F354320

General Info

Members Datasets Scaffolds Average Seq Length
242 146 242 236

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10004914|Ga0070658_1000491411
Length 247
Sequence MSGHSKWSTIKRQKGAKDAVRGAVFTKLGNTIAVAARGGTDPDMNFALRLAIDKAKAANMPMANIQRAIDRVKDKNAAQIQEVLYEGYGPGGTAILVEAATDNINRTYPEVRLAFSKHGGRLAEKGAVAFQFDRKGIIRVQGSADELLLQAIEAGAEDVQDESEPGKEESVVYTAPADLARVRDALNAAGIKVLEAELTYVPNSTVVVTDKETAGKVMRLMEALDDLDDVANTHVNFDIPEEIIAAP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
47 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
132 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
140 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0
Rhizoplane 1.65
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000010 3300001990 Bacteria 55828
2 JGI24735J21928_10000052 3300002067 Bacteria 50482
3 rootH2_10000311 3300003320 Bacteria 277677
4 rootL2_10152214 3300003322 Bacteria 4025
5 rootH1_10068823 3300003323 Bacteria 6994
6 Ga0070658_10000051 3300005327 Bacteria 118657
7 Ga0070658_10000061 3300005327 Bacteria 108607
8 Ga0070658_10000523 3300005327 Bacteria 33292
9 Ga0070658_10004914 3300005327 Bacteria 10893
10 Ga0070658_10016599 3300005327 Bacteria 5892
11 Ga0070658_10118858 3300005327 Bacteria 2195
12 Ga0070666_10080030 3300005335 Bacteria 2232
13 Ga0070680_100138432 3300005336 Bacteria 2040
14 Ga0070660_100000549 3300005339 Bacteria 25128
15 Ga0070660_100012299 3300005339 Bacteria 6108
16 Ga0070660_100259621 3300005339 Bacteria 1418
17 Ga0070691_10023988 3300005341 Unclassified 2834
18 Ga0070668_100058589 3300005347 Unclassified 2980
19 Ga0070671_100013642 3300005355 Bacteria 6554
20 Ga0070671_100141491 3300005355 Bacteria 2030
21 Ga0070674_100006663 3300005356 Bacteria 6754
22 Ga0070674_100142866 3300005356 Bacteria 1798
23 Ga0070659_100000739 3300005366 Bacteria 23764
24 Ga0070667_100014428 3300005367 Bacteria 6528
25 Ga0070663_100290720 3300005455 Unclassified 1305
26 Ga0070678_100000080 3300005456 Bacteria 35906
27 Ga0068867_100017354 3300005459 Bacteria 5113
28 Ga0070685_10000910 3300005466 Bacteria 15899
29 Ga0070685_10025959 3300005466 Unclassified 3227
30 Ga0070679_100007966 3300005530 Bacteria 9943
31 Ga0070679_100025439 3300005530 Bacteria 5809
32 Ga0070679_100063906 3300005530 Unclassified 3668
33 Ga0070679_100085980 3300005530 Bacteria 3132
34 Ga0070679_100223114 3300005530 Bacteria 1845
35 Ga0070684_100035322 3300005535 Bacteria 4278
36 Ga0070684_100166282 3300005535 Bacteria 2002
37 Ga0068853_100408201 3300005539 Unclassified 1272
38 Ga0068853_100557982 3300005539 Unclassified 1085
39 Ga0070672_100007879 3300005543 Bacteria 7270
40 Ga0070665_100074249 3300005548 Unclassified 3406
41 Ga0070665_100288886 3300005548 Bacteria 1642
42 Ga0068855_100000001 3300005563 Bacteria 818777
43 Ga0068855_100000827 3300005563 Bacteria 38293
44 Ga0068855_100013488 3300005563 Bacteria 9853
45 Ga0068855_100449582 3300005563 Bacteria 1406
46 Ga0068855_100587865 3300005563 Bacteria 1202
47 Ga0068857_100000001 3300005577 Bacteria 254081
48 Ga0068857_100615538 3300005577 Bacteria 1027
49 Ga0068856_100002145 3300005614 Bacteria 20448
50 Ga0068856_100034883 3300005614 Bacteria 4929
51 Ga0068863_100014438 3300005841 Bacteria 7608
52 Ga0068863_100578185 3300005841 Bacteria 1111
53 Ga0068858_100036881 3300005842 Bacteria 4532
54 Ga0068860_100063620 3300005843 Bacteria 3503
55 Ga0075365_10013224 3300006038 Bacteria 4925
56 Ga0075364_10007994 3300006051 Bacteria 6302
57 Ga0075369_10000418 3300006186 Bacteria 12858
58 Ga0075366_10000002 3300006195 Bacteria 153795
59 Ga0075370_10131354 3300006353 Bacteria 1461
60 Ga0068871_100000003 3300006358 Bacteria 141580
61 Ga0068865_100104735 3300006881 Bacteria 2077
62 Ga0105240_10000003 3300009093 Bacteria 1183681
63 Ga0105245_10000001 3300009098 Bacteria 939270
64 Ga0105245_10000007 3300009098 Bacteria 312285
65 Ga0105245_10000567 3300009098 Bacteria 33649
66 Ga0105245_10002901 3300009098 Bacteria 15385
67 Ga0105243_10000001 3300009148 Bacteria 1156578
68 Ga0105241_10000003 3300009174 Bacteria 839043
69 Ga0105241_10000737 3300009174 Bacteria 24848
70 Ga0105241_10205926 3300009174 Bacteria 1646
71 Ga0105241_10281352 3300009174 Bacteria 1421
72 Ga0105242_10000001 3300009176 Bacteria 574039
73 Ga0105242_10129992 3300009176 Bacteria 2172
74 Ga0105248_10467814 3300009177 Bacteria 1421
75 Ga0105248_10478183 3300009177 Unclassified 1404
76 Ga0105237_10054340 3300009545 Bacteria 4012
77 Ga0105238_10050674 3300009551 Bacteria 4179
78 Ga0105238_10069705 3300009551 Bacteria 3516
79 Ga0105238_10217560 3300009551 Unclassified 1886
80 Ga0105033_100276 3300009986 Bacteria 4058
81 Ga0105028_101430 3300009993 Unclassified 2520
82 Ga0105239_10021307 3300010375 Bacteria 7146
83 Ga0105239_10023292 3300010375 Bacteria 6821
84 Ga0105239_10026751 3300010375 Bacteria 6349
85 Ga0105239_10443650 3300010375 Bacteria 1472
86 Ga0157369_10000054 3300013105 Bacteria 162631
87 Ga0157374_10000014 3300013296 Bacteria 396846
88 Ga0157374_10000133 3300013296 Bacteria 68141
89 Ga0157374_10012811 3300013296 Bacteria 7303
90 Ga0157374_10022524 3300013296 Bacteria 5621
91 Ga0157374_10137088 3300013296 Bacteria 2373
92 Ga0157374_10171167 3300013296 Bacteria 2118
93 Ga0157374_10329746 3300013296 Bacteria 1514
94 Ga0163162_10146784 3300013306 Bacteria 2475
95 Ga0157372_10001882 3300013307 Bacteria 22747
96 Ga0157372_10051462 3300013307 Bacteria 4584
97 Ga0157372_10402909 3300013307 Bacteria 1594
98 Ga0163163_10007822 3300014325 Bacteria 9452
99 Ga0163163_10011166 3300014325 Bacteria 8133
100 Ga0163163_10261444 3300014325 Bacteria 1782
101 Ga0157377_10008404 3300014745 Bacteria 5033
102 Ga0157379_10019501 3300014968 Bacteria 5991
103 Ga0157376_10000001 3300014969 Bacteria 842910
104 Ga0157376_10661977 3300014969 Unclassified 1046
105 Ga0207680_10323517 3300025903 Unclassified 1079
106 Ga0207647_10007861 3300025904 Bacteria 7671
107 Ga0207645_10122650 3300025907 Bacteria 1688
108 Ga0207705_10000019 3300025909 Bacteria 317770
109 Ga0207705_10002466 3300025909 Bacteria 14264
110 Ga0207705_10003290 3300025909 Bacteria 12306
111 Ga0207705_10011556 3300025909 Bacteria 6383
112 Ga0207705_10019354 3300025909 Bacteria 4868
113 Ga0207705_10090773 3300025909 Bacteria 2237
114 Ga0207705_10185619 3300025909 Bacteria 1571
115 Ga0207654_10000002 3300025911 Bacteria 1460142
116 Ga0207654_10000474 3300025911 Bacteria 22982
117 Ga0207707_10137534 3300025912 Unclassified 2136
118 Ga0207695_10000005 3300025913 Bacteria 1196715
119 Ga0207671_10041475 3300025914 Bacteria 3407
120 Ga0207660_10005832 3300025917 Bacteria 7992
121 Ga0207657_10000588 3300025919 Bacteria 38480
122 Ga0207657_10013925 3300025919 Bacteria 7867
123 Ga0207657_10240394 3300025919 Bacteria 1446
124 Ga0207652_10010584 3300025921 Bacteria 7424
125 Ga0207652_10038535 3300025921 Unclassified 4053
126 Ga0207652_10116694 3300025921 Bacteria 2371
127 Ga0207652_10188099 3300025921 Unclassified 1857
128 Ga0207652_10746728 3300025921 Unclassified 871
129 Ga0207694_10223339 3300025924 Bacteria 1537
130 Ga0207694_10458450 3300025924 Bacteria 1065
131 Ga0207687_10000001 3300025927 Bacteria 1130810
132 Ga0207687_10000004 3300025927 Bacteria 841177
133 Ga0207687_10000008 3300025927 Bacteria 497738
134 Ga0207687_10004743 3300025927 Bacteria 9050
135 Ga0207687_10005954 3300025927 Bacteria 8066
136 Ga0207687_10246124 3300025927 Bacteria 1419
137 Ga0207644_10018269 3300025931 Unclassified 4742
138 Ga0207644_10041208 3300025931 Bacteria 3265
139 Ga0207690_10002786 3300025932 Bacteria 10544
140 Ga0207690_10651656 3300025932 Unclassified 863
141 Ga0207686_10000001 3300025934 Bacteria 1169580
142 Ga0207686_10082898 3300025934 Bacteria 2097
143 Ga0207709_10000002 3300025935 Bacteria 1171536
144 Ga0207669_10047888 3300025937 Bacteria 2535
145 Ga0207669_10116165 3300025937 Bacteria 1805
146 Ga0207704_10090757 3300025938 Bacteria 2006
147 Ga0207691_10012192 3300025940 Bacteria 8241
148 Ga0207711_10288612 3300025941 Bacteria 1512
149 Ga0207661_10097340 3300025944 Bacteria 2464
150 Ga0207667_10000003 3300025949 Bacteria 822935
151 Ga0207667_10008921 3300025949 Bacteria 11862
152 Ga0207667_10071859 3300025949 Bacteria 3597
153 Ga0207667_10575342 3300025949 Bacteria 1138
154 Ga0207658_10083922 3300025986 Unclassified 2450
155 Ga0207678_10290096 3300026067 Unclassified 1405
156 Ga0207702_10012769 3300026078 Bacteria 6989
157 Ga0207641_10086609 3300026088 Unclassified 2732
158 Ga0207641_10118516 3300026088 Unclassified 2358
159 Ga0207648_10039786 3300026089 Bacteria 4133
160 Ga0207674_10000015 3300026116 Bacteria 183445
161 Ga0207674_10325571 3300026116 Bacteria 1486
162 Ga0207674_10825666 3300026116 Bacteria 894
163 Ga0207683_10017234 3300026121 Bacteria 6152
164 Ga0268266_10000662 3300028379 Bacteria 46629
165 Ga0268264_10086710 3300028381 Bacteria 2690
166 Ga0265319_1012933 3300028563 Bacteria 3348
167 Ga0265334_10000013 3300028573 Bacteria 155968
168 Ga0265338_10000060 3300028800 Bacteria 197991
169 Ga0265338_10001602 3300028800 Bacteria 36326
170 Ga0265338_10078382 3300028800 Bacteria 2787
171 Ga0265340_10000025 3300031247 Bacteria 71465
172 Ga0265331_10121774 3300031250 Unclassified 1192
173 Ga0265327_10000025 3300031251 Bacteria 380054
174 Ga0265327_10001503 3300031251 Bacteria 28901
175 Ga0316596_1008898 3300033541 Unclassified 2401
176 Ga0395899_0114370 3300037312 Bacteria 1938
177 Ga0395899_0116447 3300037312 Unclassified 1917
178 Ga0395900_0022143 3300037418 Bacteria 6501
179 Ga0395900_0028538 3300037418 Bacteria 5718
180 Ga0395900_0081042 3300037418 Bacteria 3335
181 Ga0395900_0296113 3300037418 Unclassified 1605
182 Ga0395898_0008576 3300037466 Bacteria 10786
183 Ga0395898_0010996 3300037466 Bacteria 9431
184 Ga0395905_0101340 3300037471 Unclassified 2703
185 Ga0395905_0141562 3300037471 Bacteria 2262
186 Ga0395901_0000862 3300038443 Bacteria 33400
187 Ga0395901_0004711 3300038443 Bacteria 13767
188 Ga0395901_0007616 3300038443 Bacteria 10931
189 Ga0395901_0026410 3300038443 Bacteria 5962
190 Ga0395901_0198811 3300038443 Bacteria 2101
191 Ga0495629_0037108 3300046459 Bacteria 3435
192 Ga0495583_0015524 3300046506 Bacteria 4138
193 Ga0495622_0000008 3300046557 Bacteria 232461
194 Ga0495658_0007404 3300046683 Bacteria 5431
195 Ga0495600_0076581 3300046809 Bacteria 2184
196 Ga0496100_0094652 3300048903 Unclassified 2046
197 Ga0496100_0336689 3300048903 Bacteria 1137
198 Ga0496112_0007611 3300048915 Bacteria 9627
199 Ga0496113_0425925 3300048916 Bacteria 1066
200 Ga0501031_0006382 3300049568 Bacteria 7691
201 Ga0501032_0000641 3300049569 Bacteria 28409
202 Ga0501034_0001383 3300049571 Bacteria 32637
203 Ga0501034_0210692 3300049571 Bacteria 1899
204 Ga0501036_0010300 3300049572 Bacteria 7713
205 Ga0501037_0000138 3300049573 Bacteria 68040
206 Ga0501038_0000863 3300049574 Bacteria 26878
207 Ga0501042_0051974 3300049578 Bacteria 2923
208 Ga0501043_0000062 3300049579 Bacteria 95664
209 Ga0501046_0000059 3300049580 Bacteria 126801
210 Ga0501047_0000032 3300049581 Bacteria 208294
211 Ga0501048_0000001 3300049582 Bacteria 132132
212 Ga0501070_0005663 3300049586 Bacteria 10650
213 Ga0501070_0014237 3300049586 Bacteria 6694
214 Ga0501070_0125088 3300049586 Bacteria 2125
215 Ga0501073_0005462 3300049589 Bacteria 9522
216 Ga0501234_009455 3300049707 Bacteria 1521
217 Ga0501080_0379804 3300049742 Bacteria 1273
218 Ga0501083_0074778 3300049744 Bacteria 2250
219 Ga0501035_0000872 3300049822 Bacteria 32043
220 Ga0501044_0054910 3300049823 Bacteria 4092
221 nmdc:mga00v17_6605_c1 3300050491 Bacteria 6157
222 nmdc:mga00v17_69085_c1 3300050491 Bacteria 2185
223 nmdc:mga0yw44_296_c1 3300050492 Bacteria 17171
224 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
225 nmdc:mga07m45_111256_c1 3300050496 Bacteria 1577
226 nmdc:mga0sz30_3_c3 3300050516 Bacteria 21264
227 Ga0500610_0000081 3300053079 Bacteria 29103
228 Ga0500643_000034 3300053087 Bacteria 185705
229 Ga0500644_0000213 3300053088 Bacteria 34906
230 Ga0500651_0000011 3300053093 Bacteria 246573
231 Ga0500651_0030291 3300053093 Unclassified 3404
232 Ga0500566_0000001 3300053094 Bacteria 1101031
233 Ga0500555_000002 3300053103 Bacteria 1314346
234 Ga0500562_000002 3300053108 Bacteria 977234
235 Ga0500614_000286 3300053123 Bacteria 13107
236 Ga0500628_005755 3300053129 Bacteria 2080
237 Ga0500652_000009 3300053131 Bacteria 163737
238 Ga0500559_0040500 3300053136 Bacteria 2029
239 Ga0500561_0000002 3300053137 Bacteria 394147
240 Ga0500616_0000005 3300053153 Bacteria 961725
241 Ga0500570_001462 3300053724 Bacteria 10932
242 Ga0501082_0016798 3300060353 Bacteria 6304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0014237 Ga0501070_0014237_238_897 207
2 3300014325 Ga0163163_10011166 Ga0163163_100111663 224
3 3300005563 Ga0068855_100449582 Ga0068855_1004495822 226
4 3300014325 Ga0163163_10007822 Ga0163163_1000782212 226
5 3300025949 Ga0207667_10575342 Ga0207667_105753422 226
6 3300031251 Ga0265327_10000025 Ga0265327_10000025229 226
7 3300049707 Ga0501234_009455 Ga0501234_009455_639_1361 226
8 3300053153 Ga0500616_0000005 Ga0500616_0000005_87540_88250 226
9 3300005356 Ga0070674_100006663 Ga0070674_1000066633 227
10 3300005466 Ga0070685_10025959 Ga0070685_100259594 227
11 3300005535 Ga0070684_100035322 Ga0070684_1000353223 227
12 3300005548 Ga0070665_100074249 Ga0070665_1000742491 227
13 3300009098 Ga0105245_10002901 Ga0105245_100029018 227
14 3300014969 Ga0157376_10000001 Ga0157376_10000001609 227
15 3300014969 Ga0157376_10661977 Ga0157376_106619771 227
16 3300025927 Ga0207687_10005954 Ga0207687_100059545 227
17 3300025937 Ga0207669_10047888 Ga0207669_100478884 227
18 3300028379 Ga0268266_10000662 Ga0268266_1000066248 227
19 3300005327 Ga0070658_10000061 Ga0070658_10000061131 228
20 3300005327 Ga0070658_10000523 Ga0070658_1000052312 228
21 3300005336 Ga0070680_100138432 Ga0070680_1001384321 228
22 3300005339 Ga0070660_100000549 Ga0070660_10000054923 228
23 3300005339 Ga0070660_100259621 Ga0070660_1002596212 228
24 3300005356 Ga0070674_100142866 Ga0070674_1001428662 228
25 3300005455 Ga0070663_100290720 Ga0070663_1002907202 228
26 3300005456 Ga0070678_100000080 Ga0070678_10000008015 228
27 3300005459 Ga0068867_100017354 Ga0068867_1000173545 228
28 3300005466 Ga0070685_10000910 Ga0070685_100009104 228
29 3300005530 Ga0070679_100223114 Ga0070679_1002231141 228
30 3300005539 Ga0068853_100408201 Ga0068853_1004082012 228
31 3300005543 Ga0070672_100007879 Ga0070672_10000787911 228
32 3300005548 Ga0070665_100288886 Ga0070665_1002888862 228
33 3300006881 Ga0068865_100104735 Ga0068865_1001047353 228
34 3300009093 Ga0105240_10000003 Ga0105240_10000003297 228
35 3300009098 Ga0105245_10000567 Ga0105245_1000056730 228
36 3300009148 Ga0105243_10000001 Ga0105243_10000001953 228
37 3300009174 Ga0105241_10205926 Ga0105241_102059262 228
38 3300009176 Ga0105242_10000001 Ga0105242_10000001305 228
39 3300009176 Ga0105242_10129992 Ga0105242_101299922 228
40 3300009177 Ga0105248_10467814 Ga0105248_104678142 228
41 3300009545 Ga0105237_10054340 Ga0105237_100543404 228
42 3300010375 Ga0105239_10021307 Ga0105239_100213076 228
43 3300010375 Ga0105239_10023292 Ga0105239_100232928 228
44 3300010375 Ga0105239_10026751 Ga0105239_100267516 228
45 3300013296 Ga0157374_10000133 Ga0157374_1000013313 228
46 3300013296 Ga0157374_10012811 Ga0157374_100128117 228
47 3300013296 Ga0157374_10137088 Ga0157374_101370883 228
48 3300013306 Ga0163162_10146784 Ga0163162_101467843 228
49 3300013307 Ga0157372_10051462 Ga0157372_100514623 228
50 3300014745 Ga0157377_10008404 Ga0157377_100084045 228
51 3300025907 Ga0207645_10122650 Ga0207645_101226503 228
52 3300025909 Ga0207705_10003290 Ga0207705_100032908 228
53 3300025909 Ga0207705_10019354 Ga0207705_100193543 228
54 3300025909 Ga0207705_10185619 Ga0207705_101856192 228
55 3300025913 Ga0207695_10000005 Ga0207695_10000005304 228
56 3300025914 Ga0207671_10041475 Ga0207671_100414753 228
57 3300025917 Ga0207660_10005832 Ga0207660_100058322 228
58 3300025919 Ga0207657_10240394 Ga0207657_102403942 228
59 3300025921 Ga0207652_10116694 Ga0207652_101166945 228
60 3300025927 Ga0207687_10004743 Ga0207687_100047435 228
61 3300025932 Ga0207690_10651656 Ga0207690_106516561 228
62 3300025934 Ga0207686_10000001 Ga0207686_10000001187 228
63 3300025934 Ga0207686_10082898 Ga0207686_100828982 228
64 3300025935 Ga0207709_10000002 Ga0207709_10000002304 228
65 3300025937 Ga0207669_10116165 Ga0207669_101161653 228
66 3300025938 Ga0207704_10090757 Ga0207704_100907573 228
67 3300025940 Ga0207691_10012192 Ga0207691_1001219211 228
68 3300025941 Ga0207711_10288612 Ga0207711_102886122 228
69 3300026067 Ga0207678_10290096 Ga0207678_102900962 228
70 3300026089 Ga0207648_10039786 Ga0207648_100397863 228
71 3300026121 Ga0207683_10017234 Ga0207683_100172345 228
72 3300037312 Ga0395899_0116447 Ga0395899_0116447_451_1176 228
73 3300037418 Ga0395900_0296113 Ga0395900_0296113_728_1453 228
74 3300037466 Ga0395898_0010996 Ga0395898_0010996_7972_8697 228
75 3300037471 Ga0395905_0101340 Ga0395905_0101340_1751_2476 228
76 3300038443 Ga0395901_0007616 Ga0395901_0007616_3728_4453 228
77 3300048903 Ga0496100_0336689 Ga0496100_0336689_284_1006 228
78 3300005327 Ga0070658_10016599 Ga0070658_100165994 229
79 3300005530 Ga0070679_100007966 Ga0070679_1000079665 229
80 3300025909 Ga0207705_10011556 Ga0207705_100115565 229
81 3300025921 Ga0207652_10010584 Ga0207652_100105847 229
82 3300033541 Ga0316596_1008898 Ga0316596_10088983 229
83 3300037312 Ga0395899_0114370 Ga0395899_0114370_1202_1924 229
84 3300037418 Ga0395900_0028538 Ga0395900_0028538_2166_2888 229
85 3300038443 Ga0395901_0000862 Ga0395901_0000862_4850_5575 229
86 3300038443 Ga0395901_0026410 Ga0395901_0026410_3660_4382 229
87 3300049586 Ga0501070_0125088 Ga0501070_0125088_1231_1959 229
88 3300050491 nmdc:mga00v17_69085_c1 nmdc:mga00v17_69085_c1_394_1116 229
89 3300053093 Ga0500651_0000011 Ga0500651_0000011_56030_56758 229
90 3300053093 Ga0500651_0030291 Ga0500651_0030291_475_1203 229
91 3300053123 Ga0500614_000286 Ga0500614_000286_4416_5144 229
92 3300005355 Ga0070671_100013642 Ga0070671_1000136426 230
93 3300005355 Ga0070671_100141491 Ga0070671_1001414914 230
94 3300005535 Ga0070684_100166282 Ga0070684_1001662822 230
95 3300005563 Ga0068855_100000001 Ga0068855_100000001572 230
96 3300005563 Ga0068855_100013488 Ga0068855_1000134889 230
97 3300005563 Ga0068855_100587865 Ga0068855_1005878652 230
98 3300005614 Ga0068856_100034883 Ga0068856_1000348836 230
99 3300005841 Ga0068863_100578185 Ga0068863_1005781852 230
100 3300006038 Ga0075365_10013224 Ga0075365_100132242 230
101 3300006051 Ga0075364_10007994 Ga0075364_100079945 230
102 3300009174 Ga0105241_10281352 Ga0105241_102813522 230
103 3300009551 Ga0105238_10069705 Ga0105238_100697052 230
104 3300010375 Ga0105239_10443650 Ga0105239_104436502 230
105 3300013105 Ga0157369_10000054 Ga0157369_1000005498 230
106 3300013296 Ga0157374_10022524 Ga0157374_100225243 230
107 3300014325 Ga0163163_10261444 Ga0163163_102614443 230
108 3300025924 Ga0207694_10458450 Ga0207694_104584502 230
109 3300025931 Ga0207644_10018269 Ga0207644_100182693 230
110 3300025944 Ga0207661_10097340 Ga0207661_100973402 230
111 3300025949 Ga0207667_10000003 Ga0207667_10000003560 230
112 3300025949 Ga0207667_10071859 Ga0207667_100718594 230
113 3300026088 Ga0207641_10086609 Ga0207641_100866092 230
114 3300028573 Ga0265334_10000013 Ga0265334_1000001359 230
115 3300028800 Ga0265338_10000060 Ga0265338_1000006074 230
116 3300028800 Ga0265338_10001602 Ga0265338_1000160237 230
117 3300031247 Ga0265340_10000025 Ga0265340_1000002514 230
118 3300037418 Ga0395900_0081042 Ga0395900_0081042_604_1338 230
119 3300038443 Ga0395901_0198811 Ga0395901_0198811_206_928 230
120 3300046506 Ga0495583_0015524 Ga0495583_0015524_2460_3188 230
121 3300048903 Ga0496100_0094652 Ga0496100_0094652_440_1165 230
122 3300048915 Ga0496112_0007611 Ga0496112_0007611_6896_7624 230
123 3300048916 Ga0496113_0425925 Ga0496113_0425925_17_745 230
124 3300050491 nmdc:mga00v17_6605_c1 nmdc:mga00v17_6605_c1_2942_3667 230
125 3300050492 nmdc:mga0yw44_296_c1 nmdc:mga0yw44_296_c1_3599_4321 230
126 3300053108 Ga0500562_000002 Ga0500562_000002_521249_521974 230
127 3300053137 Ga0500561_0000002 Ga0500561_0000002_112501_113226 230
128 3300001990 JGI24737J22298_10000010 JGI24737J22298_1000001010 231
129 3300002067 JGI24735J21928_10000052 JGI24735J21928_1000005253 231
130 3300003320 rootH2_10000311 rootH2_1000031161 231
131 3300003322 rootL2_10152214 rootL2_101522142 231
132 3300003323 rootH1_10068823 rootH1_100688232 231
133 3300005327 Ga0070658_10000051 Ga0070658_100000516 231
134 3300005327 Ga0070658_10004914 Ga0070658_1000491411 231
135 3300005327 Ga0070658_10118858 Ga0070658_101188583 231
136 3300005335 Ga0070666_10080030 Ga0070666_100800304 231
137 3300005339 Ga0070660_100012299 Ga0070660_1000122997 231
138 3300005341 Ga0070691_10023988 Ga0070691_100239883 231
139 3300005347 Ga0070668_100058589 Ga0070668_1000585893 231
140 3300005366 Ga0070659_100000739 Ga0070659_10000073917 231
141 3300005367 Ga0070667_100014428 Ga0070667_10001442810 231
142 3300005530 Ga0070679_100025439 Ga0070679_1000254393 231
143 3300005530 Ga0070679_100063906 Ga0070679_1000639063 231
144 3300005530 Ga0070679_100085980 Ga0070679_1000859803 231
145 3300005539 Ga0068853_100557982 Ga0068853_1005579821 231
146 3300005563 Ga0068855_100000827 Ga0068855_10000082738 231
147 3300005577 Ga0068857_100000001 Ga0068857_100000001263 231
148 3300005577 Ga0068857_100615538 Ga0068857_1006155382 231
149 3300005614 Ga0068856_100002145 Ga0068856_10000214520 231
150 3300005841 Ga0068863_100014438 Ga0068863_10001443810 231
151 3300005842 Ga0068858_100036881 Ga0068858_1000368812 231
152 3300005843 Ga0068860_100063620 Ga0068860_1000636202 231
153 3300006186 Ga0075369_10000418 Ga0075369_1000041814 231
154 3300006195 Ga0075366_10000002 Ga0075366_1000000227 231
155 3300006353 Ga0075370_10131354 Ga0075370_101313542 231
156 3300006358 Ga0068871_100000003 Ga0068871_10000000314 231
157 3300009098 Ga0105245_10000001 Ga0105245_10000001705 231
158 3300009098 Ga0105245_10000007 Ga0105245_10000007153 231
159 3300009174 Ga0105241_10000003 Ga0105241_10000003871 231
160 3300009174 Ga0105241_10000737 Ga0105241_1000073710 231
161 3300009177 Ga0105248_10478183 Ga0105248_104781832 231
162 3300009551 Ga0105238_10050674 Ga0105238_100506745 231
163 3300009551 Ga0105238_10217560 Ga0105238_102175601 231
164 3300009986 Ga0105033_100276 Ga0105033_1002764 231
165 3300009993 Ga0105028_101430 Ga0105028_1014302 231
166 3300013296 Ga0157374_10000014 Ga0157374_10000014153 231
167 3300013296 Ga0157374_10171167 Ga0157374_101711674 231
168 3300013296 Ga0157374_10329746 Ga0157374_103297462 231
169 3300013307 Ga0157372_10001882 Ga0157372_1000188214 231
170 3300013307 Ga0157372_10402909 Ga0157372_104029092 231
171 3300014968 Ga0157379_10019501 Ga0157379_100195012 231
172 3300025903 Ga0207680_10323517 Ga0207680_103235172 231
173 3300025904 Ga0207647_10007861 Ga0207647_100078617 231
174 3300025909 Ga0207705_10000019 Ga0207705_1000001943 231
175 3300025909 Ga0207705_10002466 Ga0207705_100024664 231
176 3300025909 Ga0207705_10090773 Ga0207705_100907733 231
177 3300025911 Ga0207654_10000002 Ga0207654_10000002337 231
178 3300025911 Ga0207654_10000474 Ga0207654_100004748 231
179 3300025912 Ga0207707_10137534 Ga0207707_101375343 231
180 3300025919 Ga0207657_10000588 Ga0207657_100005888 231
181 3300025919 Ga0207657_10013925 Ga0207657_100139252 231
182 3300025921 Ga0207652_10038535 Ga0207652_100385352 231
183 3300025921 Ga0207652_10188099 Ga0207652_101880992 231
184 3300025921 Ga0207652_10746728 Ga0207652_107467281 231
185 3300025924 Ga0207694_10223339 Ga0207694_102233392 231
186 3300025927 Ga0207687_10000001 Ga0207687_10000001266 231
187 3300025927 Ga0207687_10000004 Ga0207687_10000004567 231
188 3300025927 Ga0207687_10000008 Ga0207687_10000008153 231
189 3300025927 Ga0207687_10246124 Ga0207687_102461242 231
190 3300025931 Ga0207644_10041208 Ga0207644_100412084 231
191 3300025932 Ga0207690_10002786 Ga0207690_1000278614 231
192 3300025949 Ga0207667_10008921 Ga0207667_100089214 231
193 3300025986 Ga0207658_10083922 Ga0207658_100839222 231
194 3300026078 Ga0207702_10012769 Ga0207702_100127695 231
195 3300026088 Ga0207641_10118516 Ga0207641_101185162 231
196 3300026116 Ga0207674_10000015 Ga0207674_10000015152 231
197 3300026116 Ga0207674_10325571 Ga0207674_103255712 231
198 3300026116 Ga0207674_10825666 Ga0207674_108256662 231
199 3300028381 Ga0268264_10086710 Ga0268264_100867102 231
200 3300028563 Ga0265319_1012933 Ga0265319_10129334 231
201 3300028800 Ga0265338_10078382 Ga0265338_100783822 231
202 3300031250 Ga0265331_10121774 Ga0265331_101217742 231
203 3300031251 Ga0265327_10001503 Ga0265327_1000150322 231
204 3300037418 Ga0395900_0022143 Ga0395900_0022143_3987_4712 231
205 3300037466 Ga0395898_0008576 Ga0395898_0008576_819_1544 231
206 3300037471 Ga0395905_0141562 Ga0395905_0141562_1178_1903 231
207 3300038443 Ga0395901_0004711 Ga0395901_0004711_1459_2184 231
208 3300046459 Ga0495629_0037108 Ga0495629_0037108_549_1274 231
209 3300046557 Ga0495622_0000008 Ga0495622_0000008_42532_43257 231
210 3300046683 Ga0495658_0007404 Ga0495658_0007404_479_1204 231
211 3300046809 Ga0495600_0076581 Ga0495600_0076581_1010_1735 231
212 3300049568 Ga0501031_0006382 Ga0501031_0006382_648_1376 231
213 3300049569 Ga0501032_0000641 Ga0501032_0000641_2733_3461 231
214 3300049571 Ga0501034_0001383 Ga0501034_0001383_7184_7912 231
215 3300049571 Ga0501034_0210692 Ga0501034_0210692_320_1045 231
216 3300049572 Ga0501036_0010300 Ga0501036_0010300_596_1324 231
217 3300049573 Ga0501037_0000138 Ga0501037_0000138_53288_54016 231
218 3300049574 Ga0501038_0000863 Ga0501038_0000863_22757_23485 231
219 3300049578 Ga0501042_0051974 Ga0501042_0051974_979_1707 231
220 3300049579 Ga0501043_0000062 Ga0501043_0000062_54281_55009 231
221 3300049580 Ga0501046_0000059 Ga0501046_0000059_71121_71849 231
222 3300049581 Ga0501047_0000032 Ga0501047_0000032_203773_204501 231
223 3300049582 Ga0501048_0000001 Ga0501048_0000001_27420_28148 231
224 3300049586 Ga0501070_0005663 Ga0501070_0005663_1151_1879 231
225 3300049589 Ga0501073_0005462 Ga0501073_0005462_7270_7998 231
226 3300049742 Ga0501080_0379804 Ga0501080_0379804_65_793 231
227 3300049744 Ga0501083_0074778 Ga0501083_0074778_1477_2205 231
228 3300049822 Ga0501035_0000872 Ga0501035_0000872_16181_16909 231
229 3300049823 Ga0501044_0054910 Ga0501044_0054910_2254_2982 231
230 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_292858_293583 231
231 3300050496 nmdc:mga07m45_111256_c1 nmdc:mga07m45_111256_c1_581_1306 231
232 3300050516 nmdc:mga0sz30_3_c3 nmdc:mga0sz30_3_c3_17106_17831 231
233 3300053079 Ga0500610_0000081 Ga0500610_0000081_15863_16588 231
234 3300053087 Ga0500643_000034 Ga0500643_000034_70921_71649 231
235 3300053088 Ga0500644_0000213 Ga0500644_0000213_27084_27809 231
236 3300053094 Ga0500566_0000001 Ga0500566_0000001_250173_250898 231
237 3300053103 Ga0500555_000002 Ga0500555_000002_1020141_1020866 231
238 3300053129 Ga0500628_005755 Ga0500628_005755_851_1579 231
239 3300053131 Ga0500652_000009 Ga0500652_000009_121693_122418 231
240 3300053136 Ga0500559_0040500 Ga0500559_0040500_128_853 231
241 3300053724 Ga0500570_001462 Ga0500570_001462_362_1093 231
242 3300060353 Ga0501082_0016798 Ga0501082_0016798_5161_5889 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

5

75

0.97

PF01709

Transcrip_reg

TACO1/YebC second and third domain

80

237

0.95

Feature Viewer

pLDDT pTM Quality
72.73 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map