F354286

General Info

Members Datasets Scaffolds Average Seq Length
242 160 484 165

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10187045|rootL2_101870453
Length 183
Sequence MYLLDLTPTQMTISIVIALVLGGALAYLFWKQRKEAKELLDQHEKLKSAPPAPHATQPLQLQAYERLMLLVDRIAMPNLISRTTATGLSARDMQLLLTQQIRQEFEYNVTQQIYVTQESWEAVRNLKDQNLLIINQIASFLPAESTGQDLSRAILEMLMQNPKASLHNIVADVLSFEAKKLMV

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
117 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
118 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
126 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
127 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
128 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
142 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
152 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
153 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
159 2738541278 Niastella sp. CF465 Isolate Unclassified
160 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.64
Nodule 0
Rhizoplane 0.41
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 15.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10187045 3300003322 Bacteria 2108
2 rootH1_10060753 3300003316 Bacteria 2600
3 rootH2_10082653 3300003320 Bacteria 1737
4 rootH2_10186112 3300003320 Bacteria 6072
5 rootH2_10311363 3300003320 Bacteria 1121
6 rootL2_10100953 3300003322 Bacteria 1247
7 rootH1_10002414 3300003323 Bacteria 26587
8 rootH1_10108108 3300003323 Bacteria 1277
9 rootH1_10174265 3300003323 Bacteria 1757
10 Ga0065712_10447133 3300005290 Unclassified 689
11 Ga0070658_10188301 3300005327 Unclassified 1739
12 Ga0070658_10939631 3300005327 Bacteria 752
13 Ga0070658_11424285 3300005327 Unclassified 601
14 Ga0070683_100016901 3300005329 Bacteria 6438
15 Ga0070690_100080767 3300005330 Bacteria 2127
16 Ga0070670_100107214 3300005331 Bacteria 2408
17 Ga0070666_10055167 3300005335 Bacteria 2682
18 Ga0070666_10057351 3300005335 Bacteria 2631
19 Ga0070682_100000763 3300005337 Bacteria 19108
20 Ga0068868_100206772 3300005338 Unclassified 1639
21 Ga0068868_100380919 3300005338 Unclassified 1214
22 Ga0068868_100807225 3300005338 Bacteria 847
23 Ga0070660_100007265 3300005339 Bacteria 7713
24 Ga0070691_10003781 3300005341 Bacteria 6839
25 Ga0070661_100016347 3300005344 Bacteria 5244
26 Ga0070674_100945049 3300005356 Bacteria 753
27 Ga0070673_100033845 3300005364 Bacteria 3862
28 Ga0070659_100018370 3300005366 Bacteria 5277
29 Ga0070659_100360572 3300005366 Bacteria 1221
30 Ga0070667_100747444 3300005367 Bacteria 906
31 Ga0070678_100091562 3300005456 Unclassified 2334
32 Ga0070662_100037768 3300005457 Bacteria 3425
33 Ga0070681_10058728 3300005458 Bacteria 3827
34 Ga0068867_100129821 3300005459 Bacteria 1957
35 Ga0070679_100009706 3300005530 Bacteria 9105
36 Ga0070679_100848041 3300005530 Bacteria 857
37 Ga0070684_100150316 3300005535 Bacteria 2109
38 Ga0068853_100033977 3300005539 Bacteria 4326
39 Ga0068853_101287744 3300005539 Bacteria 706
40 Ga0070672_100144888 3300005543 Bacteria 1962
41 Ga0070693_100029864 3300005547 Bacteria 2976
42 Ga0070693_100090039 3300005547 Bacteria 1848
43 Ga0068855_100007605 3300005563 Bacteria 13107
44 Ga0068855_100042418 3300005563 Bacteria 5391
45 Ga0068855_100048662 3300005563 Bacteria 5003
46 Ga0068855_100093408 3300005563 Bacteria 3469
47 Ga0070664_100023017 3300005564 Bacteria 5140
48 Ga0068854_100013884 3300005578 Bacteria 5297
49 Ga0068856_100014271 3300005614 Bacteria 7682
50 Ga0068852_100023526 3300005616 Bacteria 4960
51 Ga0068852_100734343 3300005616 Unclassified 999
52 Ga0068859_100921733 3300005617 Unclassified 958
53 Ga0068851_10107931 3300005834 Bacteria 1483
54 Ga0068860_100042795 3300005843 Bacteria 4323
55 Ga0075366_10195982 3300006195 Unclassified 1228
56 Ga0097621_100011220 3300006237 Bacteria 6597
57 Ga0097621_100317959 3300006237 Bacteria 1378
58 Ga0068871_100053108 3300006358 Bacteria 3284
59 Ga0097620_100921746 3300006931 Unclassified 958
60 Ga0105240_10002769 3300009093 Bacteria 27701
61 Ga0105240_10008175 3300009093 Bacteria 15002
62 Ga0105240_10086166 3300009093 Bacteria 3847
63 Ga0105240_10344666 3300009093 Bacteria 1691
64 Ga0111539_10129745 3300009094 Bacteria 2952
65 Ga0114129_10014670 3300009147 Bacteria 11163
66 Ga0105241_10000160 3300009174 Bacteria 48902
67 Ga0105241_10067151 3300009174 Bacteria 2775
68 Ga0105237_10000113 3300009545 Bacteria 114034
69 Ga0105237_10001957 3300009545 Bacteria 26223
70 Ga0105237_10024486 3300009545 Bacteria 6175
71 Ga0105239_10000797 3300010375 Bacteria 44708
72 Ga0105239_10004515 3300010375 Bacteria 16592
73 Ga0105239_10056557 3300010375 Bacteria 4303
74 Ga0105239_11447622 3300010375 Bacteria 793
75 Ga0105239_12499637 3300010375 Bacteria 602
76 Ga0157373_10010547 3300013100 Bacteria 6800
77 Ga0157373_10277461 3300013100 Bacteria 1187
78 Ga0157373_10873353 3300013100 Unclassified 666
79 Ga0157371_10077912 3300013102 Bacteria 2347
80 Ga0157371_10136403 3300013102 Unclassified 1747
81 Ga0157371_10404345 3300013102 Bacteria 999
82 Ga0157370_10198161 3300013104 Bacteria 1863
83 Ga0157370_10427882 3300013104 Bacteria 1217
84 Ga0157369_10121549 3300013105 Bacteria 2770
85 Ga0157369_10543632 3300013105 Bacteria 1201
86 Ga0157374_10003697 3300013296 Bacteria 12864
87 Ga0157374_10369230 3300013296 Bacteria 1428
88 Ga0157374_11465304 3300013296 Unclassified 706
89 Ga0157378_10007097 3300013297 Bacteria 9784
90 Ga0163162_10096435 3300013306 Bacteria 3045
91 Ga0163162_10194723 3300013306 Bacteria 2155
92 Ga0163162_10753173 3300013306 Bacteria 1093
93 Ga0157372_10019296 3300013307 Bacteria 7343
94 Ga0157372_10121147 3300013307 Bacteria 3005
95 Ga0157372_10140342 3300013307 Bacteria 2783
96 Ga0157375_10322342 3300013308 Unclassified 1710
97 Ga0157377_10206569 3300014745 Bacteria 1250
98 Ga0157379_10186547 3300014968 Unclassified 1874
99 Ga0157379_10654227 3300014968 Bacteria 984
100 Ga0157376_10069637 3300014969 Bacteria 2983
101 Ga0207680_10040955 3300025903 Bacteria 2700
102 Ga0207647_10173688 3300025904 Bacteria 1254
103 Ga0207705_10100380 3300025909 Unclassified 2129
104 Ga0207705_10694478 3300025909 Bacteria 791
105 Ga0207654_10003003 3300025911 Bacteria 8561
106 Ga0207654_10177597 3300025911 Bacteria 1387
107 Ga0207707_10000323 3300025912 Bacteria 50505
108 Ga0207695_10100571 3300025913 Bacteria 2887
109 Ga0207695_10441887 3300025913 Unclassified 1184
110 Ga0207671_10000992 3300025914 Bacteria 34903
111 Ga0207671_10002898 3300025914 Bacteria 17718
112 Ga0207671_10073583 3300025914 Bacteria 2552
113 Ga0207671_10266764 3300025914 Unclassified 1348
114 Ga0207660_10133978 3300025917 Unclassified 1889
115 Ga0207657_10002296 3300025919 Bacteria 20721
116 Ga0207649_10095361 3300025920 Bacteria 1957
117 Ga0207652_10031715 3300025921 Bacteria 4439
118 Ga0207652_10037876 3300025921 Bacteria 4084
119 Ga0207652_11300801 3300025921 Bacteria 630
120 Ga0207659_10104157 3300025926 Bacteria 2145
121 Ga0207644_10263464 3300025931 Bacteria 1379
122 Ga0207690_10010251 3300025932 Bacteria 5565
123 Ga0207690_10153002 3300025932 Bacteria 1712
124 Ga0207706_10034050 3300025933 Bacteria 4533
125 Ga0207661_10577964 3300025944 Bacteria 1030
126 Ga0207679_10149944 3300025945 Bacteria 1896
127 Ga0207667_10035134 3300025949 Bacteria 5378
128 Ga0207667_10035264 3300025949 Bacteria 5367
129 Ga0207667_10039568 3300025949 Bacteria 5025
130 Ga0207651_10180749 3300025960 Bacteria 1673
131 Ga0207658_10200193 3300025986 Bacteria 1667
132 Ga0207658_11131329 3300025986 Bacteria 715
133 Ga0207677_10243007 3300026023 Bacteria 1458
134 Ga0207639_10040854 3300026041 Bacteria 3465
135 Ga0207639_10184227 3300026041 Unclassified 1778
136 Ga0207702_10098350 3300026078 Bacteria 2577
137 Ga0207702_10145845 3300026078 Bacteria 2148
138 Ga0207648_10249242 3300026089 Bacteria 1583
139 Ga0207674_11316188 3300026116 Bacteria 692
140 Ga0207675_100642448 3300026118 Bacteria 1067
141 Ga0207698_10265751 3300026142 Bacteria 1578
142 Ga0207698_10674842 3300026142 Unclassified 1026
143 Ga0268264_10011442 3300028381 Bacteria 7326
144 Ga0307511_10000579 3300030521 Bacteria 39193
145 Ga0316183_1059634 3300030742 Unclassified 677
146 Ga0307513_10181922 3300031456 Bacteria 1964
147 Ga0307513_10228734 3300031456 Bacteria 1674
148 Ga0307513_10311610 3300031456 Unclassified 1336
149 Ga0307509_10663810 3300031507 Unclassified 711
150 Ga0265313_10027128 3300031595 Bacteria 3004
151 Ga0373937_0149185 3300036401 Bacteria 2190
152 Ga0395900_0033543 3300037418 Bacteria 5283
153 Ga0395905_0014668 3300037471 Bacteria 7475
154 Ga0395905_0139979 3300037471 Bacteria 2277
155 Ga0395905_1142855 3300037471 Bacteria 682
156 Ga0439439_0027811 3300041406 Bacteria 1430
157 Ga0451802_1664803 3300041460 Unclassified 653
158 Ga0451849_0483062 3300041505 Unclassified 639
159 Ga0439449_0035101 3300042007 Bacteria 1867
160 Ga0439457_001402 3300042014 Bacteria 7253
161 Ga0439457_027641 3300042014 Bacteria 1256
162 Ga0450894_035167 3300042131 Bacteria 708
163 Ga0466969_0000293 3300044656 Bacteria 27315
164 Ga0466972_0000023 3300044658 Bacteria 192679
165 Ga0466972_0033097 3300044658 Bacteria 2536
166 Ga0466972_0203679 3300044658 Bacteria 927
167 Ga0466966_0000028 3300044684 Bacteria 105667
168 Ga0466964_0566650 3300044706 Unclassified 619
169 Ga0466957_0000123 3300044842 Bacteria 32543
170 Ga0466957_0002136 3300044842 Bacteria 10580
171 Ga0466959_0000039 3300045049 Bacteria 101186
172 Ga0466967_0107486 3300045976 Bacteria 2559
173 Ga0466967_1801409 3300045976 Unclassified 609
174 Ga0495638_0043769 3300046460 Bacteria 2823
175 Ga0495648_0002188 3300046524 Bacteria 18313
176 Ga0495667_0207988 3300046559 Bacteria 1251
177 Ga0495668_0018683 3300046616 Bacteria 4006
178 Ga0495668_0435071 3300046616 Bacteria 722
179 Ga0495611_0001199 3300046648 Bacteria 13429
180 Ga0495657_0780375 3300046675 Unclassified 547
181 Ga0495613_0251107 3300046689 Unclassified 1234
182 Ga0495672_0022605 3300047320 Bacteria 4085
183 Ga0495672_0212203 3300047320 Bacteria 961
184 Ga0501290_015878 3300049513 Bacteria 1000
185 Ga0501291_154994 3300049514 Unclassified 520
186 Ga0501296_011686 3300049519 Bacteria 1053
187 Ga0501034_0363091 3300049571 Bacteria 1375
188 Ga0501046_0404548 3300049580 Bacteria 986
189 Ga0501047_0014128 3300049581 Bacteria 7587
190 Ga0501047_0037049 3300049581 Bacteria 4715
191 Ga0501047_0468776 3300049581 Bacteria 1088
192 Ga0501047_0539144 3300049581 Bacteria 992
193 Ga0501047_0634472 3300049581 Unclassified 888
194 Ga0501070_0465218 3300049586 Bacteria 1018
195 Ga0501071_0044623 3300049587 Bacteria 3180
196 Ga0501202_102297 3300049652 Bacteria 699
197 Ga0501240_011080 3300049673 Bacteria 1210
198 Ga0501243_028438 3300049675 Bacteria 946
199 Ga0501257_008928 3300049686 Bacteria 2259
200 Ga0501219_000174 3300049703 Bacteria 11909
201 Ga0501225_0000598 3300049705 Bacteria 11232
202 Ga0501245_008333 3300049708 Bacteria 1476
203 Ga0501079_0257609 3300049741 Bacteria 1364
204 Ga0501035_0142059 3300049822 Bacteria 2087
205 Ga0501044_0001962 3300049823 Bacteria 23802
206 Ga0501284_00087 3300050005 Bacteria 22697
207 nmdc:mga0k408_262127_c1 3300050493 Bacteria 1032
208 nmdc:mga05p37_10164_c1 3300050507 Bacteria 11169
209 Ga0500578_0000027 3300053086 Bacteria 144362
210 Ga0500578_0069259 3300053086 Bacteria 2249
211 Ga0500644_0006074 3300053088 Bacteria 3079
212 Ga0500646_0007970 3300053090 Bacteria 2707
213 Ga0500646_0015350 3300053090 Bacteria 1993
214 Ga0500583_0000042 3300053092 Bacteria 82406
215 Ga0500583_0000264 3300053092 Bacteria 18644
216 Ga0500583_0076511 3300053092 Bacteria 1610
217 Ga0500583_0206860 3300053092 Unclassified 975
218 Ga0500650_0079423 3300053098 Bacteria 1534
219 Ga0500555_015265 3300053103 Bacteria 2215
220 Ga0500562_000016 3300053108 Bacteria 131323
221 Ga0500569_147842 3300053109 Bacteria 792
222 Ga0500652_016388 3300053131 Bacteria 2695
223 Ga0500568_0112377 3300053139 Bacteria 1017
224 Ga0500589_027486 3300053147 Unclassified 2642
225 Ga0500604_0218265 3300053151 Unclassified 657
226 Ga0500616_0100907 3300053153 Unclassified 1411
227 Ga0500616_0342247 3300053153 Unclassified 610
228 Ga0500622_0006532 3300053156 Bacteria 6740
229 Ga0500622_0075667 3300053156 Bacteria 1694
230 Ga0500622_0140780 3300053156 Bacteria 1150
231 Ga0500639_063485 3300053163 Bacteria 1899
232 Ga0500636_0032600 3300053177 Bacteria 3083
233 Ga0500636_0254970 3300053177 Bacteria 892
234 Ga0500637_0202337 3300053178 Bacteria 1130
235 Ga0500611_004698 3300053727 Bacteria 1863
236 Ga0500645_011892 3300053730 Bacteria 2827
237 Ga0500645_073977 3300053730 Unclassified 976
238 Ga0500587_009721 3300053739 Bacteria 1226
239 Ga0501084_0070369 3300054114 Bacteria 2929
240 Ga0500661_015016 3300055283 Bacteria 1391
241 2738727665 2738541278 Bacteria 9755573
242 2929156946 2929154850 Bacteria 6753285
243 rootL2_10187045
244 rootH1_10060753
245 rootH2_10082653
246 rootH2_10186112
247 rootH2_10311363
248 rootL2_10100953
249 rootH1_10002414
250 rootH1_10108108
251 rootH1_10174265
252 Ga0065712_10447133
253 Ga0070658_10188301
254 Ga0070658_10939631
255 Ga0070658_11424285
256 Ga0070683_100016901
257 Ga0070690_100080767
258 Ga0070670_100107214
259 Ga0070666_10055167
260 Ga0070666_10057351
261 Ga0070682_100000763
262 Ga0068868_100206772
263 Ga0068868_100380919
264 Ga0068868_100807225
265 Ga0070660_100007265
266 Ga0070691_10003781
267 Ga0070661_100016347
268 Ga0070674_100945049
269 Ga0070673_100033845
270 Ga0070659_100018370
271 Ga0070659_100360572
272 Ga0070667_100747444
273 Ga0070678_100091562
274 Ga0070662_100037768
275 Ga0070681_10058728
276 Ga0068867_100129821
277 Ga0070679_100009706
278 Ga0070679_100848041
279 Ga0070684_100150316
280 Ga0068853_100033977
281 Ga0068853_101287744
282 Ga0070672_100144888
283 Ga0070693_100029864
284 Ga0070693_100090039
285 Ga0068855_100007605
286 Ga0068855_100042418
287 Ga0068855_100048662
288 Ga0068855_100093408
289 Ga0070664_100023017
290 Ga0068854_100013884
291 Ga0068856_100014271
292 Ga0068852_100023526
293 Ga0068852_100734343
294 Ga0068859_100921733
295 Ga0068851_10107931
296 Ga0068860_100042795
297 Ga0075366_10195982
298 Ga0097621_100011220
299 Ga0097621_100317959
300 Ga0068871_100053108
301 Ga0097620_100921746
302 Ga0105240_10002769
303 Ga0105240_10008175
304 Ga0105240_10086166
305 Ga0105240_10344666
306 Ga0111539_10129745
307 Ga0114129_10014670
308 Ga0105241_10000160
309 Ga0105241_10067151
310 Ga0105237_10000113
311 Ga0105237_10001957
312 Ga0105237_10024486
313 Ga0105239_10000797
314 Ga0105239_10004515
315 Ga0105239_10056557
316 Ga0105239_11447622
317 Ga0105239_12499637
318 Ga0157373_10010547
319 Ga0157373_10277461
320 Ga0157373_10873353
321 Ga0157371_10077912
322 Ga0157371_10136403
323 Ga0157371_10404345
324 Ga0157370_10198161
325 Ga0157370_10427882
326 Ga0157369_10121549
327 Ga0157369_10543632
328 Ga0157374_10003697
329 Ga0157374_10369230
330 Ga0157374_11465304
331 Ga0157378_10007097
332 Ga0163162_10096435
333 Ga0163162_10194723
334 Ga0163162_10753173
335 Ga0157372_10019296
336 Ga0157372_10121147
337 Ga0157372_10140342
338 Ga0157375_10322342
339 Ga0157377_10206569
340 Ga0157379_10186547
341 Ga0157379_10654227
342 Ga0157376_10069637
343 Ga0207680_10040955
344 Ga0207647_10173688
345 Ga0207705_10100380
346 Ga0207705_10694478
347 Ga0207654_10003003
348 Ga0207654_10177597
349 Ga0207707_10000323
350 Ga0207695_10100571
351 Ga0207695_10441887
352 Ga0207671_10000992
353 Ga0207671_10002898
354 Ga0207671_10073583
355 Ga0207671_10266764
356 Ga0207660_10133978
357 Ga0207657_10002296
358 Ga0207649_10095361
359 Ga0207652_10031715
360 Ga0207652_10037876
361 Ga0207652_11300801
362 Ga0207659_10104157
363 Ga0207644_10263464
364 Ga0207690_10010251
365 Ga0207690_10153002
366 Ga0207706_10034050
367 Ga0207661_10577964
368 Ga0207679_10149944
369 Ga0207667_10035134
370 Ga0207667_10035264
371 Ga0207667_10039568
372 Ga0207651_10180749
373 Ga0207658_10200193
374 Ga0207658_11131329
375 Ga0207677_10243007
376 Ga0207639_10040854
377 Ga0207639_10184227
378 Ga0207702_10098350
379 Ga0207702_10145845
380 Ga0207648_10249242
381 Ga0207674_11316188
382 Ga0207675_100642448
383 Ga0207698_10265751
384 Ga0207698_10674842
385 Ga0268264_10011442
386 Ga0307511_10000579
387 Ga0316183_1059634
388 Ga0307513_10181922
389 Ga0307513_10228734
390 Ga0307513_10311610
391 Ga0307509_10663810
392 Ga0265313_10027128
393 Ga0373937_0149185
394 Ga0395900_0033543
395 Ga0395905_0014668
396 Ga0395905_0139979
397 Ga0395905_1142855
398 Ga0439439_0027811
399 Ga0451802_1664803
400 Ga0451849_0483062
401 Ga0439449_0035101
402 Ga0439457_001402
403 Ga0439457_027641
404 Ga0450894_035167
405 Ga0466969_0000293
406 Ga0466972_0000023
407 Ga0466972_0033097
408 Ga0466972_0203679
409 Ga0466966_0000028
410 Ga0466964_0566650
411 Ga0466957_0000123
412 Ga0466957_0002136
413 Ga0466959_0000039
414 Ga0466967_0107486
415 Ga0466967_1801409
416 Ga0495638_0043769
417 Ga0495648_0002188
418 Ga0495667_0207988
419 Ga0495668_0018683
420 Ga0495668_0435071
421 Ga0495611_0001199
422 Ga0495657_0780375
423 Ga0495613_0251107
424 Ga0495672_0022605
425 Ga0495672_0212203
426 Ga0501290_015878
427 Ga0501291_154994
428 Ga0501296_011686
429 Ga0501034_0363091
430 Ga0501046_0404548
431 Ga0501047_0014128
432 Ga0501047_0037049
433 Ga0501047_0468776
434 Ga0501047_0539144
435 Ga0501047_0634472
436 Ga0501070_0465218
437 Ga0501071_0044623
438 Ga0501202_102297
439 Ga0501240_011080
440 Ga0501243_028438
441 Ga0501257_008928
442 Ga0501219_000174
443 Ga0501225_0000598
444 Ga0501245_008333
445 Ga0501079_0257609
446 Ga0501035_0142059
447 Ga0501044_0001962
448 Ga0501284_00087
449 nmdc:mga0k408_262127_c1
450 nmdc:mga05p37_10164_c1
451 Ga0500578_0000027
452 Ga0500578_0069259
453 Ga0500644_0006074
454 Ga0500646_0007970
455 Ga0500646_0015350
456 Ga0500583_0000042
457 Ga0500583_0000264
458 Ga0500583_0076511
459 Ga0500583_0206860
460 Ga0500650_0079423
461 Ga0500555_015265
462 Ga0500562_000016
463 Ga0500569_147842
464 Ga0500652_016388
465 Ga0500568_0112377
466 Ga0500589_027486
467 Ga0500604_0218265
468 Ga0500616_0100907
469 Ga0500616_0342247
470 Ga0500622_0006532
471 Ga0500622_0075667
472 Ga0500622_0140780
473 Ga0500639_063485
474 Ga0500636_0032600
475 Ga0500636_0254970
476 Ga0500637_0202337
477 Ga0500611_004698
478 Ga0500645_011892
479 Ga0500645_073977
480 Ga0500587_009721
481 Ga0501084_0070369
482 Ga0500661_015016
483 2738727665
484 2929156946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rvu-assembly1.cif.gz_B e75q mutant of rabbit cytosolic serine hydroxymethyltransferase 0.5481 113 171
1qvx-assembly1.cif.gz_A solution structure of the fat domain of focal adhesion kinase 0.5453 52 171
1wat-assembly1.cif.gz_A the three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor 0.5268 41 169
7nen-assembly1.cif.gz_A-2 crystal structure of outer surface protein c (ospc) from borrelia garinii 0.5166 47 171
1qvx-assembly1.cif.gz_A solution structure of the fat domain of focal adhesion kinase 0.4954 52 171
ID Description Score Start End Superfamily
1rvuB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.5481 113 171 3.90.1150.10
1watA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.5268 41 169 1.20.120.30
af_A0A0R0IZY4_87_243_1.20.120.1190 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5131 53 171 1.20.120.1190
af_A0A0R4IDZ8_1657_1820_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.5126 29 172 1.20.1420.10
af_I1LQ21_54_281_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5067 35 171 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A4Q3SMJ6-F1-model_v4 Uncharacterized protein 0.9982 53 172
AF-A0A7K3IX89-F1-model_v4 Uncharacterized protein 0.979 78 172
AF-A0A4Q3SMJ6-F1-model_v4 Uncharacterized protein 0.9739 53 172
AF-A0A3S1DNQ2-F1-model_v4 deleted 0.9694 41 172
AF-A0A7K3IX89-F1-model_v4 Uncharacterized protein 0.9689 78 172

Map