F354171
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 241 | 168 | 240 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300053093|Ga0500651_0061178|Ga0500651_0061178_1004_1522 |
| Length | 172 |
| Sequence | MRLVEQSSFDELTLELNGLKLTLRRGAVAEQSNGGFAFEQTAGVGAPAPNSAIGTIAAPAALRAANSLTGSACERAMASSSRAVPLAGADPNVQNVISPMLGTFYRAPKPGAPPFVEIGSIVEEDTIVALIEVMKLMNSVRAGVRGTVSEILARDGALVEYGETVLRVRKTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 162 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 163 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 164 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 165 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 166 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.24 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0 |
| Rhizoplane | 7.05 |
| Rhizosphere | 87.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10144617 | 3300003322 | Unclassified | 1237 |
| 2 | Ga0065704_10152796 | 3300005289 | Unclassified | 1415 |
| 3 | Ga0070690_100028902 | 3300005330 | Bacteria | 3436 |
| 4 | Ga0070690_100070361 | 3300005330 | Bacteria | 2272 |
| 5 | Ga0070670_100037750 | 3300005331 | Bacteria | 4155 |
| 6 | Ga0068869_100056991 | 3300005334 | Bacteria | 2851 |
| 7 | Ga0070666_10001463 | 3300005335 | Bacteria | 14338 |
| 8 | Ga0070680_100143081 | 3300005336 | Bacteria | 2005 |
| 9 | Ga0070689_100031042 | 3300005340 | Bacteria | 4059 |
| 10 | Ga0070687_100670855 | 3300005343 | Bacteria | 721 |
| 11 | Ga0070687_100842909 | 3300005343 | Unclassified | 653 |
| 12 | Ga0070692_10275203 | 3300005345 | Bacteria | 1018 |
| 13 | Ga0070669_100383818 | 3300005353 | Bacteria | 1146 |
| 14 | Ga0070673_100269703 | 3300005364 | Bacteria | 1489 |
| 15 | Ga0070659_101088620 | 3300005366 | Bacteria | 704 |
| 16 | Ga0070667_100030761 | 3300005367 | Bacteria | 4477 |
| 17 | Ga0070713_100146665 | 3300005436 | Bacteria | 2095 |
| 18 | Ga0070701_10029324 | 3300005438 | Bacteria | 2713 |
| 19 | Ga0070711_100033476 | 3300005439 | Bacteria | 3422 |
| 20 | Ga0070711_100038138 | 3300005439 | Bacteria | 3228 |
| 21 | Ga0070705_100036986 | 3300005440 | Bacteria | 2750 |
| 22 | Ga0070700_100214837 | 3300005441 | Bacteria | 1359 |
| 23 | Ga0070700_100600659 | 3300005441 | Bacteria | 862 |
| 24 | Ga0070708_100097444 | 3300005445 | Bacteria | 2688 |
| 25 | Ga0070681_10144445 | 3300005458 | Unclassified | 2309 |
| 26 | Ga0070685_10107369 | 3300005466 | Bacteria | 1714 |
| 27 | Ga0070707_100321188 | 3300005468 | Bacteria | 1504 |
| 28 | Ga0070679_100041299 | 3300005530 | Bacteria | 4590 |
| 29 | Ga0070684_100037398 | 3300005535 | Bacteria | 4163 |
| 30 | Ga0070697_100226425 | 3300005536 | Bacteria | 1594 |
| 31 | Ga0070672_100590164 | 3300005543 | Bacteria | 967 |
| 32 | Ga0070686_100012129 | 3300005544 | Bacteria | 4903 |
| 33 | Ga0070693_100821943 | 3300005547 | Bacteria | 690 |
| 34 | Ga0070665_100003052 | 3300005548 | Bacteria | 18032 |
| 35 | Ga0070665_100005884 | 3300005548 | Bacteria | 12563 |
| 36 | Ga0070665_100036879 | 3300005548 | Bacteria | 4916 |
| 37 | Ga0070665_100044467 | 3300005548 | Bacteria | 4460 |
| 38 | Ga0070665_100086382 | 3300005548 | Bacteria | 3142 |
| 39 | Ga0068855_100004606 | 3300005563 | Bacteria | 16832 |
| 40 | Ga0068855_101069903 | 3300005563 | Bacteria | 845 |
| 41 | Ga0068857_101356194 | 3300005577 | Bacteria | 691 |
| 42 | Ga0068856_101339457 | 3300005614 | Bacteria | 731 |
| 43 | Ga0070702_100015827 | 3300005615 | Bacteria | 3858 |
| 44 | Ga0068852_100310307 | 3300005616 | Bacteria | 1529 |
| 45 | Ga0068852_101480078 | 3300005616 | Bacteria | 701 |
| 46 | Ga0068859_100029343 | 3300005617 | Bacteria | 5520 |
| 47 | Ga0068859_100278619 | 3300005617 | Bacteria | 1765 |
| 48 | Ga0068859_100357745 | 3300005617 | Bacteria | 1555 |
| 49 | Ga0068859_100396864 | 3300005617 | Bacteria | 1475 |
| 50 | Ga0068859_100585461 | 3300005617 | Bacteria | 1209 |
| 51 | Ga0068864_100058408 | 3300005618 | Bacteria | 3334 |
| 52 | Ga0068864_100110555 | 3300005618 | Bacteria | 2447 |
| 53 | Ga0068861_100032728 | 3300005719 | Bacteria | 3830 |
| 54 | Ga0068861_100106702 | 3300005719 | Bacteria | 2238 |
| 55 | Ga0068861_100409657 | 3300005719 | Bacteria | 1205 |
| 56 | Ga0068851_10286647 | 3300005834 | Bacteria | 943 |
| 57 | Ga0068858_100012153 | 3300005842 | Bacteria | 8119 |
| 58 | Ga0068858_100247609 | 3300005842 | Bacteria | 1692 |
| 59 | Ga0068860_100004120 | 3300005843 | Bacteria | 14895 |
| 60 | Ga0068860_100535553 | 3300005843 | Bacteria | 1172 |
| 61 | Ga0068860_101280192 | 3300005843 | Bacteria | 754 |
| 62 | Ga0068860_101382191 | 3300005843 | Bacteria | 725 |
| 63 | Ga0068862_100017197 | 3300005844 | Bacteria | 6018 |
| 64 | Ga0068862_100128698 | 3300005844 | Bacteria | 2238 |
| 65 | Ga0068862_100182960 | 3300005844 | Bacteria | 1882 |
| 66 | Ga0081455_10001456 | 3300005937 | Bacteria | 29298 |
| 67 | Ga0070712_100499625 | 3300006175 | Unclassified | 1019 |
| 68 | Ga0097621_100036088 | 3300006237 | Bacteria | 3953 |
| 69 | Ga0097621_100562551 | 3300006237 | Bacteria | 1039 |
| 70 | Ga0068871_100214098 | 3300006358 | Bacteria | 1667 |
| 71 | Ga0075428_100008172 | 3300006844 | Bacteria | 11611 |
| 72 | Ga0075431_100803803 | 3300006847 | Bacteria | 913 |
| 73 | Ga0075429_100646922 | 3300006880 | Bacteria | 926 |
| 74 | Ga0075436_100159456 | 3300006914 | Bacteria | 1590 |
| 75 | Ga0097620_100029342 | 3300006931 | Bacteria | 5520 |
| 76 | Ga0097620_100278620 | 3300006931 | Bacteria | 1765 |
| 77 | Ga0097620_100357754 | 3300006931 | Bacteria | 1555 |
| 78 | Ga0097620_100396836 | 3300006931 | Bacteria | 1475 |
| 79 | Ga0097620_100585422 | 3300006931 | Bacteria | 1209 |
| 80 | Ga0105250_10000014 | 3300009092 | Bacteria | 268458 |
| 81 | Ga0105240_10016790 | 3300009093 | Bacteria | 9900 |
| 82 | Ga0105240_10026583 | 3300009093 | Bacteria | 7594 |
| 83 | Ga0105240_10027407 | 3300009093 | Bacteria | 7458 |
| 84 | Ga0105240_10753119 | 3300009093 | Bacteria | 1059 |
| 85 | Ga0111539_10193464 | 3300009094 | Bacteria | 2373 |
| 86 | Ga0105245_10020195 | 3300009098 | Bacteria | 5839 |
| 87 | Ga0105245_10095718 | 3300009098 | Bacteria | 2739 |
| 88 | Ga0105247_10150346 | 3300009101 | Bacteria | 1534 |
| 89 | Ga0105242_10044259 | 3300009176 | Bacteria | 3605 |
| 90 | Ga0105248_10006277 | 3300009177 | Bacteria | 13037 |
| 91 | Ga0105237_10057995 | 3300009545 | Bacteria | 3875 |
| 92 | Ga0105237_10151566 | 3300009545 | Bacteria | 2315 |
| 93 | Ga0105237_10706580 | 3300009545 | Bacteria | 1015 |
| 94 | Ga0105238_10045883 | 3300009551 | Bacteria | 4414 |
| 95 | Ga0105238_10080934 | 3300009551 | Bacteria | 3237 |
| 96 | Ga0105249_10046698 | 3300009553 | Bacteria | 3942 |
| 97 | Ga0105239_11156784 | 3300010375 | Bacteria | 891 |
| 98 | Ga0157370_10962325 | 3300013104 | Unclassified | 774 |
| 99 | Ga0157374_10077160 | 3300013296 | Bacteria | 3152 |
| 100 | Ga0163162_10081169 | 3300013306 | Bacteria | 3313 |
| 101 | Ga0163162_11515644 | 3300013306 | Bacteria | 764 |
| 102 | Ga0157372_10329082 | 3300013307 | Bacteria | 1779 |
| 103 | Ga0157372_12575520 | 3300013307 | Bacteria | 584 |
| 104 | Ga0157375_10002928 | 3300013308 | Bacteria | 14809 |
| 105 | Ga0163163_10008759 | 3300014325 | Bacteria | 9004 |
| 106 | Ga0163163_10755935 | 3300014325 | Bacteria | 1035 |
| 107 | Ga0157380_10008495 | 3300014326 | Bacteria | 7336 |
| 108 | Ga0157380_12128089 | 3300014326 | Bacteria | 624 |
| 109 | Ga0157379_10000278 | 3300014968 | Bacteria | 40420 |
| 110 | Ga0157379_10001605 | 3300014968 | Bacteria | 18651 |
| 111 | Ga0157379_10897694 | 3300014968 | Unclassified | 840 |
| 112 | Ga0157376_10000910 | 3300014969 | Bacteria | 19232 |
| 113 | Ga0207696_1000087 | 3300025711 | Bacteria | 194367 |
| 114 | Ga0207707_10266043 | 3300025912 | Bacteria | 1487 |
| 115 | Ga0207695_10022830 | 3300025913 | Bacteria | 7088 |
| 116 | Ga0207695_10514082 | 3300025913 | Bacteria | 1079 |
| 117 | Ga0207695_10673005 | 3300025913 | Unclassified | 916 |
| 118 | Ga0207671_10369013 | 3300025914 | Bacteria | 1140 |
| 119 | Ga0207671_10991550 | 3300025914 | Unclassified | 662 |
| 120 | Ga0207693_10407983 | 3300025915 | Unclassified | 1062 |
| 121 | Ga0207663_10352653 | 3300025916 | Unclassified | 1114 |
| 122 | Ga0207660_10180711 | 3300025917 | Bacteria | 1638 |
| 123 | Ga0207662_10144219 | 3300025918 | Bacteria | 1510 |
| 124 | Ga0207662_10556895 | 3300025918 | Bacteria | 794 |
| 125 | Ga0207652_10275921 | 3300025921 | Bacteria | 1516 |
| 126 | Ga0207646_10032731 | 3300025922 | Bacteria | 4704 |
| 127 | Ga0207681_10859309 | 3300025923 | Bacteria | 759 |
| 128 | Ga0207650_10380551 | 3300025925 | Bacteria | 1165 |
| 129 | Ga0207687_10161564 | 3300025927 | Bacteria | 1720 |
| 130 | Ga0207687_10652373 | 3300025927 | Unclassified | 890 |
| 131 | Ga0207700_10026838 | 3300025928 | Bacteria | 4023 |
| 132 | Ga0207686_10135727 | 3300025934 | Unclassified | 1693 |
| 133 | Ga0207704_10209545 | 3300025938 | Bacteria | 1433 |
| 134 | Ga0207704_10333891 | 3300025938 | Bacteria | 1174 |
| 135 | Ga0207689_10165079 | 3300025942 | Bacteria | 1825 |
| 136 | Ga0207667_10001737 | 3300025949 | Bacteria | 27400 |
| 137 | Ga0207651_10356025 | 3300025960 | Bacteria | 1234 |
| 138 | Ga0207712_10025287 | 3300025961 | Bacteria | 3944 |
| 139 | Ga0207658_10242544 | 3300025986 | Bacteria | 1527 |
| 140 | Ga0207703_10005491 | 3300026035 | Bacteria | 10191 |
| 141 | Ga0207703_10006054 | 3300026035 | Bacteria | 9674 |
| 142 | Ga0207708_10540464 | 3300026075 | Bacteria | 982 |
| 143 | Ga0207702_11366420 | 3300026078 | Bacteria | 702 |
| 144 | Ga0207702_11831162 | 3300026078 | Unclassified | 599 |
| 145 | Ga0207676_10079338 | 3300026095 | Bacteria | 2662 |
| 146 | Ga0207675_100101080 | 3300026118 | Bacteria | 2716 |
| 147 | Ga0207675_100111950 | 3300026118 | Bacteria | 2576 |
| 148 | Ga0207675_100195654 | 3300026118 | Bacteria | 1940 |
| 149 | Ga0207675_100460892 | 3300026118 | Bacteria | 1261 |
| 150 | Ga0207698_10238319 | 3300026142 | Bacteria | 1656 |
| 151 | Ga0268266_10001861 | 3300028379 | Bacteria | 23842 |
| 152 | Ga0268266_10017864 | 3300028379 | Bacteria | 6044 |
| 153 | Ga0268266_10020712 | 3300028379 | Bacteria | 5605 |
| 154 | Ga0268266_10043416 | 3300028379 | Bacteria | 3842 |
| 155 | Ga0268266_10149702 | 3300028379 | Bacteria | 2102 |
| 156 | Ga0268266_10521790 | 3300028379 | Bacteria | 1136 |
| 157 | Ga0268265_10026239 | 3300028380 | Bacteria | 4143 |
| 158 | Ga0268265_10122495 | 3300028380 | Bacteria | 2145 |
| 159 | Ga0268265_10528366 | 3300028380 | Bacteria | 1116 |
| 160 | Ga0268265_11051867 | 3300028380 | Unclassified | 806 |
| 161 | Ga0268264_10132305 | 3300028381 | Unclassified | 2213 |
| 162 | Ga0268264_11749743 | 3300028381 | Bacteria | 632 |
| 163 | Ga0265338_10008206 | 3300028800 | Bacteria | 12725 |
| 164 | Ga0265338_10023510 | 3300028800 | Bacteria | 6333 |
| 165 | Ga0265762_1027651 | 3300030760 | Bacteria | 1065 |
| 166 | Ga0265762_1103350 | 3300030760 | Unclassified | 634 |
| 167 | Ga0265760_10141731 | 3300031090 | Bacteria | 783 |
| 168 | Ga0265327_10004065 | 3300031251 | Bacteria | 13254 |
| 169 | Ga0307509_10495630 | 3300031507 | Bacteria | 907 |
| 170 | Ga0307408_100388735 | 3300031548 | Bacteria | 1195 |
| 171 | Ga0307508_10258420 | 3300031616 | Unclassified | 1337 |
| 172 | Ga0265314_10019244 | 3300031711 | Bacteria | 5293 |
| 173 | Ga0307407_11001557 | 3300031903 | Bacteria | 646 |
| 174 | Ga0307510_10204621 | 3300033180 | Bacteria | 1504 |
| 175 | Ga0373936_0077520 | 3300035113 | Unclassified | 1379 |
| 176 | Ga0373954_0076670 | 3300035118 | Bacteria | 1594 |
| 177 | Ga0373937_0514590 | 3300036401 | Bacteria | 1137 |
| 178 | Ga0373925_0132890 | 3300037068 | Bacteria | 1942 |
| 179 | Ga0395898_0002975 | 3300037466 | Bacteria | 19261 |
| 180 | Ga0436364_1523198 | 3300037853 | Unclassified | 1364 |
| 181 | Ga0436365_0363133 | 3300039437 | Unclassified | 996 |
| 182 | Ga0439460_0044358 | 3300042461 | Bacteria | 1316 |
| 183 | Ga0466961_0071694 | 3300044693 | Bacteria | 2198 |
| 184 | Ga0466959_0033955 | 3300045049 | Bacteria | 3774 |
| 185 | Ga0495651_0250772 | 3300046462 | Bacteria | 1209 |
| 186 | Ga0495632_0120204 | 3300046519 | Bacteria | 1228 |
| 187 | Ga0495652_0156811 | 3300046529 | Bacteria | 1772 |
| 188 | Ga0495668_0480794 | 3300046616 | Bacteria | 684 |
| 189 | Ga0495684_0529782 | 3300047471 | Bacteria | 805 |
| 190 | Ga0496101_0033626 | 3300048904 | Bacteria | 3617 |
| 191 | Ga0496101_0161634 | 3300048904 | Unclassified | 1718 |
| 192 | Ga0496104_0008673 | 3300048907 | Bacteria | 9042 |
| 193 | Ga0496105_0003391 | 3300048908 | Bacteria | 11779 |
| 194 | Ga0496105_0007873 | 3300048908 | Bacteria | 8273 |
| 195 | Ga0496106_0287861 | 3300048909 | Bacteria | 1317 |
| 196 | Ga0496106_0340263 | 3300048909 | Unclassified | 1205 |
| 197 | Ga0496107_0321950 | 3300048910 | Bacteria | 1151 |
| 198 | Ga0496108_0004690 | 3300048911 | Bacteria | 11020 |
| 199 | Ga0496108_0510013 | 3300048911 | Bacteria | 1050 |
| 200 | Ga0496109_0003527 | 3300048912 | Bacteria | 13056 |
| 201 | Ga0496110_0005766 | 3300048913 | Bacteria | 9729 |
| 202 | Ga0496111_0019835 | 3300048914 | Bacteria | 4675 |
| 203 | Ga0496114_0075955 | 3300048917 | Bacteria | 2830 |
| 204 | Ga0496115_0004092 | 3300048918 | Bacteria | 10529 |
| 205 | Ga0496115_0493396 | 3300048918 | Bacteria | 985 |
| 206 | Ga0496115_0823560 | 3300048918 | Bacteria | 721 |
| 207 | Ga0501038_0608468 | 3300049574 | Bacteria | 826 |
| 208 | Ga0501039_0368253 | 3300049575 | Bacteria | 1129 |
| 209 | Ga0501040_0131793 | 3300049576 | Bacteria | 1758 |
| 210 | Ga0501041_0087734 | 3300049577 | Bacteria | 1920 |
| 211 | Ga0501042_0034967 | 3300049578 | Bacteria | 3565 |
| 212 | Ga0501046_0068875 | 3300049580 | Bacteria | 2754 |
| 213 | Ga0501068_0247976 | 3300049584 | Bacteria | 1134 |
| 214 | Ga0501071_0188318 | 3300049587 | Bacteria | 1547 |
| 215 | Ga0501072_0049162 | 3300049588 | Bacteria | 3320 |
| 216 | Ga0501072_0116737 | 3300049588 | Bacteria | 2126 |
| 217 | Ga0501076_0045496 | 3300049592 | Bacteria | 3465 |
| 218 | Ga0501077_0004175 | 3300049593 | Bacteria | 8727 |
| 219 | Ga0501079_0047164 | 3300049741 | Bacteria | 3324 |
| 220 | Ga0501080_0939079 | 3300049742 | Unclassified | 752 |
| 221 | Ga0501081_0000287 | 3300049743 | Bacteria | 26798 |
| 222 | Ga0501083_0568410 | 3300049744 | Bacteria | 738 |
| 223 | Ga0501045_0149932 | 3300049824 | Bacteria | 1735 |
| 224 | Ga0501045_0210861 | 3300049824 | Bacteria | 1447 |
| 225 | nmdc:mga09592_633740_c1 | 3300050508 | Bacteria | 914 |
| 226 | nmdc:mga08y16_308306_c1 | 3300050511 | Bacteria | 1630 |
| 227 | nmdc:mga0n895_271827_c1 | 3300050512 | Bacteria | 1719 |
| 228 | nmdc:mga08x19_95161_c1 | 3300050514 | Bacteria | 1970 |
| 229 | Ga0495601_0762332 | 3300053077 | Bacteria | 615 |
| 230 | Ga0500644_0016783 | 3300053088 | Bacteria | 2113 |
| 231 | Ga0500651_0061178 | 3300053093 | Unclassified | 2353 |
| 232 | Ga0500617_025349 | 3300053124 | Bacteria | 2634 |
| 233 | Ga0500658_0119999 | 3300053134 | Bacteria | 1165 |
| 234 | Ga0500622_0003625 | 3300053156 | Bacteria | 10146 |
| 235 | Ga0500637_0019938 | 3300053178 | Bacteria | 3624 |
| 236 | Ga0500637_0064044 | 3300053178 | Bacteria | 2109 |
| 237 | Ga0500637_0205987 | 3300053178 | Bacteria | 1118 |
| 238 | Ga0501084_0047872 | 3300054114 | Bacteria | 3580 |
| 239 | Ga0501082_0035018 | 3300060353 | Bacteria | 4327 |
| 240 | Ga0530510_0015782 | 3300061734 | Bacteria | 5340 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005343 | Ga0070687_100670855 | Ga0070687_1006708551 | 114 |
| 2 | 3300014326 | Ga0157380_12128089 | Ga0157380_121280891 | 118 |
| 3 | 3300005345 | Ga0070692_10275203 | Ga0070692_102752032 | 119 |
| 4 | 3300005614 | Ga0068856_101339457 | Ga0068856_1013394571 | 120 |
| 5 | 3300009101 | Ga0105247_10150346 | Ga0105247_101503462 | 121 |
| 6 | 3300048911 | Ga0496108_0510013 | Ga0496108_0510013_446_871 | 122 |
| 7 | 3300046529 | Ga0495652_0156811 | Ga0495652_0156811_693_1154 | 123 |
| 8 | 3300047471 | Ga0495684_0529782 | Ga0495684_0529782_127_588 | 123 |
| 9 | 3300005436 | Ga0070713_100146665 | Ga0070713_1001466652 | 124 |
| 10 | 3300005548 | Ga0070665_100005884 | Ga0070665_1000058842 | 124 |
| 11 | 3300025914 | Ga0207671_10369013 | Ga0207671_103690132 | 124 |
| 12 | 3300025928 | Ga0207700_10026838 | Ga0207700_100268384 | 124 |
| 13 | 3300028379 | Ga0268266_10001861 | Ga0268266_100018617 | 124 |
| 14 | 3300046462 | Ga0495651_0250772 | Ga0495651_0250772_571_1032 | 124 |
| 15 | 3300009092 | Ga0105250_10000014 | Ga0105250_100000145 | 126 |
| 16 | 3300014968 | Ga0157379_10000278 | Ga0157379_100002786 | 126 |
| 17 | 3300025711 | Ga0207696_1000087 | Ga0207696_10000875 | 126 |
| 18 | 3300005843 | Ga0068860_101382191 | Ga0068860_1013821912 | 127 |
| 19 | 3300028381 | Ga0268264_11749743 | Ga0268264_117497431 | 127 |
| 20 | 3300005536 | Ga0070697_100226425 | Ga0070697_1002264252 | 130 |
| 21 | 3300046519 | Ga0495632_0120204 | Ga0495632_0120204_67_516 | 130 |
| 22 | 3300046616 | Ga0495668_0480794 | Ga0495668_0480794_157_606 | 130 |
| 23 | 3300049574 | Ga0501038_0608468 | Ga0501038_0608468_156_650 | 131 |
| 24 | 3300049575 | Ga0501039_0368253 | Ga0501039_0368253_501_995 | 131 |
| 25 | 3300049576 | Ga0501040_0131793 | Ga0501040_0131793_790_1284 | 131 |
| 26 | 3300049577 | Ga0501041_0087734 | Ga0501041_0087734_667_1161 | 131 |
| 27 | 3300049578 | Ga0501042_0034967 | Ga0501042_0034967_1156_1650 | 131 |
| 28 | 3300049580 | Ga0501046_0068875 | Ga0501046_0068875_153_647 | 131 |
| 29 | 3300049584 | Ga0501068_0247976 | Ga0501068_0247976_575_1069 | 131 |
| 30 | 3300049587 | Ga0501071_0188318 | Ga0501071_0188318_46_540 | 131 |
| 31 | 3300049588 | Ga0501072_0049162 | Ga0501072_0049162_1296_1790 | 131 |
| 32 | 3300049592 | Ga0501076_0045496 | Ga0501076_0045496_664_1158 | 131 |
| 33 | 3300049593 | Ga0501077_0004175 | Ga0501077_0004175_4269_4763 | 131 |
| 34 | 3300049741 | Ga0501079_0047164 | Ga0501079_0047164_923_1417 | 131 |
| 35 | 3300049743 | Ga0501081_0000287 | Ga0501081_0000287_3551_4045 | 131 |
| 36 | 3300049824 | Ga0501045_0210861 | Ga0501045_0210861_929_1423 | 131 |
| 37 | 3300053178 | Ga0500637_0064044 | Ga0500637_0064044_1067_1516 | 131 |
| 38 | 3300053178 | Ga0500637_0205987 | Ga0500637_0205987_450_959 | 131 |
| 39 | 3300054114 | Ga0501084_0047872 | Ga0501084_0047872_1768_2262 | 131 |
| 40 | 3300060353 | Ga0501082_0035018 | Ga0501082_0035018_3540_4034 | 131 |
| 41 | 3300061734 | Ga0530510_0015782 | Ga0530510_0015782_809_1303 | 131 |
| 42 | 3300005439 | Ga0070711_100033476 | Ga0070711_1000334763 | 132 |
| 43 | 3300005563 | Ga0068855_101069903 | Ga0068855_1010699031 | 132 |
| 44 | 3300037068 | Ga0373925_0132890 | Ga0373925_0132890_1256_1744 | 132 |
| 45 | 3300006237 | Ga0097621_100562551 | Ga0097621_1005625512 | 133 |
| 46 | 3300009098 | Ga0105245_10095718 | Ga0105245_100957182 | 133 |
| 47 | 3300025927 | Ga0207687_10652373 | Ga0207687_106523731 | 133 |
| 48 | 3300035113 | Ga0373936_0077520 | Ga0373936_0077520_613_1098 | 133 |
| 49 | 3300053077 | Ga0495601_0762332 | Ga0495601_0762332_19_504 | 133 |
| 50 | 3300005842 | Ga0068858_100012153 | Ga0068858_1000121533 | 135 |
| 51 | 3300026035 | Ga0207703_10005491 | Ga0207703_100054913 | 135 |
| 52 | 3300035118 | Ga0373954_0076670 | Ga0373954_0076670_67_555 | 135 |
| 53 | 3300037466 | Ga0395898_0002975 | Ga0395898_0002975_10860_11372 | 135 |
| 54 | 3300005330 | Ga0070690_100028902 | Ga0070690_1000289022 | 136 |
| 55 | 3300005353 | Ga0070669_100383818 | Ga0070669_1003838182 | 136 |
| 56 | 3300005439 | Ga0070711_100038138 | Ga0070711_1000381383 | 136 |
| 57 | 3300005440 | Ga0070705_100036986 | Ga0070705_1000369862 | 136 |
| 58 | 3300005544 | Ga0070686_100012129 | Ga0070686_1000121293 | 136 |
| 59 | 3300005548 | Ga0070665_100044467 | Ga0070665_1000444675 | 136 |
| 60 | 3300005615 | Ga0070702_100015827 | Ga0070702_1000158273 | 136 |
| 61 | 3300005617 | Ga0068859_100029343 | Ga0068859_1000293433 | 136 |
| 62 | 3300005618 | Ga0068864_100058408 | Ga0068864_1000584082 | 136 |
| 63 | 3300005618 | Ga0068864_100110555 | Ga0068864_1001105552 | 136 |
| 64 | 3300005719 | Ga0068861_100032728 | Ga0068861_1000327283 | 136 |
| 65 | 3300005843 | Ga0068860_100004120 | Ga0068860_1000041204 | 136 |
| 66 | 3300005843 | Ga0068860_100535553 | Ga0068860_1005355532 | 136 |
| 67 | 3300005844 | Ga0068862_100017197 | Ga0068862_1000171973 | 136 |
| 68 | 3300006175 | Ga0070712_100499625 | Ga0070712_1004996252 | 136 |
| 69 | 3300006237 | Ga0097621_100036088 | Ga0097621_1000360883 | 136 |
| 70 | 3300006931 | Ga0097620_100029342 | Ga0097620_1000293423 | 136 |
| 71 | 3300009093 | Ga0105240_10027407 | Ga0105240_100274074 | 136 |
| 72 | 3300009545 | Ga0105237_10706580 | Ga0105237_107065802 | 136 |
| 73 | 3300025913 | Ga0207695_10673005 | Ga0207695_106730052 | 136 |
| 74 | 3300025915 | Ga0207693_10407983 | Ga0207693_104079832 | 136 |
| 75 | 3300025916 | Ga0207663_10352653 | Ga0207663_103526532 | 136 |
| 76 | 3300025918 | Ga0207662_10556895 | Ga0207662_105568952 | 136 |
| 77 | 3300025923 | Ga0207681_10859309 | Ga0207681_108593092 | 136 |
| 78 | 3300026035 | Ga0207703_10006054 | Ga0207703_100060545 | 136 |
| 79 | 3300026095 | Ga0207676_10079338 | Ga0207676_100793383 | 136 |
| 80 | 3300026118 | Ga0207675_100195654 | Ga0207675_1001956542 | 136 |
| 81 | 3300028379 | Ga0268266_10017864 | Ga0268266_100178642 | 136 |
| 82 | 3300028380 | Ga0268265_10026239 | Ga0268265_100262393 | 136 |
| 83 | 3300028381 | Ga0268264_10132305 | Ga0268264_101323053 | 136 |
| 84 | 3300033180 | Ga0307510_10204621 | Ga0307510_102046212 | 136 |
| 85 | 3300048904 | Ga0496101_0033626 | Ga0496101_0033626_2517_3002 | 136 |
| 86 | 3300048904 | Ga0496101_0161634 | Ga0496101_0161634_852_1286 | 136 |
| 87 | 3300048907 | Ga0496104_0008673 | Ga0496104_0008673_4481_4915 | 136 |
| 88 | 3300048908 | Ga0496105_0003391 | Ga0496105_0003391_7155_7589 | 136 |
| 89 | 3300048908 | Ga0496105_0007873 | Ga0496105_0007873_5991_6476 | 136 |
| 90 | 3300048909 | Ga0496106_0287861 | Ga0496106_0287861_833_1267 | 136 |
| 91 | 3300048909 | Ga0496106_0340263 | Ga0496106_0340263_304_789 | 136 |
| 92 | 3300048910 | Ga0496107_0321950 | Ga0496107_0321950_625_1059 | 136 |
| 93 | 3300048911 | Ga0496108_0004690 | Ga0496108_0004690_4482_4916 | 136 |
| 94 | 3300048912 | Ga0496109_0003527 | Ga0496109_0003527_4901_5335 | 136 |
| 95 | 3300048913 | Ga0496110_0005766 | Ga0496110_0005766_9089_9523 | 136 |
| 96 | 3300048914 | Ga0496111_0019835 | Ga0496111_0019835_761_1195 | 136 |
| 97 | 3300048917 | Ga0496114_0075955 | Ga0496114_0075955_1675_2160 | 136 |
| 98 | 3300048918 | Ga0496115_0004092 | Ga0496115_0004092_9502_9987 | 136 |
| 99 | 3300005336 | Ga0070680_100143081 | Ga0070680_1001430812 | 137 |
| 100 | 3300005458 | Ga0070681_10144445 | Ga0070681_101444453 | 137 |
| 101 | 3300005530 | Ga0070679_100041299 | Ga0070679_1000412994 | 137 |
| 102 | 3300005535 | Ga0070684_100037398 | Ga0070684_1000373982 | 137 |
| 103 | 3300005548 | Ga0070665_100036879 | Ga0070665_1000368792 | 137 |
| 104 | 3300005548 | Ga0070665_100086382 | Ga0070665_1000863822 | 137 |
| 105 | 3300005563 | Ga0068855_100004606 | Ga0068855_10000460612 | 137 |
| 106 | 3300009093 | Ga0105240_10016790 | Ga0105240_100167904 | 137 |
| 107 | 3300009093 | Ga0105240_10753119 | Ga0105240_107531192 | 137 |
| 108 | 3300009545 | Ga0105237_10057995 | Ga0105237_100579953 | 137 |
| 109 | 3300009551 | Ga0105238_10045883 | Ga0105238_100458833 | 137 |
| 110 | 3300010375 | Ga0105239_11156784 | Ga0105239_111567842 | 137 |
| 111 | 3300013104 | Ga0157370_10962325 | Ga0157370_109623252 | 137 |
| 112 | 3300013307 | Ga0157372_10329082 | Ga0157372_103290823 | 137 |
| 113 | 3300025912 | Ga0207707_10266043 | Ga0207707_102660432 | 137 |
| 114 | 3300025913 | Ga0207695_10022830 | Ga0207695_100228304 | 137 |
| 115 | 3300025917 | Ga0207660_10180711 | Ga0207660_101807112 | 137 |
| 116 | 3300025921 | Ga0207652_10275921 | Ga0207652_102759212 | 137 |
| 117 | 3300025949 | Ga0207667_10001737 | Ga0207667_100017373 | 137 |
| 118 | 3300028379 | Ga0268266_10020712 | Ga0268266_100207124 | 137 |
| 119 | 3300028379 | Ga0268266_10043416 | Ga0268266_100434163 | 137 |
| 120 | 3300028800 | Ga0265338_10023510 | Ga0265338_100235104 | 137 |
| 121 | 3300036401 | Ga0373937_0514590 | Ga0373937_0514590_643_1107 | 137 |
| 122 | 3300053124 | Ga0500617_025349 | Ga0500617_025349_672_1130 | 137 |
| 123 | 3300006914 | Ga0075436_100159456 | Ga0075436_1001594562 | 138 |
| 124 | 3300050512 | nmdc:mga0n895_271827_c1 | nmdc:mga0n895_271827_c1_284_772 | 138 |
| 125 | 3300050514 | nmdc:mga08x19_95161_c1 | nmdc:mga08x19_95161_c1_975_1463 | 138 |
| 126 | 3300053134 | Ga0500658_0119999 | Ga0500658_0119999_196_663 | 138 |
| 127 | 3300005445 | Ga0070708_100097444 | Ga0070708_1000974442 | 139 |
| 128 | 3300005468 | Ga0070707_100321188 | Ga0070707_1003211881 | 139 |
| 129 | 3300025922 | Ga0207646_10032731 | Ga0207646_100327312 | 139 |
| 130 | 3300031903 | Ga0307407_11001557 | Ga0307407_110015571 | 139 |
| 131 | 3300005719 | Ga0068861_100106702 | Ga0068861_1001067023 | 140 |
| 132 | 3300009553 | Ga0105249_10046698 | Ga0105249_100466982 | 140 |
| 133 | 3300013307 | Ga0157372_12575520 | Ga0157372_125755201 | 140 |
| 134 | 3300025961 | Ga0207712_10025287 | Ga0207712_100252872 | 140 |
| 135 | 3300026118 | Ga0207675_100111950 | Ga0207675_1001119503 | 140 |
| 136 | 3300005289 | Ga0065704_10152796 | Ga0065704_101527962 | 141 |
| 137 | 3300005340 | Ga0070689_100031042 | Ga0070689_1000310422 | 141 |
| 138 | 3300005577 | Ga0068857_101356194 | Ga0068857_1013561941 | 141 |
| 139 | 3300005844 | Ga0068862_100128698 | Ga0068862_1001286982 | 141 |
| 140 | 3300014326 | Ga0157380_10008495 | Ga0157380_100084953 | 141 |
| 141 | 3300028380 | Ga0268265_10122495 | Ga0268265_101224952 | 141 |
| 142 | 3300005334 | Ga0068869_100056991 | Ga0068869_1000569913 | 142 |
| 143 | 3300005438 | Ga0070701_10029324 | Ga0070701_100293242 | 142 |
| 144 | 3300005441 | Ga0070700_100214837 | Ga0070700_1002148372 | 142 |
| 145 | 3300005466 | Ga0070685_10107369 | Ga0070685_101073692 | 142 |
| 146 | 3300005548 | Ga0070665_100003052 | Ga0070665_10000305211 | 142 |
| 147 | 3300005617 | Ga0068859_100278619 | Ga0068859_1002786192 | 142 |
| 148 | 3300005843 | Ga0068860_101280192 | Ga0068860_1012801922 | 142 |
| 149 | 3300005844 | Ga0068862_100182960 | Ga0068862_1001829602 | 142 |
| 150 | 3300006931 | Ga0097620_100278620 | Ga0097620_1002786202 | 142 |
| 151 | 3300025938 | Ga0207704_10333891 | Ga0207704_103338911 | 142 |
| 152 | 3300025942 | Ga0207689_10165079 | Ga0207689_101650792 | 142 |
| 153 | 3300026075 | Ga0207708_10540464 | Ga0207708_105404642 | 142 |
| 154 | 3300028379 | Ga0268266_10149702 | Ga0268266_101497022 | 142 |
| 155 | 3300028380 | Ga0268265_10528366 | Ga0268265_105283662 | 142 |
| 156 | 3300039437 | Ga0436365_0363133 | Ga0436365_0363133_478_936 | 142 |
| 157 | 3300028379 | Ga0268266_10521790 | Ga0268266_105217902 | 143 |
| 158 | 3300048918 | Ga0496115_0493396 | Ga0496115_0493396_207_671 | 143 |
| 159 | 3300048918 | Ga0496115_0823560 | Ga0496115_0823560_168_659 | 143 |
| 160 | 3300005937 | Ga0081455_10001456 | Ga0081455_1000145635 | 144 |
| 161 | 3300026078 | Ga0207702_11366420 | Ga0207702_113664202 | 144 |
| 162 | 3300031616 | Ga0307508_10258420 | Ga0307508_102584202 | 144 |
| 163 | 3300053178 | Ga0500637_0019938 | Ga0500637_0019938_3101_3538 | 144 |
| 164 | 3300005616 | Ga0068852_101480078 | Ga0068852_1014800781 | 145 |
| 165 | 3300028800 | Ga0265338_10008206 | Ga0265338_1000820612 | 145 |
| 166 | 3300030760 | Ga0265762_1103350 | Ga0265762_11033501 | 145 |
| 167 | 3300031251 | Ga0265327_10004065 | Ga0265327_1000406513 | 145 |
| 168 | 3300031711 | Ga0265314_10019244 | Ga0265314_100192443 | 145 |
| 169 | 3300005719 | Ga0068861_100409657 | Ga0068861_1004096572 | 146 |
| 170 | 3300026118 | Ga0207675_100460892 | Ga0207675_1004608921 | 146 |
| 171 | 3300031548 | Ga0307408_100388735 | Ga0307408_1003887351 | 146 |
| 172 | 3300005335 | Ga0070666_10001463 | Ga0070666_1000146311 | 147 |
| 173 | 3300005364 | Ga0070673_100269703 | Ga0070673_1002697032 | 147 |
| 174 | 3300005367 | Ga0070667_100030761 | Ga0070667_1000307614 | 147 |
| 175 | 3300005547 | Ga0070693_100821943 | Ga0070693_1008219431 | 147 |
| 176 | 3300005616 | Ga0068852_100310307 | Ga0068852_1003103072 | 147 |
| 177 | 3300005617 | Ga0068859_100585461 | Ga0068859_1005854611 | 147 |
| 178 | 3300005834 | Ga0068851_10286647 | Ga0068851_102866471 | 147 |
| 179 | 3300005842 | Ga0068858_100247609 | Ga0068858_1002476092 | 147 |
| 180 | 3300006358 | Ga0068871_100214098 | Ga0068871_1002140982 | 147 |
| 181 | 3300006931 | Ga0097620_100585422 | Ga0097620_1005854221 | 147 |
| 182 | 3300009098 | Ga0105245_10020195 | Ga0105245_100201953 | 147 |
| 183 | 3300009176 | Ga0105242_10044259 | Ga0105242_100442592 | 147 |
| 184 | 3300009177 | Ga0105248_10006277 | Ga0105248_100062779 | 147 |
| 185 | 3300009551 | Ga0105238_10080934 | Ga0105238_100809342 | 147 |
| 186 | 3300013296 | Ga0157374_10077160 | Ga0157374_100771603 | 147 |
| 187 | 3300013306 | Ga0163162_10081169 | Ga0163162_100811692 | 147 |
| 188 | 3300013306 | Ga0163162_11515644 | Ga0163162_115156442 | 147 |
| 189 | 3300013308 | Ga0157375_10002928 | Ga0157375_1000292812 | 147 |
| 190 | 3300014325 | Ga0163163_10008759 | Ga0163163_100087593 | 147 |
| 191 | 3300014968 | Ga0157379_10001605 | Ga0157379_100016053 | 147 |
| 192 | 3300014969 | Ga0157376_10000910 | Ga0157376_1000091015 | 147 |
| 193 | 3300025927 | Ga0207687_10161564 | Ga0207687_101615642 | 147 |
| 194 | 3300025934 | Ga0207686_10135727 | Ga0207686_101357272 | 147 |
| 195 | 3300025938 | Ga0207704_10209545 | Ga0207704_102095452 | 147 |
| 196 | 3300025960 | Ga0207651_10356025 | Ga0207651_103560252 | 147 |
| 197 | 3300025986 | Ga0207658_10242544 | Ga0207658_102425442 | 147 |
| 198 | 3300026142 | Ga0207698_10238319 | Ga0207698_102383192 | 147 |
| 199 | 3300037853 | Ga0436364_1523198 | Ga0436364_1523198_156_617 | 147 |
| 200 | 3300049588 | Ga0501072_0116737 | Ga0501072_0116737_154_627 | 147 |
| 201 | 3300049742 | Ga0501080_0939079 | Ga0501080_0939079_32_505 | 147 |
| 202 | 3300049744 | Ga0501083_0568410 | Ga0501083_0568410_223_696 | 147 |
| 203 | 3300049824 | Ga0501045_0149932 | Ga0501045_0149932_201_674 | 147 |
| 204 | 3300053088 | Ga0500644_0016783 | Ga0500644_0016783_247_729 | 147 |
| 205 | 3300005617 | Ga0068859_100396864 | Ga0068859_1003968642 | 148 |
| 206 | 3300006931 | Ga0097620_100396836 | Ga0097620_1003968362 | 148 |
| 207 | 3300014325 | Ga0163163_10755935 | Ga0163163_107559352 | 148 |
| 208 | 3300025913 | Ga0207695_10514082 | Ga0207695_105140822 | 148 |
| 209 | 3300025914 | Ga0207671_10991550 | Ga0207671_109915502 | 148 |
| 210 | 3300031090 | Ga0265760_10141731 | Ga0265760_101417312 | 148 |
| 211 | 3300005330 | Ga0070690_100070361 | Ga0070690_1000703612 | 149 |
| 212 | 3300005331 | Ga0070670_100037750 | Ga0070670_1000377505 | 149 |
| 213 | 3300005343 | Ga0070687_100842909 | Ga0070687_1008429091 | 149 |
| 214 | 3300005366 | Ga0070659_101088620 | Ga0070659_1010886202 | 149 |
| 215 | 3300005441 | Ga0070700_100600659 | Ga0070700_1006006592 | 149 |
| 216 | 3300005543 | Ga0070672_100590164 | Ga0070672_1005901642 | 149 |
| 217 | 3300005617 | Ga0068859_100357745 | Ga0068859_1003577452 | 149 |
| 218 | 3300006931 | Ga0097620_100357754 | Ga0097620_1003577542 | 149 |
| 219 | 3300009093 | Ga0105240_10026583 | Ga0105240_100265834 | 149 |
| 220 | 3300014968 | Ga0157379_10897694 | Ga0157379_108976941 | 149 |
| 221 | 3300025918 | Ga0207662_10144219 | Ga0207662_101442192 | 149 |
| 222 | 3300025925 | Ga0207650_10380551 | Ga0207650_103805512 | 149 |
| 223 | 3300026118 | Ga0207675_100101080 | Ga0207675_1001010802 | 149 |
| 224 | iso_pu_bacteria | 2896253425 | 2896255828 | 149 |
| 225 | 3300006844 | Ga0075428_100008172 | Ga0075428_1000081728 | 150 |
| 226 | 3300006847 | Ga0075431_100803803 | Ga0075431_1008038032 | 150 |
| 227 | 3300006880 | Ga0075429_100646922 | Ga0075429_1006469222 | 150 |
| 228 | 3300009094 | Ga0111539_10193464 | Ga0111539_101934643 | 150 |
| 229 | 3300028380 | Ga0268265_11051867 | Ga0268265_110518672 | 150 |
| 230 | 3300042461 | Ga0439460_0044358 | Ga0439460_0044358_400_870 | 150 |
| 231 | 3300045049 | Ga0466959_0033955 | Ga0466959_0033955_259_903 | 150 |
| 232 | 3300050508 | nmdc:mga09592_633740_c1 | nmdc:mga09592_633740_c1_102_572 | 150 |
| 233 | 3300050511 | nmdc:mga08y16_308306_c1 | nmdc:mga08y16_308306_c1_236_706 | 150 |
| 234 | 3300044693 | Ga0466961_0071694 | Ga0466961_0071694_1247_1876 | 152 |
| 235 | 3300009545 | Ga0105237_10151566 | Ga0105237_101515662 | 153 |
| 236 | 3300026078 | Ga0207702_11831162 | Ga0207702_118311621 | 153 |
| 237 | 3300053093 | Ga0500651_0061178 | Ga0500651_0061178_1004_1522 | 157 |
| 238 | 3300053156 | Ga0500622_0003625 | Ga0500622_0003625_8645_9163 | 157 |
| 239 | 3300030760 | Ga0265762_1027651 | Ga0265762_10276512 | 158 |
| 240 | 3300031507 | Ga0307509_10495630 | Ga0307509_104956302 | 161 |
| 241 | 3300003322 | rootL2_10144617 | rootL2_101446172 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hr7-assembly1.cif.gz_B | crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli | 0.9913 | 90 | 164 |
| 2ejg-assembly1.cif.gz_C | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9366 | 90 | 164 |
| 5gua-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant | 0.9347 | 89 | 164 |
| 1dd2-assembly1.cif.gz_A | biotin carboxyl carrier domain of transcarboxylase (tc 1.3s) | 0.9208 | 91 | 164 |
| 4hr7-assembly1.cif.gz_B | crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli | 0.9185 | 90 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LWR8_198_274_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9815 | 90 | 162 | 2.40.50.100 |
| af_Q2FXX0_70_148_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9605 | 89 | 164 | 2.40.50.100 |
| af_Q93W03_192_271_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9483 | 88 | 164 | 2.40.50.100 |
| af_Q58628_489_566_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9412 | 91 | 162 | 2.40.50.100 |
| af_P9WPQ1_4_71_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9356 | 91 | 164 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1HF19-F1-model_v4 | deleted | 0.9923 | 89 | 166 |
|
| AF-A0A399F3B0-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9908 | 90 | 167 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A3N5N3S2-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9883 | 92 | 167 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A519Y5H1-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9852 | 89 | 167 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A357FV41-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9843 | 89 | 167 |
GO:0003989
GO:0006633 GO:0009317 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar