F354803

General Info

Members Datasets Scaffolds Average Seq Length
242 141 484 106

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10001530|Ga0265313_100015307
Length 122
Sequence VPEHGRPHEACSSLGPMTDRYDRAXDXXLCEAARITPWYHEDDVCWIAECEICATPMVVWRGHGTEPPPEELAHMHAKLAMVVTEHFEFEHYVDDNMRNIPDHYHAHGRPVGGFFGHGMKRK

Samples

Sample ID Description Type Environment
1 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
69 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 13.22
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265313_10001530 3300031595 Bacteria 21512
2 Ga0058860_11577668 3300004801 Unclassified 628
3 Ga0070682_100492554 3300005337 Bacteria 948
4 Ga0070687_100736783 3300005343 Bacteria 692
5 Ga0070671_100014672 3300005355 Bacteria 6333
6 Ga0070667_100147142 3300005367 Bacteria 2067
7 Ga0070678_101660009 3300005456 Bacteria 601
8 Ga0070665_100214693 3300005548 Bacteria 1925
9 Ga0070665_101705399 3300005548 Bacteria 637
10 Ga0070704_100263457 3300005549 Bacteria 1421
11 Ga0068863_100040265 3300005841 Bacteria 4443
12 Ga0068863_100458714 3300005841 Bacteria 1251
13 Ga0068858_100239830 3300005842 Bacteria 1720
14 Ga0068860_100062443 3300005843 Bacteria 3540
15 Ga0068860_102575642 3300005843 Bacteria 528
16 Ga0068862_102298987 3300005844 Bacteria 551
17 Ga0081455_10718912 3300005937 Bacteria 634
18 Ga0070717_10731795 3300006028 Unclassified 899
19 Ga0075363_100790480 3300006048 Bacteria 577
20 Ga0070715_10530295 3300006163 Bacteria 679
21 Ga0070712_101099516 3300006175 Bacteria 690
22 Ga0075367_10116588 3300006178 Bacteria 1643
23 Ga0075370_10257713 3300006353 Bacteria 1034
24 Ga0075429_102006692 3300006880 Bacteria 501
25 Ga0068865_100305315 3300006881 Unclassified 1275
26 Ga0105240_12501164 3300009093 Bacteria 534
27 Ga0111539_11860001 3300009094 Bacteria 698
28 Ga0111539_13029010 3300009094 Bacteria 543
29 Ga0105245_10016048 3300009098 Bacteria 6525
30 Ga0114129_12671349 3300009147 Bacteria 595
31 Ga0105242_10033414 3300009176 Bacteria 4118
32 Ga0105248_12667812 3300009177 Unclassified 570
33 Ga0105246_11093049 3300011119 Bacteria 728
34 Ga0157341_1039361 3300012494 Bacteria 542
35 Ga0157375_11911192 3300013308 Bacteria 705
36 Ga0163163_10178363 3300014325 Bacteria 2171
37 Ga0163163_10264805 3300014325 Bacteria 1770
38 Ga0157380_10976482 3300014326 Unclassified 879
39 Ga0157377_11188669 3300014745 Bacteria 590
40 Ga0157377_11409020 3300014745 Bacteria 550
41 Ga0157379_10072274 3300014968 Bacteria 3086
42 Ga0157379_10194782 3300014968 Unclassified 1831
43 Ga0213876_10200579 3300021384 Bacteria 1060
44 Ga0213876_10282854 3300021384 Bacteria 882
45 Ga0207697_10278951 3300025315 Bacteria 741
46 Ga0207687_10067899 3300025927 Bacteria 2538
47 Ga0207689_10618669 3300025942 Bacteria 912
48 Ga0207661_11977914 3300025944 Bacteria 529
49 Ga0207658_10115694 3300025986 Bacteria 2129
50 Ga0207641_10369587 3300026088 Bacteria 1371
51 Ga0207648_10929710 3300026089 Bacteria 813
52 Ga0268266_10171747 3300028379 Bacteria 1968
53 Ga0268266_10737164 3300028379 Bacteria 951
54 Ga0268266_11523323 3300028379 Bacteria 644
55 Ga0268265_11637237 3300028380 Bacteria 649
56 Ga0268264_10652374 3300028381 Bacteria 1042
57 Ga0268264_11569423 3300028381 Bacteria 669
58 Ga0268264_11961333 3300028381 Bacteria 595
59 Ga0265319_1103725 3300028563 Unclassified 892
60 Ga0265318_10083973 3300028577 Bacteria 1175
61 Ga0265318_10248874 3300028577 Bacteria 649
62 Ga0265322_10032515 3300028654 Bacteria 1488
63 Ga0265338_10000955 3300028800 Bacteria 48703
64 Ga0265338_10176632 3300028800 Bacteria 1632
65 Ga0265320_10172352 3300031240 Bacteria 972
66 Ga0265325_10008265 3300031241 Bacteria 6149
67 Ga0265325_10543762 3300031241 Bacteria 502
68 Ga0265327_10006429 3300031251 Bacteria 9395
69 Ga0265327_10012492 3300031251 Bacteria 5723
70 Ga0265327_10112573 3300031251 Bacteria 1298
71 Ga0265316_10621763 3300031344 Bacteria 765
72 Ga0265313_10373178 3300031595 Bacteria 563
73 Ga0265314_10059791 3300031711 Bacteria 2605
74 Ga0265314_10282653 3300031711 Unclassified 938
75 Ga0265314_10597389 3300031711 Unclassified 569
76 Ga0316576_10907540 3300031727 Bacteria 631
77 Ga0307405_11360111 3300031731 Bacteria 620
78 Ga0307406_10840452 3300031901 Bacteria 778
79 Ga0307409_100783835 3300031995 Bacteria 960
80 Ga0307411_10250244 3300032005 Bacteria 1393
81 Ga0373955_0913564 3300035172 Bacteria 540
82 Ga0316574_0011151 3300035398 Bacteria 5100
83 Ga0373933_0475821 3300035724 Bacteria 818
84 Ga0373937_1041820 3300036401 Bacteria 767
85 Ga0436364_0223666 3300037853 Bacteria 1187
86 Ga0436365_0117919 3300039437 Bacteria 1673
87 Ga0436365_0693920 3300039437 Bacteria 1024
88 Ga0436365_0774550 3300039437 Bacteria 581
89 Ga0436365_1160848 3300039437 Bacteria 1220
90 Ga0436363_0297771 3300039450 Bacteria 1148
91 Ga0439465_0404242 3300041413 Bacteria 520
92 Ga0451800_0168135 3300041459 Bacteria 642
93 Ga0451802_1868703 3300041460 Bacteria 562
94 Ga0451847_0978048 3300041503 Bacteria 676
95 Ga0451851_1180801 3300041507 Bacteria 1041
96 Ga0451853_3558595 3300041512 Bacteria 512
97 Ga0439434_0109394 3300042435 Bacteria 894
98 Ga0439434_0236193 3300042435 Bacteria 623
99 Ga0466963_0686344 3300044694 Bacteria 723
100 Ga0466967_1526292 3300045976 Bacteria 665
101 Ga0495592_0402555 3300046454 Bacteria 866
102 Ga0495653_0139091 3300046463 Bacteria 1710
103 Ga0495653_0584610 3300046463 Bacteria 688
104 Ga0495628_1039313 3300046516 Bacteria 562
105 Ga0495630_1045121 3300046517 Bacteria 620
106 Ga0495644_0456790 3300046523 Bacteria 509
107 Ga0495640_0872160 3300046533 Bacteria 534
108 Ga0495586_0297594 3300046535 Bacteria 924
109 Ga0495587_0204959 3300046536 Bacteria 1115
110 Ga0495667_0139141 3300046559 Bacteria 1565
111 Ga0495667_0528085 3300046559 Bacteria 738
112 Ga0495604_0467343 3300047317 Bacteria 822
113 Ga0495674_0531634 3300047319 Bacteria 938
114 Ga0495672_0000575 3300047320 Bacteria 41492
115 Ga0496101_0499850 3300048904 Unclassified 961
116 Ga0496101_0837652 3300048904 Bacteria 725
117 Ga0496103_0103702 3300048906 Bacteria 1802
118 Ga0496104_0049824 3300048907 Bacteria 3950
119 Ga0496104_0183898 3300048907 Bacteria 2000
120 Ga0496104_0348280 3300048907 Bacteria 1394
121 Ga0496104_1480561 3300048907 Unclassified 582
122 Ga0496104_1744016 3300048907 Bacteria 525
123 Ga0496105_0029504 3300048908 Bacteria 4490
124 Ga0496105_0102402 3300048908 Bacteria 2364
125 Ga0496105_0271037 3300048908 Bacteria 1371
126 Ga0496105_0613333 3300048908 Bacteria 843
127 Ga0496108_0003659 3300048911 Bacteria 12334
128 Ga0496108_0190427 3300048911 Bacteria 1778
129 Ga0496108_0426786 3300048911 Bacteria 1158
130 Ga0496109_0137733 3300048912 Bacteria 2282
131 Ga0496109_0182671 3300048912 Bacteria 1970
132 Ga0496109_0382189 3300048912 Bacteria 1330
133 Ga0496109_0417725 3300048912 Bacteria 1267
134 Ga0496110_0015869 3300048913 Bacteria 6280
135 Ga0496112_0015298 3300048915 Bacteria 7155
136 Ga0496112_0017730 3300048915 Bacteria 6701
137 Ga0496113_0302921 3300048916 Bacteria 1280
138 Ga0496113_0401545 3300048916 Bacteria 1100
139 Ga0496113_0947368 3300048916 Bacteria 680
140 Ga0496114_0842670 3300048917 Bacteria 797
141 Ga0496114_1009046 3300048917 Bacteria 716
142 Ga0496114_1204985 3300048917 Bacteria 643
143 Ga0496115_0168394 3300048918 Unclassified 1812
144 Ga0496115_0779116 3300048918 Bacteria 746
145 Ga0501032_0214807 3300049569 Bacteria 1253
146 Ga0501034_0001792 3300049571 Bacteria 27431
147 Ga0501036_0472153 3300049572 Bacteria 1044
148 Ga0501036_1071875 3300049572 Bacteria 659
149 Ga0501037_0775515 3300049573 Bacteria 634
150 Ga0501038_0336916 3300049574 Unclassified 1177
151 Ga0501039_0022329 3300049575 Bacteria 4858
152 Ga0501039_0263027 3300049575 Bacteria 1356
153 Ga0501040_0005244 3300049576 Bacteria 8377
154 Ga0501040_0018007 3300049576 Bacteria 4689
155 Ga0501041_0007281 3300049577 Bacteria 6498
156 Ga0501041_0250281 3300049577 Bacteria 1114
157 Ga0501041_0408737 3300049577 Bacteria 860
158 Ga0501042_0305680 3300049578 Bacteria 1149
159 Ga0501046_0343627 3300049580 Unclassified 1084
160 Ga0501048_0070250 3300049582 Bacteria 2473
161 Ga0501048_0302618 3300049582 Unclassified 1138
162 Ga0501048_1033152 3300049582 Bacteria 591
163 Ga0501067_0377676 3300049583 Bacteria 790
164 Ga0501068_0000138 3300049584 Bacteria 33430
165 Ga0501068_0008894 3300049584 Bacteria 5603
166 Ga0501068_0374168 3300049584 Bacteria 917
167 Ga0501068_0833488 3300049584 Bacteria 605
168 Ga0501069_0041239 3300049585 Bacteria 2551
169 Ga0501069_0202843 3300049585 Bacteria 1150
170 Ga0501070_0097035 3300049586 Bacteria 2438
171 Ga0501070_0104232 3300049586 Bacteria 2345
172 Ga0501070_0524215 3300049586 Bacteria 950
173 Ga0501070_0568445 3300049586 Bacteria 906
174 Ga0501071_0031099 3300049587 Bacteria 3781
175 Ga0501071_0203466 3300049587 Bacteria 1488
176 Ga0501071_0248815 3300049587 Bacteria 1341
177 Ga0501072_0008102 3300049588 Bacteria 7974
178 Ga0501072_0012719 3300049588 Bacteria 6435
179 Ga0501072_0125420 3300049588 Bacteria 2045
180 Ga0501072_0382676 3300049588 Bacteria 1116
181 Ga0501073_0000572 3300049589 Bacteria 25964
182 Ga0501073_0167286 3300049589 Bacteria 1522
183 Ga0501073_0397683 3300049589 Bacteria 952
184 Ga0501073_0445935 3300049589 Bacteria 895
185 Ga0501073_0457358 3300049589 Bacteria 882
186 Ga0501073_0484442 3300049589 Bacteria 855
187 Ga0501073_0735682 3300049589 Bacteria 680
188 Ga0501074_0012187 3300049590 Bacteria 6250
189 Ga0501074_0084703 3300049590 Bacteria 2272
190 Ga0501074_0111433 3300049590 Bacteria 1958
191 Ga0501074_0301402 3300049590 Bacteria 1138
192 Ga0501074_1254435 3300049590 Bacteria 520
193 Ga0501075_0739831 3300049591 Bacteria 749
194 Ga0501075_1372225 3300049591 Bacteria 535
195 Ga0501076_0005751 3300049592 Bacteria 8934
196 Ga0501076_0271364 3300049592 Bacteria 1389
197 Ga0501076_1432938 3300049592 Bacteria 567
198 Ga0501079_0264485 3300049741 Bacteria 1344
199 Ga0501079_0386003 3300049741 Unclassified 1098
200 Ga0501079_0611463 3300049741 Bacteria 858
201 Ga0501080_0008959 3300049742 Bacteria 9101
202 Ga0501080_0108175 3300049742 Bacteria 2577
203 Ga0501080_0164555 3300049742 Bacteria 2047
204 Ga0501080_0194018 3300049742 Bacteria 1866
205 Ga0501081_0086675 3300049743 Unclassified 2198
206 Ga0501081_1148825 3300049743 Bacteria 588
207 Ga0501083_0014316 3300049744 Bacteria 5548
208 Ga0501083_0125646 3300049744 Bacteria 1681
209 Ga0501083_0163600 3300049744 Bacteria 1455
210 Ga0501083_1101428 3300049744 Bacteria 517
211 Ga0501035_0281377 3300049822 Unclassified 1406
212 Ga0501044_0656653 3300049823 Bacteria 937
213 Ga0501045_0105941 3300049824 Bacteria 2083
214 Ga0501045_0584479 3300049824 Unclassified 827
215 Ga0501045_0891099 3300049824 Bacteria 654
216 Ga0501045_0898940 3300049824 Bacteria 651
217 nmdc:mga03n38_341430_c1 3300050490 Bacteria 813
218 nmdc:mga03n38_793710_c1 3300050490 Bacteria 551
219 nmdc:mga00v17_483761_c1 3300050491 Bacteria 803
220 nmdc:mga0yw44_263343_c1 3300050492 Bacteria 1149
221 nmdc:mga06z11_522518_c1 3300050494 Bacteria 720
222 nmdc:mga07m45_286408_c1 3300050496 Bacteria 958
223 nmdc:mga08y16_436216_c1 3300050511 Bacteria 1337
224 nmdc:mga0n895_16175_c1 3300050512 Bacteria 6838
225 nmdc:mga0n895_337191_c1 3300050512 Bacteria 1527
226 nmdc:mga0rr50_1117130_c1 3300050513 Bacteria 670
227 Ga0495601_0084756 3300053077 Bacteria 2036
228 Ga0495619_0033507 3300053085 Bacteria 3336
229 Ga0500616_0038106 3300053153 Bacteria 2598
230 Ga0501084_0000026 3300054114 Bacteria 132271
231 Ga0501084_0056803 3300054114 Bacteria 3275
232 Ga0501084_0086395 3300054114 Bacteria 2634
233 Ga0501084_0487771 3300054114 Bacteria 1041
234 Ga0501084_0558925 3300054114 Bacteria 967
235 Ga0501082_0219621 3300060353 Bacteria 1654
236 Ga0501082_0245522 3300060353 Bacteria 1558
237 Ga0501082_0501997 3300060353 Bacteria 1060
238 Ga0501082_0826750 3300060353 Bacteria 810
239 Ga0501082_1337666 3300060353 Bacteria 626
240 Ga0530510_0143823 3300061734 Unclassified 1758
241 Ga0530510_0898717 3300061734 Bacteria 677
242 Ga0530510_1339080 3300061734 Bacteria 549
243 Ga0265313_10001530
244 Ga0058860_11577668
245 Ga0070682_100492554
246 Ga0070687_100736783
247 Ga0070671_100014672
248 Ga0070667_100147142
249 Ga0070678_101660009
250 Ga0070665_100214693
251 Ga0070665_101705399
252 Ga0070704_100263457
253 Ga0068863_100040265
254 Ga0068863_100458714
255 Ga0068858_100239830
256 Ga0068860_100062443
257 Ga0068860_102575642
258 Ga0068862_102298987
259 Ga0081455_10718912
260 Ga0070717_10731795
261 Ga0075363_100790480
262 Ga0070715_10530295
263 Ga0070712_101099516
264 Ga0075367_10116588
265 Ga0075370_10257713
266 Ga0075429_102006692
267 Ga0068865_100305315
268 Ga0105240_12501164
269 Ga0111539_11860001
270 Ga0111539_13029010
271 Ga0105245_10016048
272 Ga0114129_12671349
273 Ga0105242_10033414
274 Ga0105248_12667812
275 Ga0105246_11093049
276 Ga0157341_1039361
277 Ga0157375_11911192
278 Ga0163163_10178363
279 Ga0163163_10264805
280 Ga0157380_10976482
281 Ga0157377_11188669
282 Ga0157377_11409020
283 Ga0157379_10072274
284 Ga0157379_10194782
285 Ga0213876_10200579
286 Ga0213876_10282854
287 Ga0207697_10278951
288 Ga0207687_10067899
289 Ga0207689_10618669
290 Ga0207661_11977914
291 Ga0207658_10115694
292 Ga0207641_10369587
293 Ga0207648_10929710
294 Ga0268266_10171747
295 Ga0268266_10737164
296 Ga0268266_11523323
297 Ga0268265_11637237
298 Ga0268264_10652374
299 Ga0268264_11569423
300 Ga0268264_11961333
301 Ga0265319_1103725
302 Ga0265318_10083973
303 Ga0265318_10248874
304 Ga0265322_10032515
305 Ga0265338_10000955
306 Ga0265338_10176632
307 Ga0265320_10172352
308 Ga0265325_10008265
309 Ga0265325_10543762
310 Ga0265327_10006429
311 Ga0265327_10012492
312 Ga0265327_10112573
313 Ga0265316_10621763
314 Ga0265313_10373178
315 Ga0265314_10059791
316 Ga0265314_10282653
317 Ga0265314_10597389
318 Ga0316576_10907540
319 Ga0307405_11360111
320 Ga0307406_10840452
321 Ga0307409_100783835
322 Ga0307411_10250244
323 Ga0373955_0913564
324 Ga0316574_0011151
325 Ga0373933_0475821
326 Ga0373937_1041820
327 Ga0436364_0223666
328 Ga0436365_0117919
329 Ga0436365_0693920
330 Ga0436365_0774550
331 Ga0436365_1160848
332 Ga0436363_0297771
333 Ga0439465_0404242
334 Ga0451800_0168135
335 Ga0451802_1868703
336 Ga0451847_0978048
337 Ga0451851_1180801
338 Ga0451853_3558595
339 Ga0439434_0109394
340 Ga0439434_0236193
341 Ga0466963_0686344
342 Ga0466967_1526292
343 Ga0495592_0402555
344 Ga0495653_0139091
345 Ga0495653_0584610
346 Ga0495628_1039313
347 Ga0495630_1045121
348 Ga0495644_0456790
349 Ga0495640_0872160
350 Ga0495586_0297594
351 Ga0495587_0204959
352 Ga0495667_0139141
353 Ga0495667_0528085
354 Ga0495604_0467343
355 Ga0495674_0531634
356 Ga0495672_0000575
357 Ga0496101_0499850
358 Ga0496101_0837652
359 Ga0496103_0103702
360 Ga0496104_0049824
361 Ga0496104_0183898
362 Ga0496104_0348280
363 Ga0496104_1480561
364 Ga0496104_1744016
365 Ga0496105_0029504
366 Ga0496105_0102402
367 Ga0496105_0271037
368 Ga0496105_0613333
369 Ga0496108_0003659
370 Ga0496108_0190427
371 Ga0496108_0426786
372 Ga0496109_0137733
373 Ga0496109_0182671
374 Ga0496109_0382189
375 Ga0496109_0417725
376 Ga0496110_0015869
377 Ga0496112_0015298
378 Ga0496112_0017730
379 Ga0496113_0302921
380 Ga0496113_0401545
381 Ga0496113_0947368
382 Ga0496114_0842670
383 Ga0496114_1009046
384 Ga0496114_1204985
385 Ga0496115_0168394
386 Ga0496115_0779116
387 Ga0501032_0214807
388 Ga0501034_0001792
389 Ga0501036_0472153
390 Ga0501036_1071875
391 Ga0501037_0775515
392 Ga0501038_0336916
393 Ga0501039_0022329
394 Ga0501039_0263027
395 Ga0501040_0005244
396 Ga0501040_0018007
397 Ga0501041_0007281
398 Ga0501041_0250281
399 Ga0501041_0408737
400 Ga0501042_0305680
401 Ga0501046_0343627
402 Ga0501048_0070250
403 Ga0501048_0302618
404 Ga0501048_1033152
405 Ga0501067_0377676
406 Ga0501068_0000138
407 Ga0501068_0008894
408 Ga0501068_0374168
409 Ga0501068_0833488
410 Ga0501069_0041239
411 Ga0501069_0202843
412 Ga0501070_0097035
413 Ga0501070_0104232
414 Ga0501070_0524215
415 Ga0501070_0568445
416 Ga0501071_0031099
417 Ga0501071_0203466
418 Ga0501071_0248815
419 Ga0501072_0008102
420 Ga0501072_0012719
421 Ga0501072_0125420
422 Ga0501072_0382676
423 Ga0501073_0000572
424 Ga0501073_0167286
425 Ga0501073_0397683
426 Ga0501073_0445935
427 Ga0501073_0457358
428 Ga0501073_0484442
429 Ga0501073_0735682
430 Ga0501074_0012187
431 Ga0501074_0084703
432 Ga0501074_0111433
433 Ga0501074_0301402
434 Ga0501074_1254435
435 Ga0501075_0739831
436 Ga0501075_1372225
437 Ga0501076_0005751
438 Ga0501076_0271364
439 Ga0501076_1432938
440 Ga0501079_0264485
441 Ga0501079_0386003
442 Ga0501079_0611463
443 Ga0501080_0008959
444 Ga0501080_0108175
445 Ga0501080_0164555
446 Ga0501080_0194018
447 Ga0501081_0086675
448 Ga0501081_1148825
449 Ga0501083_0014316
450 Ga0501083_0125646
451 Ga0501083_0163600
452 Ga0501083_1101428
453 Ga0501035_0281377
454 Ga0501044_0656653
455 Ga0501045_0105941
456 Ga0501045_0584479
457 Ga0501045_0891099
458 Ga0501045_0898940
459 nmdc:mga03n38_341430_c1
460 nmdc:mga03n38_793710_c1
461 nmdc:mga00v17_483761_c1
462 nmdc:mga0yw44_263343_c1
463 nmdc:mga06z11_522518_c1
464 nmdc:mga07m45_286408_c1
465 nmdc:mga08y16_436216_c1
466 nmdc:mga0n895_16175_c1
467 nmdc:mga0n895_337191_c1
468 nmdc:mga0rr50_1117130_c1
469 Ga0495601_0084756
470 Ga0495619_0033507
471 Ga0500616_0038106
472 Ga0501084_0000026
473 Ga0501084_0056803
474 Ga0501084_0086395
475 Ga0501084_0487771
476 Ga0501084_0558925
477 Ga0501082_0219621
478 Ga0501082_0245522
479 Ga0501082_0501997
480 Ga0501082_0826750
481 Ga0501082_1337666
482 Ga0530510_0143823
483 Ga0530510_0898717
484 Ga0530510_1339080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.7217 4 93
3i24-assembly1.cif.gz_B crystal structure of a hit family hydrolase protein from vibrio fischeri. northeast structural genomics consortium target id vfr176 0.623 3 90
3r6f-assembly1.cif.gz_A-2 crystal structure of a zinc-containing hit family protein from encephalitozoon cuniculi 0.6074 4 110
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.6064 4 93
3r6f-assembly1.cif.gz_A-2 crystal structure of a zinc-containing hit family protein from encephalitozoon cuniculi 0.589 4 110
ID Description Score Start End Superfamily
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7383 6 93 3.30.428.10
af_Q84VV6_2_112_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.6708 3 89 3.30.428.10
af_Q23921_6_127_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.6317 7 93 3.30.428.10
3i24B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.623 3 90 3.30.428.10
2oikD00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.6178 1 110 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A6J6CI71-F1-model_v4 Unannotated protein 0.9338 15 100
AF-A0A7K1B3Y0-F1-model_v4 Uncharacterized protein 0.9282 6 90
AF-A0A6J6CZC8-F1-model_v4 Unannotated protein 0.927 6 90
AF-A0A6J6HWA5-F1-model_v4 Unannotated protein 0.9189 38 100
AF-A0A094PJP2-F1-model_v4 Uncharacterized protein 0.9159 38 104

Map