 958
182 Ga0436365_1913695 3300039437 Bacteria 3907
183 Ga0439431_0011245 3300041997 Bacteria 2043
184 Ga0439443_022025 3300042003 Bacteria 1009
185 Ga0450898_126342 3300042134 Bacteria 548
186 Ga0450908_016635 3300042184 Bacteria 1311
187 Ga0439434_0037638 3300042435 Bacteria 1481
188 Ga0439434_0210543 3300042435 Bacteria 657
189 Ga0439435_0003354 3300042436 Bacteria 3322
190 Ga0439444_0098332 3300042437 Bacteria 661
191 Ga0439464_0118515 3300042439 Unclassified 814
192 Ga0439464_0231293 3300042439 Unclassified 595
193 Ga0451577_0572180 3300042876 Bacteria 1025
194 Ga0466965_0653043 3300044683 Bacteria 601
195 Ga0466963_0005426 3300044694 Bacteria 7467
196 Ga0466964_0043198 3300044706 Bacteria 1828
197 Ga0466957_1197119 3300044842 Bacteria 550
198 Ga0466967_0006443 3300045976 Bacteria 8304
199 Ga0495590_0199037 3300046457 Bacteria 736
200 Ga0495606_0263692 3300046507 Bacteria 950
201 Ga0495625_0267365 3300046660 Unclassified 1105
202 Ga0495669_0184484 3300046684 Bacteria 995
203 Ga0495649_0513302 3300046694 Bacteria 595
204 Ga0496102_1043680 3300048905 Bacteria 737
205 Ga0496108_0047944 3300048911 Bacteria 3572
206 Ga0496109_0113065 3300048912 Bacteria 2525
207 Ga0496113_0012014 3300048916 Bacteria 5807
208 Ga0496118_0169431 3300048921 Bacteria 1336
209 Ga0496121_0029808 3300048924 Bacteria 5030
210 Ga0496121_0036968 3300048924 Bacteria 4343
211 Ga0496121_0110047 3300048924 Bacteria 2103
212 Ga0496121_0110522 3300048924 Bacteria 2097
213 Ga0496126_0724574 3300048929 Bacteria 770
214 Ga0501036_1317418 3300049572 Bacteria 587
215 Ga0501036_1382781 3300049572 Unclassified 571
216 Ga0501039_0355048 3300049575 Bacteria 1152
217 Ga0501040_0877291 3300049576 Unclassified 650
218 Ga0501041_0551169 3300049577 Bacteria 735
219 Ga0501042_0661977 3300049578 Bacteria 759
220 Ga0501071_0502682 3300049587 Bacteria 930
221 Ga0501075_0489803 3300049591 Bacteria 938
222 Ga0501076_1545425 3300049592 Bacteria 545
223 nmdc:mga0yw44_19163_c1 3300050492 Bacteria 3766
224 nmdc:mga0yw44_704472_c1 3300050492 Bacteria 686
225 nmdc:mga07m45_295396_c1 3300050496 Bacteria 942
226 nmdc:mga0qj67_454106_c1 3300050509 Bacteria 1032
227 nmdc:mga06r32_60635_c1 3300050510 Bacteria 3641
228 nmdc:mga06r32_744696_c1 3300050510 Bacteria 943
229 nmdc:mga08y16_1332882_c1 3300050511 Bacteria 683
230 Ga0500578_0015066 3300053086 Bacteria 4970
231 Ga0500603_105664 3300053150 Unclassified 841
232 Ga0500616_0014748 3300053153 Bacteria 4483
233 Ga0500636_0001145 3300053177 Bacteria 14219
234 Ga0500601_000144 3300053737 Bacteria 14679
235 2936011149 2936002035 Bacteria 9362176
236 2874630065 2874628541 Bacteria 8630250
237 2932792943 2932784394 Bacteria 9704911
238 2932836940 2932828146 Bacteria 9745859
239 3005599879 3005594810 Bacteria 8716512
240 3005716061 3005710791 Bacteria 7622528
241 8016512451 8016511872 Bacteria 9921665
242 8017066977 8017057580 Bacteria 10023680
243 JGI25165J46597_1005112
244 JGI25165J46597_1027128
245 rootH2_10045638
246 rootH1_10114714
247 Ga0055529_1024191
248 Ga0055526_1000177
249 Ga0055524_1012701
250 Ga0055543_1002687
251 Ga0065165_1000044
252 Ga0065165_1000309
253 Ga0065704_10436914
254 Ga0070676_10476832
255 Ga0070690_100085589
256 Ga0070670_100306596
257 Ga0070670_100416280
258 Ga0070670_100881604
259 Ga0070677_10001317
260 Ga0070677_10366765
261 Ga0070666_10618371
262 Ga0070680_100130589
263 Ga0068868_101925756
264 Ga0070661_100121528
265 Ga0070668_100406628
266 Ga0070668_101258790
267 Ga0070669_100113943
268 Ga0070669_100333147
269 Ga0070669_100669659
270 Ga0070675_100006396
271 Ga0070675_100018717
272 Ga0070675_100030852
273 Ga0070671_100038718
274 Ga0070671_100400798
275 Ga0070673_100004779
276 Ga0070688_100732571
277 Ga0070659_100805412
278 Ga0070667_100065897
279 Ga0070709_10431582
280 Ga0070701_10550293
281 Ga0070678_100004055
282 Ga0070678_100053086
283 Ga0070678_102238610
284 Ga0070662_100027793
285 Ga0070681_10050890
286 Ga0068867_100449341
287 Ga0070685_10082338
288 Ga0070684_100010905
289 Ga0068853_100443107
290 Ga0070672_100001123
291 Ga0070672_100092496
292 Ga0070665_100307628
293 Ga0070664_100023502
294 Ga0068857_101245030
295 Ga0068852_100085963
296 Ga0068852_100401761
297 Ga0068864_100011724
298 Ga0068864_101383205
299 Ga0068861_100136440
300 Ga0068851_10441846
301 Ga0068870_10076623
302 Ga0068863_100186557
303 Ga0068863_100456114
304 Ga0068858_100625464
305 Ga0081538_10119465
306 Ga0075369_10650295
307 Ga0075370_10307565
308 Ga0068871_100009741
309 Ga0075428_100259736
310 Ga0075428_100918936
311 Ga0075429_100335903
312 Ga0105240_10009089
313 Ga0105240_10368320
314 Ga0111539_12010833
315 Ga0105245_10982226
316 Ga0105241_10156853
317 Ga0105241_11086849
318 Ga0105248_11380775
319 Ga0105238_10474939
320 Ga0105249_11182935
321 Ga0105239_10191866
322 Ga0157369_10683015
323 Ga0171462_1016
324 Ga0157374_10772902
325 Ga0157374_11755350
326 Ga0163162_13087803
327 Ga0157377_10031907
328 Ga0157379_11998217
329 Ga0157376_10066071
330 Ga0213876_10101286
331 Ga0213876_10205794
332 Ga0209677_101098
333 Ga0209148_1009660
334 Ga0209148_1014912
335 Ga0209233_1003789
336 Ga0209233_1009202
337 Ga0209455_1004607
338 Ga0209455_1008190
339 Ga0209130_1000089
340 Ga0209025_1008978
341 Ga0209025_1013843
342 Ga0209564_1000366
343 Ga0209256_1000808
344 Ga0207426_1006577
345 Ga0209257_1030188
346 Ga0207697_10184321
347 Ga0207656_10096815
348 Ga0207682_10022868
349 Ga0207682_10065884
350 Ga0207682_10104300
351 Ga0207699_10882617
352 Ga0207705_10526954
353 Ga0207695_10002860
354 Ga0207695_10662594
355 Ga0207649_10964560
356 Ga0207652_10486940
357 Ga0207681_10454668
358 Ga0207694_10144414
359 Ga0207650_10040063
360 Ga0207650_10303573
361 Ga0207650_10588108
362 Ga0207650_11700509
363 Ga0207659_10009917
364 Ga0207659_10015958
365 Ga0207659_10017731
366 Ga0207659_11780837
367 Ga0207644_10108670
368 Ga0207644_10650333
369 Ga0207706_10061093
370 Ga0207706_11318632
371 Ga0207669_11522501
372 Ga0207691_10005714
373 Ga0207691_10021951
374 Ga0207661_10195510
375 Ga0207679_10057565
376 Ga0207651_10003102
377 Ga0207651_10008657
378 Ga0207712_11805148
379 Ga0207668_10391972
380 Ga0207668_10744340
381 Ga0207658_10259917
382 Ga0207677_10230377
383 Ga0207639_10770898
384 Ga0207678_10129922
385 Ga0207678_10178415
386 Ga0207708_11381627
387 Ga0207702_12141892
388 Ga0207641_10092951
389 Ga0207641_10732607
390 Ga0207648_10230299
391 Ga0207676_10119998
392 Ga0207675_100815656
393 Ga0207683_10016301
394 Ga0207683_10023219
395 Ga0207698_10899018
396 Ga0209981_1023076
397 Ga0209971_1087565
398 Ga0209998_10105733
399 Ga0268266_10009726
400 Ga0268266_10999622
401 Ga0307408_100050047
402 Ga0307408_100159117
403 Ga0307413_10324877
404 Ga0307413_10560191
405 Ga0307413_12154766
406 Ga0307410_10221272
407 Ga0307410_10582774
408 Ga0307407_10323951
409 Ga0307412_10196609
410 Ga0307409_100341748
411 Ga0307409_101778314
412 Ga0307409_102011298
413 Ga0307416_100002634
414 Ga0307415_100026559
415 Ga0307415_102157467
416 Ga0373925_0613091
417 Ga0395905_1355673
418 Ga0436364_0196196
419 Ga0237819_20553
420 Ga0436365_0688712
421 Ga0436365_1171120
422 Ga0436365_1246191
423 Ga0436365_1637262
424 Ga0436365_1913695
425 Ga0439431_0011245
426 Ga0439443_022025
427 Ga0450898_126342
428 Ga0450908_016635
429 Ga0439434_0037638
430 Ga0439434_0210543
431 Ga0439435_0003354
432 Ga0439444_0098332
433 Ga0439464_0118515
434 Ga0439464_0231293
435 Ga0451577_0572180
436 Ga0466965_0653043
437 Ga0466963_0005426
438 Ga0466964_0043198
439 Ga0466957_1197119
440 Ga0466967_0006443
441 Ga0495590_0199037
442 Ga0495606_0263692
443 Ga0495625_0267365
444 Ga0495669_0184484
445 Ga0495649_0513302
446 Ga0496102_1043680
447 Ga0496108_0047944
448 Ga0496109_0113065
449 Ga0496113_0012014
450 Ga0496118_0169431
451 Ga0496121_0029808
452 Ga0496121_0036968
453 Ga0496121_0110047
454 Ga0496121_0110522
455 Ga0496126_0724574
456 Ga0501036_1317418
457 Ga0501036_1382781
458 Ga0501039_0355048
459 Ga0501040_0877291
460 Ga0501041_0551169
461 Ga0501042_0661977
462 Ga0501071_0502682
463 Ga0501075_0489803
464 Ga0501076_1545425
465 nmdc:mga0yw44_19163_c1
466 nmdc:mga0yw44_704472_c1
467 nmdc:mga07m45_295396_c1
468 nmdc:mga0qj67_454106_c1
469 nmdc:mga06r32_60635_c1
470 nmdc:mga06r32_744696_c1
471 nmdc:mga08y16_1332882_c1
472 Ga0500578_0015066
473 Ga0500603_105664
474 Ga0500616_0014748
475 Ga0500636_0001145
476 Ga0500601_000144
477 2936011149
478 2874630065
479 2932792943
480 2932836940
481 3005599879
482 3005716061
483 8016512451
484 8017066977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

139

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9279 4 118
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9047 3 118
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9012 4 118
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.879 1 122
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8619 3 118
ID Description Score Start End Superfamily
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8953 6 118 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.879 1 122 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8593 1 122 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8521 61 121 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8449 6 118 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A514BFE7-F1-model_v4 deleted 0.995 62 118
AF-A0A4U9Z0D5-F1-model_v4 deleted 0.992 62 120
AF-A0A7Y8B6K7-F1-model_v4 deleted 0.9871 62 118
AF-A2S116-F1-model_v4 Conserved domain protein 0.9837 63 122
AF-A0A258JSI3-F1-model_v4 Glyoxalase 0.9824 1 122

Map