F354739

General Info

Members Datasets Scaffolds Average Seq Length
242 167 484 165

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_11003528|Ga0207646_110035282
Length 187
Sequence MTLEITEMSLADREQVLRIYLDGIATGQATFETEVPSWEEWDGGHLSFARLVAISDGRVKGWAALSPVSRRAVYRGVAEVSVYVDRDWRGQGVGRVLLEKLIQASEKNGIWTLQASIFPQNEASIALHKSCGFREVGVRERIARLHGVWRNTVLLERRSKAVGNSEDRGKNTALIQAKTGTRKPARS

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.74
Rhizosphere 89.26
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_11003528 3300025922 Bacteria 737
2 JGI24751J29686_10000027 3300002459 Bacteria 95343
3 Ga0065704_10646171 3300005289 Bacteria 585
4 Ga0070690_100147183 3300005330 Bacteria 1604
5 Ga0070690_100665321 3300005330 Unclassified 797
6 Ga0070670_100000084 3300005331 Bacteria 90455
7 Ga0070670_100529167 3300005331 Bacteria 1050
8 Ga0070682_100006949 3300005337 Bacteria 6364
9 Ga0070682_100837114 3300005337 Bacteria 751
10 Ga0070692_10015287 3300005345 Bacteria 3628
11 Ga0070692_10273438 3300005345 Bacteria 1021
12 Ga0070669_100405412 3300005353 Bacteria 1116
13 Ga0070669_100496521 3300005353 Unclassified 1012
14 Ga0070673_100097224 3300005364 Bacteria 2418
15 Ga0070673_100125249 3300005364 Bacteria 2149
16 Ga0070673_100388786 3300005364 Bacteria 1245
17 Ga0070703_10011589 3300005406 Bacteria 2492
18 Ga0070709_10231426 3300005434 Bacteria 1322
19 Ga0070714_100083201 3300005435 Bacteria 2790
20 Ga0070710_10040381 3300005437 Bacteria 2572
21 Ga0070710_10248556 3300005437 Bacteria 1142
22 Ga0070705_100219197 3300005440 Bacteria 1316
23 Ga0070694_100160829 3300005444 Bacteria 1647
24 Ga0070694_101177434 3300005444 Unclassified 642
25 Ga0070708_100022590 3300005445 Bacteria 5336
26 Ga0070678_100201377 3300005456 Bacteria 1643
27 Ga0070662_100103328 3300005457 Bacteria 2161
28 Ga0070706_100408553 3300005467 Unclassified 1264
29 Ga0070707_100306672 3300005468 Bacteria 1543
30 Ga0070707_100608340 3300005468 Bacteria 1055
31 Ga0070698_101050946 3300005471 Unclassified 762
32 Ga0070699_100791479 3300005518 Bacteria 868
33 Ga0070679_101417901 3300005530 Bacteria 641
34 Ga0070684_101024857 3300005535 Bacteria 775
35 Ga0070697_100047910 3300005536 Bacteria 3465
36 Ga0070697_100460259 3300005536 Bacteria 1109
37 Ga0070697_100477555 3300005536 Unclassified 1088
38 Ga0070697_100729509 3300005536 Unclassified 875
39 Ga0070672_100381965 3300005543 Bacteria 1205
40 Ga0070695_100050862 3300005545 Bacteria 2657
41 Ga0070695_100212089 3300005545 Bacteria 1391
42 Ga0070695_100282754 3300005545 Bacteria 1220
43 Ga0070695_100617516 3300005545 Unclassified 853
44 Ga0070696_100008256 3300005546 Bacteria 6968
45 Ga0070696_100130553 3300005546 Bacteria 1828
46 Ga0070696_100164065 3300005546 Unclassified 1639
47 Ga0070693_100238563 3300005547 Bacteria 1199
48 Ga0070665_101929426 3300005548 Unclassified 596
49 Ga0070704_100015259 3300005549 Bacteria 4822
50 Ga0070704_100601806 3300005549 Unclassified 966
51 Ga0070704_100764257 3300005549 Unclassified 861
52 Ga0068857_100203734 3300005577 Bacteria 1804
53 Ga0068857_101136496 3300005577 Bacteria 755
54 Ga0068856_100064398 3300005614 Bacteria 3622
55 Ga0068856_100491230 3300005614 Bacteria 1248
56 Ga0068856_100615910 3300005614 Bacteria 1106
57 Ga0070702_100329153 3300005615 Unclassified 1068
58 Ga0068852_100303701 3300005616 Bacteria 1545
59 Ga0068859_100124793 3300005617 Bacteria 2643
60 Ga0068864_100122030 3300005618 Bacteria 2331
61 Ga0068864_100147238 3300005618 Bacteria 2130
62 Ga0068864_101797177 3300005618 Bacteria 618
63 Ga0068870_10010922 3300005840 Bacteria 4191
64 Ga0068863_100756171 3300005841 Bacteria 968
65 Ga0068858_100456445 3300005842 Bacteria 1232
66 Ga0068860_100241367 3300005843 Bacteria 1758
67 Ga0081540_1233299 3300005983 Unclassified 648
68 Ga0081539_10000318 3300005985 Bacteria 107294
69 Ga0070717_10259061 3300006028 Bacteria 1538
70 Ga0070715_10001914 3300006163 Bacteria 6258
71 Ga0070712_100133543 3300006175 Bacteria 1884
72 Ga0070712_101297167 3300006175 Bacteria 634
73 Ga0097621_100029016 3300006237 Bacteria 4366
74 Ga0097621_100226401 3300006237 Bacteria 1631
75 Ga0097621_101060889 3300006237 Bacteria 759
76 Ga0075430_100119288 3300006846 Bacteria 2199
77 Ga0075433_10042632 3300006852 Bacteria 3938
78 Ga0075433_10295371 3300006852 Bacteria 1435
79 Ga0097620_100124789 3300006931 Bacteria 2643
80 Ga0075435_100006011 3300007076 Bacteria 8544
81 Ga0075435_100102314 3300007076 Bacteria 2374
82 Ga0075435_100132560 3300007076 Unclassified 2085
83 Ga0111539_12011551 3300009094 Bacteria 670
84 Ga0105245_11669361 3300009098 Bacteria 689
85 Ga0114129_10023401 3300009147 Bacteria 8759
86 Ga0114129_10509239 3300009147 Unclassified 1571
87 Ga0114129_11441814 3300009147 Unclassified 848
88 Ga0114129_11662413 3300009147 Unclassified 780
89 Ga0105243_11611317 3300009148 Unclassified 676
90 Ga0105241_10165075 3300009174 Bacteria 1824
91 Ga0105242_10094573 3300009176 Bacteria 2521
92 Ga0105242_11393828 3300009176 Unclassified 728
93 Ga0105248_11574029 3300009177 Unclassified 744
94 Ga0105237_10148097 3300009545 Bacteria 2343
95 Ga0105249_10040767 3300009553 Bacteria 4219
96 Ga0105249_10566275 3300009553 Bacteria 1188
97 Ga0105239_10298815 3300010375 Bacteria 1813
98 Ga0105239_10300164 3300010375 Bacteria 1809
99 Ga0105246_10050822 3300011119 Bacteria 2844
100 Ga0105246_11597562 3300011119 Bacteria 616
101 Ga0157343_1020227 3300012488 Bacteria 597
102 Ga0157373_10042379 3300013100 Bacteria 3253
103 Ga0157371_10427731 3300013102 Bacteria 971
104 Ga0157378_10104203 3300013297 Bacteria 2593
105 Ga0157378_11587654 3300013297 Unclassified 700
106 Ga0157375_10094420 3300013308 Bacteria 3060
107 Ga0157375_10926059 3300013308 Unclassified 1014
108 Ga0163163_10000087 3300014325 Bacteria 101689
109 Ga0163163_10148473 3300014325 Bacteria 2388
110 Ga0157379_10140295 3300014968 Bacteria 2179
111 Ga0157379_10966336 3300014968 Unclassified 811
112 Ga0182007_10327906 3300015262 Bacteria 569
113 Ga0207653_10001655 3300025885 Bacteria 7143
114 Ga0207692_10070002 3300025898 Bacteria 1845
115 Ga0207647_10007639 3300025904 Bacteria 7792
116 Ga0207685_10003589 3300025905 Bacteria 3796
117 Ga0207685_10033616 3300025905 Bacteria 1855
118 Ga0207685_10645859 3300025905 Unclassified 572
119 Ga0207684_10502381 3300025910 Bacteria 1039
120 Ga0207654_10040923 3300025911 Bacteria 2614
121 Ga0207654_10088720 3300025911 Bacteria 1880
122 Ga0207654_10104189 3300025911 Unclassified 1753
123 Ga0207695_10546582 3300025913 Unclassified 1040
124 Ga0207671_10025793 3300025914 Bacteria 4411
125 Ga0207693_10002384 3300025915 Bacteria 16305
126 Ga0207693_10182838 3300025915 Bacteria 1650
127 Ga0207693_10287868 3300025915 Bacteria 1287
128 Ga0207663_10032761 3300025916 Bacteria 3088
129 Ga0207663_10498899 3300025916 Bacteria 945
130 Ga0207662_10182470 3300025918 Bacteria 1351
131 Ga0207652_10147061 3300025921 Bacteria 2109
132 Ga0207646_10389088 3300025922 Bacteria 1260
133 Ga0207650_10000017 3300025925 Bacteria 354674
134 Ga0207687_10355314 3300025927 Unclassified 1195
135 Ga0207687_10360389 3300025927 Bacteria 1187
136 Ga0207664_10346455 3300025929 Bacteria 1314
137 Ga0207644_10317718 3300025931 Bacteria 1259
138 Ga0207706_10138156 3300025933 Bacteria 2144
139 Ga0207709_10309474 3300025935 Unclassified 1178
140 Ga0207665_10014834 3300025939 Bacteria 5122
141 Ga0207691_10372878 3300025940 Bacteria 1219
142 Ga0207711_10926569 3300025941 Unclassified 810
143 Ga0207689_10312873 3300025942 Bacteria 1302
144 Ga0207667_10307408 3300025949 Bacteria 1620
145 Ga0207651_10051700 3300025960 Bacteria 2797
146 Ga0207712_10057885 3300025961 Bacteria 2736
147 Ga0207678_10034710 3300026067 Bacteria 4393
148 Ga0207708_10389062 3300026075 Bacteria 1151
149 Ga0207702_10230249 3300026078 Bacteria 1731
150 Ga0207641_10613907 3300026088 Bacteria 1066
151 Ga0207676_10314356 3300026095 Bacteria 1435
152 Ga0207676_11091615 3300026095 Bacteria 789
153 Ga0207674_10168170 3300026116 Bacteria 2146
154 Ga0207674_10459526 3300026116 Bacteria 1230
155 Ga0207683_10001497 3300026121 Bacteria 21070
156 Ga0207683_10220595 3300026121 Bacteria 1728
157 Ga0268264_10026111 3300028381 Bacteria 4770
158 Ga0316575_10053238 3300031665 Unclassified 1612
159 Ga0316579_10164873 3300031691 Unclassified 1071
160 Ga0316576_10225172 3300031727 Bacteria 1410
161 Ga0307407_10075315 3300031903 Bacteria 2023
162 Ga0307409_100623652 3300031995 Bacteria 1069
163 Ga0307416_100420070 3300032002 Bacteria 1381
164 Ga0307415_100601029 3300032126 Unclassified 979
165 Ga0316585_10003043 3300032137 Bacteria 4579
166 Ga0316592_1014301 3300033524 Unclassified 1644
167 Ga0373948_0087542 3300034817 Bacteria 719
168 Ga0373950_0003843 3300034818 Bacteria 2178
169 Ga0373958_0075991 3300034819 Bacteria 753
170 Ga0373959_0006159 3300034820 Bacteria 1985
171 Ga0373928_0002776 3300035084 Bacteria 3377
172 Ga0373940_0008251 3300035088 Bacteria 2382
173 Ga0373940_0052018 3300035088 Bacteria 1153
174 Ga0373949_0004686 3300035090 Bacteria 3108
175 Ga0373932_0000805 3300035112 Bacteria 9305
176 Ga0373939_0009250 3300035114 Bacteria 2440
177 Ga0373941_0007352 3300035115 Bacteria 2692
178 Ga0373942_0003275 3300035207 Bacteria 3820
179 Ga0373962_0000216 3300035242 Bacteria 12145
180 Ga0316574_0789044 3300035398 Unclassified 579
181 Ga0316574_0803414 3300035398 Bacteria 572
182 Ga0373931_0012360 3300035691 Bacteria 4135
183 Ga0373931_0015546 3300035691 Bacteria 3735
184 Ga0316582_0980157 3300036647 Unclassified 577
185 Ga0316584_0262242 3300036712 Unclassified 1260
186 Ga0316584_0851346 3300036712 Unclassified 616
187 Ga0395899_0029271 3300037312 Bacteria 4142
188 Ga0395900_0074145 3300037418 Bacteria 3499
189 Ga0395900_0075564 3300037418 Bacteria 3463
190 Ga0395900_0177794 3300037418 Bacteria 2164
191 Ga0395898_0133134 3300037466 Bacteria 2380
192 Ga0395898_0726798 3300037466 Bacteria 934
193 Ga0395905_0091651 3300037471 Bacteria 2849
194 Ga0316581_0019063 3300037588 Unclassified 1998
195 Ga0395901_0479056 3300038443 Bacteria 1269
196 Ga0395901_0615899 3300038443 Unclassified 1093
197 Ga0451577_1012207 3300042876 Unclassified 746
198 Ga0466964_0010428 3300044706 Bacteria 3505
199 Ga0466968_0027957 3300044735 Bacteria 2323
200 Ga0466960_0097232 3300044901 Bacteria 1510
201 Ga0451576_0103431 3300045051 Bacteria 2963
202 Ga0466967_0002514 3300045976 Bacteria 11463
203 Ga0495580_0000238 3300046472 Bacteria 43561
204 Ga0495630_0384061 3300046517 Bacteria 1076
205 Ga0495658_0081590 3300046683 Bacteria 1899
206 Ga0495613_0293340 3300046689 Bacteria 1127
207 Ga0495581_0182573 3300047315 Bacteria 1227
208 Ga0495675_0092455 3300047444 Bacteria 1898
209 Ga0496100_0298330 3300048903 Bacteria 1205
210 Ga0496100_1266882 3300048903 Unclassified 582
211 Ga0496101_0120690 3300048904 Bacteria 1981
212 Ga0496102_0258938 3300048905 Unclassified 1640
213 Ga0496102_0458504 3300048905 Bacteria 1195
214 Ga0496103_0151800 3300048906 Bacteria 1484
215 Ga0496104_0051679 3300048907 Bacteria 3879
216 Ga0496104_0091640 3300048907 Bacteria 2906
217 Ga0496105_0019999 3300048908 Bacteria 5403
218 Ga0496106_0021934 3300048909 Bacteria 4745
219 Ga0496106_0118773 3300048909 Bacteria 2065
220 Ga0496107_0095793 3300048910 Bacteria 2171
221 Ga0496108_0029524 3300048911 Bacteria 4541
222 Ga0496108_0304803 3300048911 Bacteria 1388
223 Ga0496108_0612387 3300048911 Bacteria 948
224 Ga0496109_0121414 3300048912 Bacteria 2434
225 Ga0496109_0962897 3300048912 Bacteria 791
226 Ga0496111_0172564 3300048914 Bacteria 1607
227 Ga0496111_0209633 3300048914 Bacteria 1447
228 Ga0496112_0198493 3300048915 Bacteria 1966
229 Ga0496112_0730526 3300048915 Bacteria 917
230 Ga0496113_0022969 3300048916 Bacteria 4419
231 Ga0496114_0115385 3300048917 Bacteria 2304
232 Ga0496114_0648606 3300048917 Bacteria 929
233 Ga0496114_1706106 3300048917 Bacteria 518
234 Ga0496115_0004267 3300048918 Bacteria 10342
235 Ga0501034_0047067 3300049571 Bacteria 4357
236 Ga0501047_0079268 3300049581 Bacteria 3158
237 Ga0501067_0177503 3300049583 Unclassified 1186
238 nmdc:mga0rr50_159535_c1 3300050513 Bacteria 1830
239 nmdc:mga0rr50_541676_c1 3300050513 Unclassified 991
240 nmdc:mga08x19_218670_c1 3300050514 Bacteria 1309
241 nmdc:mga0a205_131921_c1 3300050515 Unclassified 2399
242 nmdc:mga0a205_49799_c1 3300050515 Bacteria 4045
243 Ga0207646_11003528
244 JGI24751J29686_10000027
245 Ga0065704_10646171
246 Ga0070690_100147183
247 Ga0070690_100665321
248 Ga0070670_100000084
249 Ga0070670_100529167
250 Ga0070682_100006949
251 Ga0070682_100837114
252 Ga0070692_10015287
253 Ga0070692_10273438
254 Ga0070669_100405412
255 Ga0070669_100496521
256 Ga0070673_100097224
257 Ga0070673_100125249
258 Ga0070673_100388786
259 Ga0070703_10011589
260 Ga0070709_10231426
261 Ga0070714_100083201
262 Ga0070710_10040381
263 Ga0070710_10248556
264 Ga0070705_100219197
265 Ga0070694_100160829
266 Ga0070694_101177434
267 Ga0070708_100022590
268 Ga0070678_100201377
269 Ga0070662_100103328
270 Ga0070706_100408553
271 Ga0070707_100306672
272 Ga0070707_100608340
273 Ga0070698_101050946
274 Ga0070699_100791479
275 Ga0070679_101417901
276 Ga0070684_101024857
277 Ga0070697_100047910
278 Ga0070697_100460259
279 Ga0070697_100477555
280 Ga0070697_100729509
281 Ga0070672_100381965
282 Ga0070695_100050862
283 Ga0070695_100212089
284 Ga0070695_100282754
285 Ga0070695_100617516
286 Ga0070696_100008256
287 Ga0070696_100130553
288 Ga0070696_100164065
289 Ga0070693_100238563
290 Ga0070665_101929426
291 Ga0070704_100015259
292 Ga0070704_100601806
293 Ga0070704_100764257
294 Ga0068857_100203734
295 Ga0068857_101136496
296 Ga0068856_100064398
297 Ga0068856_100491230
298 Ga0068856_100615910
299 Ga0070702_100329153
300 Ga0068852_100303701
301 Ga0068859_100124793
302 Ga0068864_100122030
303 Ga0068864_100147238
304 Ga0068864_101797177
305 Ga0068870_10010922
306 Ga0068863_100756171
307 Ga0068858_100456445
308 Ga0068860_100241367
309 Ga0081540_1233299
310 Ga0081539_10000318
311 Ga0070717_10259061
312 Ga0070715_10001914
313 Ga0070712_100133543
314 Ga0070712_101297167
315 Ga0097621_100029016
316 Ga0097621_100226401
317 Ga0097621_101060889
318 Ga0075430_100119288
319 Ga0075433_10042632
320 Ga0075433_10295371
321 Ga0097620_100124789
322 Ga0075435_100006011
323 Ga0075435_100102314
324 Ga0075435_100132560
325 Ga0111539_12011551
326 Ga0105245_11669361
327 Ga0114129_10023401
328 Ga0114129_10509239
329 Ga0114129_11441814
330 Ga0114129_11662413
331 Ga0105243_11611317
332 Ga0105241_10165075
333 Ga0105242_10094573
334 Ga0105242_11393828
335 Ga0105248_11574029
336 Ga0105237_10148097
337 Ga0105249_10040767
338 Ga0105249_10566275
339 Ga0105239_10298815
340 Ga0105239_10300164
341 Ga0105246_10050822
342 Ga0105246_11597562
343 Ga0157343_1020227
344 Ga0157373_10042379
345 Ga0157371_10427731
346 Ga0157378_10104203
347 Ga0157378_11587654
348 Ga0157375_10094420
349 Ga0157375_10926059
350 Ga0163163_10000087
351 Ga0163163_10148473
352 Ga0157379_10140295
353 Ga0157379_10966336
354 Ga0182007_10327906
355 Ga0207653_10001655
356 Ga0207692_10070002
357 Ga0207647_10007639
358 Ga0207685_10003589
359 Ga0207685_10033616
360 Ga0207685_10645859
361 Ga0207684_10502381
362 Ga0207654_10040923
363 Ga0207654_10088720
364 Ga0207654_10104189
365 Ga0207695_10546582
366 Ga0207671_10025793
367 Ga0207693_10002384
368 Ga0207693_10182838
369 Ga0207693_10287868
370 Ga0207663_10032761
371 Ga0207663_10498899
372 Ga0207662_10182470
373 Ga0207652_10147061
374 Ga0207646_10389088
375 Ga0207650_10000017
376 Ga0207687_10355314
377 Ga0207687_10360389
378 Ga0207664_10346455
379 Ga0207644_10317718
380 Ga0207706_10138156
381 Ga0207709_10309474
382 Ga0207665_10014834
383 Ga0207691_10372878
384 Ga0207711_10926569
385 Ga0207689_10312873
386 Ga0207667_10307408
387 Ga0207651_10051700
388 Ga0207712_10057885
389 Ga0207678_10034710
390 Ga0207708_10389062
391 Ga0207702_10230249
392 Ga0207641_10613907
393 Ga0207676_10314356
394 Ga0207676_11091615
395 Ga0207674_10168170
396 Ga0207674_10459526
397 Ga0207683_10001497
398 Ga0207683_10220595
399 Ga0268264_10026111
400 Ga0316575_10053238
401 Ga0316579_10164873
402 Ga0316576_10225172
403 Ga0307407_10075315
404 Ga0307409_100623652
405 Ga0307416_100420070
406 Ga0307415_100601029
407 Ga0316585_10003043
408 Ga0316592_1014301
409 Ga0373948_0087542
410 Ga0373950_0003843
411 Ga0373958_0075991
412 Ga0373959_0006159
413 Ga0373928_0002776
414 Ga0373940_0008251
415 Ga0373940_0052018
416 Ga0373949_0004686
417 Ga0373932_0000805
418 Ga0373939_0009250
419 Ga0373941_0007352
420 Ga0373942_0003275
421 Ga0373962_0000216
422 Ga0316574_0789044
423 Ga0316574_0803414
424 Ga0373931_0012360
425 Ga0373931_0015546
426 Ga0316582_0980157
427 Ga0316584_0262242
428 Ga0316584_0851346
429 Ga0395899_0029271
430 Ga0395900_0074145
431 Ga0395900_0075564
432 Ga0395900_0177794
433 Ga0395898_0133134
434 Ga0395898_0726798
435 Ga0395905_0091651
436 Ga0316581_0019063
437 Ga0395901_0479056
438 Ga0395901_0615899
439 Ga0451577_1012207
440 Ga0466964_0010428
441 Ga0466968_0027957
442 Ga0466960_0097232
443 Ga0451576_0103431
444 Ga0466967_0002514
445 Ga0495580_0000238
446 Ga0495630_0384061
447 Ga0495658_0081590
448 Ga0495613_0293340
449 Ga0495581_0182573
450 Ga0495675_0092455
451 Ga0496100_0298330
452 Ga0496100_1266882
453 Ga0496101_0120690
454 Ga0496102_0258938
455 Ga0496102_0458504
456 Ga0496103_0151800
457 Ga0496104_0051679
458 Ga0496104_0091640
459 Ga0496105_0019999
460 Ga0496106_0021934
461 Ga0496106_0118773
462 Ga0496107_0095793
463 Ga0496108_0029524
464 Ga0496108_0304803
465 Ga0496108_0612387
466 Ga0496109_0121414
467 Ga0496109_0962897
468 Ga0496111_0172564
469 Ga0496111_0209633
470 Ga0496112_0198493
471 Ga0496112_0730526
472 Ga0496113_0022969
473 Ga0496114_0115385
474 Ga0496114_0648606
475 Ga0496114_1706106
476 Ga0496115_0004267
477 Ga0501034_0047067
478 Ga0501047_0079268
479 Ga0501067_0177503
480 nmdc:mga0rr50_159535_c1
481 nmdc:mga0rr50_541676_c1
482 nmdc:mga08x19_218670_c1
483 nmdc:mga0a205_131921_c1
484 nmdc:mga0a205_49799_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

75

142

0.92

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

5

154

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

39

146

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

14

133

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

47

135

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

3

134

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jtf-assembly1.cif.gz_B crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440 0.9203 3 161
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9165 5 159
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.9141 3 159
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9127 112 160
3dr8-assembly1.cif.gz_A structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa 0.9121 3 161
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9503 112 160 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9318 93 159 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.911 96 161 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9104 51 138 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9046 3 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Y7ZP30-F1-model_v4 N-acetyltransferase family protein 0.9768 5 161 GO:0016747
AF-M7XA83-F1-model_v4 GCN5-related N-acetyltransferase 0.9755 3 161 GO:0016747
AF-A0A2S5XC14-F1-model_v4 deleted 0.9746 9 161
AF-A0A518H6T0-F1-model_v4 Phosphinothricin acetyltransferase YwnH (EC 2.3.1.183) 0.9736 3 160 GO:0102971
AF-A0A1L7I3X2-F1-model_v4 Phosphinothricin N-acetyltransferase 0.9717 5 161 GO:0016747

Map