F354171

General Info

Members Datasets Scaffolds Average Seq Length
241 168 240 146

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0061178|Ga0500651_0061178_1004_1522
Length 172
Sequence MRLVEQSSFDELTLELNGLKLTLRRGAVAEQSNGGFAFEQTAGVGAPAPNSAIGTIAAPAALRAANSLTGSACERAMASSSRAVPLAGADPNVQNVISPMLGTFYRAPKPGAPPFVEIGSIVEEDTIVALIEVMKLMNSVRAGVRGTVSEILARDGALVEYGETVLRVRKTS

Samples

Sample ID Description Type Environment
1 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.24
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 7.05
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 2.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10144617 3300003322 Unclassified 1237
2 Ga0065704_10152796 3300005289 Unclassified 1415
3 Ga0070690_100028902 3300005330 Bacteria 3436
4 Ga0070690_100070361 3300005330 Bacteria 2272
5 Ga0070670_100037750 3300005331 Bacteria 4155
6 Ga0068869_100056991 3300005334 Bacteria 2851
7 Ga0070666_10001463 3300005335 Bacteria 14338
8 Ga0070680_100143081 3300005336 Bacteria 2005
9 Ga0070689_100031042 3300005340 Bacteria 4059
10 Ga0070687_100670855 3300005343 Bacteria 721
11 Ga0070687_100842909 3300005343 Unclassified 653
12 Ga0070692_10275203 3300005345 Bacteria 1018
13 Ga0070669_100383818 3300005353 Bacteria 1146
14 Ga0070673_100269703 3300005364 Bacteria 1489
15 Ga0070659_101088620 3300005366 Bacteria 704
16 Ga0070667_100030761 3300005367 Bacteria 4477
17 Ga0070713_100146665 3300005436 Bacteria 2095
18 Ga0070701_10029324 3300005438 Bacteria 2713
19 Ga0070711_100033476 3300005439 Bacteria 3422
20 Ga0070711_100038138 3300005439 Bacteria 3228
21 Ga0070705_100036986 3300005440 Bacteria 2750
22 Ga0070700_100214837 3300005441 Bacteria 1359
23 Ga0070700_100600659 3300005441 Bacteria 862
24 Ga0070708_100097444 3300005445 Bacteria 2688
25 Ga0070681_10144445 3300005458 Unclassified 2309
26 Ga0070685_10107369 3300005466 Bacteria 1714
27 Ga0070707_100321188 3300005468 Bacteria 1504
28 Ga0070679_100041299 3300005530 Bacteria 4590
29 Ga0070684_100037398 3300005535 Bacteria 4163
30 Ga0070697_100226425 3300005536 Bacteria 1594
31 Ga0070672_100590164 3300005543 Bacteria 967
32 Ga0070686_100012129 3300005544 Bacteria 4903
33 Ga0070693_100821943 3300005547 Bacteria 690
34 Ga0070665_100003052 3300005548 Bacteria 18032
35 Ga0070665_100005884 3300005548 Bacteria 12563
36 Ga0070665_100036879 3300005548 Bacteria 4916
37 Ga0070665_100044467 3300005548 Bacteria 4460
38 Ga0070665_100086382 3300005548 Bacteria 3142
39 Ga0068855_100004606 3300005563 Bacteria 16832
40 Ga0068855_101069903 3300005563 Bacteria 845
41 Ga0068857_101356194 3300005577 Bacteria 691
42 Ga0068856_101339457 3300005614 Bacteria 731
43 Ga0070702_100015827 3300005615 Bacteria 3858
44 Ga0068852_100310307 3300005616 Bacteria 1529
45 Ga0068852_101480078 3300005616 Bacteria 701
46 Ga0068859_100029343 3300005617 Bacteria 5520
47 Ga0068859_100278619 3300005617 Bacteria 1765
48 Ga0068859_100357745 3300005617 Bacteria 1555
49 Ga0068859_100396864 3300005617 Bacteria 1475
50 Ga0068859_100585461 3300005617 Bacteria 1209
51 Ga0068864_100058408 3300005618 Bacteria 3334
52 Ga0068864_100110555 3300005618 Bacteria 2447
53 Ga0068861_100032728 3300005719 Bacteria 3830
54 Ga0068861_100106702 3300005719 Bacteria 2238
55 Ga0068861_100409657 3300005719 Bacteria 1205
56 Ga0068851_10286647 3300005834 Bacteria 943
57 Ga0068858_100012153 3300005842 Bacteria 8119
58 Ga0068858_100247609 3300005842 Bacteria 1692
59 Ga0068860_100004120 3300005843 Bacteria 14895
60 Ga0068860_100535553 3300005843 Bacteria 1172
61 Ga0068860_101280192 3300005843 Bacteria 754
62 Ga0068860_101382191 3300005843 Bacteria 725
63 Ga0068862_100017197 3300005844 Bacteria 6018
64 Ga0068862_100128698 3300005844 Bacteria 2238
65 Ga0068862_100182960 3300005844 Bacteria 1882
66 Ga0081455_10001456 3300005937 Bacteria 29298
67 Ga0070712_100499625 3300006175 Unclassified 1019
68 Ga0097621_100036088 3300006237 Bacteria 3953
69 Ga0097621_100562551 3300006237 Bacteria 1039
70 Ga0068871_100214098 3300006358 Bacteria 1667
71 Ga0075428_100008172 3300006844 Bacteria 11611
72 Ga0075431_100803803 3300006847 Bacteria 913
73 Ga0075429_100646922 3300006880 Bacteria 926
74 Ga0075436_100159456 3300006914 Bacteria 1590
75 Ga0097620_100029342 3300006931 Bacteria 5520
76 Ga0097620_100278620 3300006931 Bacteria 1765
77 Ga0097620_100357754 3300006931 Bacteria 1555
78 Ga0097620_100396836 3300006931 Bacteria 1475
79 Ga0097620_100585422 3300006931 Bacteria 1209
80 Ga0105250_10000014 3300009092 Bacteria 268458
81 Ga0105240_10016790 3300009093 Bacteria 9900
82 Ga0105240_10026583 3300009093 Bacteria 7594
83 Ga0105240_10027407 3300009093 Bacteria 7458
84 Ga0105240_10753119 3300009093 Bacteria 1059
85 Ga0111539_10193464 3300009094 Bacteria 2373
86 Ga0105245_10020195 3300009098 Bacteria 5839
87 Ga0105245_10095718 3300009098 Bacteria 2739
88 Ga0105247_10150346 3300009101 Bacteria 1534
89 Ga0105242_10044259 3300009176 Bacteria 3605
90 Ga0105248_10006277 3300009177 Bacteria 13037
91 Ga0105237_10057995 3300009545 Bacteria 3875
92 Ga0105237_10151566 3300009545 Bacteria 2315
93 Ga0105237_10706580 3300009545 Bacteria 1015
94 Ga0105238_10045883 3300009551 Bacteria 4414
95 Ga0105238_10080934 3300009551 Bacteria 3237
96 Ga0105249_10046698 3300009553 Bacteria 3942
97 Ga0105239_11156784 3300010375 Bacteria 891
98 Ga0157370_10962325 3300013104 Unclassified 774
99 Ga0157374_10077160 3300013296 Bacteria 3152
100 Ga0163162_10081169 3300013306 Bacteria 3313
101 Ga0163162_11515644 3300013306 Bacteria 764
102 Ga0157372_10329082 3300013307 Bacteria 1779
103 Ga0157372_12575520 3300013307 Bacteria 584
104 Ga0157375_10002928 3300013308 Bacteria 14809
105 Ga0163163_10008759 3300014325 Bacteria 9004
106 Ga0163163_10755935 3300014325 Bacteria 1035
107 Ga0157380_10008495 3300014326 Bacteria 7336
108 Ga0157380_12128089 3300014326 Bacteria 624
109 Ga0157379_10000278 3300014968 Bacteria 40420
110 Ga0157379_10001605 3300014968 Bacteria 18651
111 Ga0157379_10897694 3300014968 Unclassified 840
112 Ga0157376_10000910 3300014969 Bacteria 19232
113 Ga0207696_1000087 3300025711 Bacteria 194367
114 Ga0207707_10266043 3300025912 Bacteria 1487
115 Ga0207695_10022830 3300025913 Bacteria 7088
116 Ga0207695_10514082 3300025913 Bacteria 1079
117 Ga0207695_10673005 3300025913 Unclassified 916
118 Ga0207671_10369013 3300025914 Bacteria 1140
119 Ga0207671_10991550 3300025914 Unclassified 662
120 Ga0207693_10407983 3300025915 Unclassified 1062
121 Ga0207663_10352653 3300025916 Unclassified 1114
122 Ga0207660_10180711 3300025917 Bacteria 1638
123 Ga0207662_10144219 3300025918 Bacteria 1510
124 Ga0207662_10556895 3300025918 Bacteria 794
125 Ga0207652_10275921 3300025921 Bacteria 1516
126 Ga0207646_10032731 3300025922 Bacteria 4704
127 Ga0207681_10859309 3300025923 Bacteria 759
128 Ga0207650_10380551 3300025925 Bacteria 1165
129 Ga0207687_10161564 3300025927 Bacteria 1720
130 Ga0207687_10652373 3300025927 Unclassified 890
131 Ga0207700_10026838 3300025928 Bacteria 4023
132 Ga0207686_10135727 3300025934 Unclassified 1693
133 Ga0207704_10209545 3300025938 Bacteria 1433
134 Ga0207704_10333891 3300025938 Bacteria 1174
135 Ga0207689_10165079 3300025942 Bacteria 1825
136 Ga0207667_10001737 3300025949 Bacteria 27400
137 Ga0207651_10356025 3300025960 Bacteria 1234
138 Ga0207712_10025287 3300025961 Bacteria 3944
139 Ga0207658_10242544 3300025986 Bacteria 1527
140 Ga0207703_10005491 3300026035 Bacteria 10191
141 Ga0207703_10006054 3300026035 Bacteria 9674
142 Ga0207708_10540464 3300026075 Bacteria 982
143 Ga0207702_11366420 3300026078 Bacteria 702
144 Ga0207702_11831162 3300026078 Unclassified 599
145 Ga0207676_10079338 3300026095 Bacteria 2662
146 Ga0207675_100101080 3300026118 Bacteria 2716
147 Ga0207675_100111950 3300026118 Bacteria 2576
148 Ga0207675_100195654 3300026118 Bacteria 1940
149 Ga0207675_100460892 3300026118 Bacteria 1261
150 Ga0207698_10238319 3300026142 Bacteria 1656
151 Ga0268266_10001861 3300028379 Bacteria 23842
152 Ga0268266_10017864 3300028379 Bacteria 6044
153 Ga0268266_10020712 3300028379 Bacteria 5605
154 Ga0268266_10043416 3300028379 Bacteria 3842
155 Ga0268266_10149702 3300028379 Bacteria 2102
156 Ga0268266_10521790 3300028379 Bacteria 1136
157 Ga0268265_10026239 3300028380 Bacteria 4143
158 Ga0268265_10122495 3300028380 Bacteria 2145
159 Ga0268265_10528366 3300028380 Bacteria 1116
160 Ga0268265_11051867 3300028380 Unclassified 806
161 Ga0268264_10132305 3300028381 Unclassified 2213
162 Ga0268264_11749743 3300028381 Bacteria 632
163 Ga0265338_10008206 3300028800 Bacteria 12725
164 Ga0265338_10023510 3300028800 Bacteria 6333
165 Ga0265762_1027651 3300030760 Bacteria 1065
166 Ga0265762_1103350 3300030760 Unclassified 634
167 Ga0265760_10141731 3300031090 Bacteria 783
168 Ga0265327_10004065 3300031251 Bacteria 13254
169 Ga0307509_10495630 3300031507 Bacteria 907
170 Ga0307408_100388735 3300031548 Bacteria 1195
171 Ga0307508_10258420 3300031616 Unclassified 1337
172 Ga0265314_10019244 3300031711 Bacteria 5293
173 Ga0307407_11001557 3300031903 Bacteria 646
174 Ga0307510_10204621 3300033180 Bacteria 1504
175 Ga0373936_0077520 3300035113 Unclassified 1379
176 Ga0373954_0076670 3300035118 Bacteria 1594
177 Ga0373937_0514590 3300036401 Bacteria 1137
178 Ga0373925_0132890 3300037068 Bacteria 1942
179 Ga0395898_0002975 3300037466 Bacteria 19261
180 Ga0436364_1523198 3300037853 Unclassified 1364
181 Ga0436365_0363133 3300039437 Unclassified 996
182 Ga0439460_0044358 3300042461 Bacteria 1316
183 Ga0466961_0071694 3300044693 Bacteria 2198
184 Ga0466959_0033955 3300045049 Bacteria 3774
185 Ga0495651_0250772 3300046462 Bacteria 1209
186 Ga0495632_0120204 3300046519 Bacteria 1228
187 Ga0495652_0156811 3300046529 Bacteria 1772
188 Ga0495668_0480794 3300046616 Bacteria 684
189 Ga0495684_0529782 3300047471 Bacteria 805
190 Ga0496101_0033626 3300048904 Bacteria 3617
191 Ga0496101_0161634 3300048904 Unclassified 1718
192 Ga0496104_0008673 3300048907 Bacteria 9042
193 Ga0496105_0003391 3300048908 Bacteria 11779
194 Ga0496105_0007873 3300048908 Bacteria 8273
195 Ga0496106_0287861 3300048909 Bacteria 1317
196 Ga0496106_0340263 3300048909 Unclassified 1205
197 Ga0496107_0321950 3300048910 Bacteria 1151
198 Ga0496108_0004690 3300048911 Bacteria 11020
199 Ga0496108_0510013 3300048911 Bacteria 1050
200 Ga0496109_0003527 3300048912 Bacteria 13056
201 Ga0496110_0005766 3300048913 Bacteria 9729
202 Ga0496111_0019835 3300048914 Bacteria 4675
203 Ga0496114_0075955 3300048917 Bacteria 2830
204 Ga0496115_0004092 3300048918 Bacteria 10529
205 Ga0496115_0493396 3300048918 Bacteria 985
206 Ga0496115_0823560 3300048918 Bacteria 721
207 Ga0501038_0608468 3300049574 Bacteria 826
208 Ga0501039_0368253 3300049575 Bacteria 1129
209 Ga0501040_0131793 3300049576 Bacteria 1758
210 Ga0501041_0087734 3300049577 Bacteria 1920
211 Ga0501042_0034967 3300049578 Bacteria 3565
212 Ga0501046_0068875 3300049580 Bacteria 2754
213 Ga0501068_0247976 3300049584 Bacteria 1134
214 Ga0501071_0188318 3300049587 Bacteria 1547
215 Ga0501072_0049162 3300049588 Bacteria 3320
216 Ga0501072_0116737 3300049588 Bacteria 2126
217 Ga0501076_0045496 3300049592 Bacteria 3465
218 Ga0501077_0004175 3300049593 Bacteria 8727
219 Ga0501079_0047164 3300049741 Bacteria 3324
220 Ga0501080_0939079 3300049742 Unclassified 752
221 Ga0501081_0000287 3300049743 Bacteria 26798
222 Ga0501083_0568410 3300049744 Bacteria 738
223 Ga0501045_0149932 3300049824 Bacteria 1735
224 Ga0501045_0210861 3300049824 Bacteria 1447
225 nmdc:mga09592_633740_c1 3300050508 Bacteria 914
226 nmdc:mga08y16_308306_c1 3300050511 Bacteria 1630
227 nmdc:mga0n895_271827_c1 3300050512 Bacteria 1719
228 nmdc:mga08x19_95161_c1 3300050514 Bacteria 1970
229 Ga0495601_0762332 3300053077 Bacteria 615
230 Ga0500644_0016783 3300053088 Bacteria 2113
231 Ga0500651_0061178 3300053093 Unclassified 2353
232 Ga0500617_025349 3300053124 Bacteria 2634
233 Ga0500658_0119999 3300053134 Bacteria 1165
234 Ga0500622_0003625 3300053156 Bacteria 10146
235 Ga0500637_0019938 3300053178 Bacteria 3624
236 Ga0500637_0064044 3300053178 Bacteria 2109
237 Ga0500637_0205987 3300053178 Bacteria 1118
238 Ga0501084_0047872 3300054114 Bacteria 3580
239 Ga0501082_0035018 3300060353 Bacteria 4327
240 Ga0530510_0015782 3300061734 Bacteria 5340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100670855 Ga0070687_1006708551 114
2 3300014326 Ga0157380_12128089 Ga0157380_121280891 118
3 3300005345 Ga0070692_10275203 Ga0070692_102752032 119
4 3300005614 Ga0068856_101339457 Ga0068856_1013394571 120
5 3300009101 Ga0105247_10150346 Ga0105247_101503462 121
6 3300048911 Ga0496108_0510013 Ga0496108_0510013_446_871 122
7 3300046529 Ga0495652_0156811 Ga0495652_0156811_693_1154 123
8 3300047471 Ga0495684_0529782 Ga0495684_0529782_127_588 123
9 3300005436 Ga0070713_100146665 Ga0070713_1001466652 124
10 3300005548 Ga0070665_100005884 Ga0070665_1000058842 124
11 3300025914 Ga0207671_10369013 Ga0207671_103690132 124
12 3300025928 Ga0207700_10026838 Ga0207700_100268384 124
13 3300028379 Ga0268266_10001861 Ga0268266_100018617 124
14 3300046462 Ga0495651_0250772 Ga0495651_0250772_571_1032 124
15 3300009092 Ga0105250_10000014 Ga0105250_100000145 126
16 3300014968 Ga0157379_10000278 Ga0157379_100002786 126
17 3300025711 Ga0207696_1000087 Ga0207696_10000875 126
18 3300005843 Ga0068860_101382191 Ga0068860_1013821912 127
19 3300028381 Ga0268264_11749743 Ga0268264_117497431 127
20 3300005536 Ga0070697_100226425 Ga0070697_1002264252 130
21 3300046519 Ga0495632_0120204 Ga0495632_0120204_67_516 130
22 3300046616 Ga0495668_0480794 Ga0495668_0480794_157_606 130
23 3300049574 Ga0501038_0608468 Ga0501038_0608468_156_650 131
24 3300049575 Ga0501039_0368253 Ga0501039_0368253_501_995 131
25 3300049576 Ga0501040_0131793 Ga0501040_0131793_790_1284 131
26 3300049577 Ga0501041_0087734 Ga0501041_0087734_667_1161 131
27 3300049578 Ga0501042_0034967 Ga0501042_0034967_1156_1650 131
28 3300049580 Ga0501046_0068875 Ga0501046_0068875_153_647 131
29 3300049584 Ga0501068_0247976 Ga0501068_0247976_575_1069 131
30 3300049587 Ga0501071_0188318 Ga0501071_0188318_46_540 131
31 3300049588 Ga0501072_0049162 Ga0501072_0049162_1296_1790 131
32 3300049592 Ga0501076_0045496 Ga0501076_0045496_664_1158 131
33 3300049593 Ga0501077_0004175 Ga0501077_0004175_4269_4763 131
34 3300049741 Ga0501079_0047164 Ga0501079_0047164_923_1417 131
35 3300049743 Ga0501081_0000287 Ga0501081_0000287_3551_4045 131
36 3300049824 Ga0501045_0210861 Ga0501045_0210861_929_1423 131
37 3300053178 Ga0500637_0064044 Ga0500637_0064044_1067_1516 131
38 3300053178 Ga0500637_0205987 Ga0500637_0205987_450_959 131
39 3300054114 Ga0501084_0047872 Ga0501084_0047872_1768_2262 131
40 3300060353 Ga0501082_0035018 Ga0501082_0035018_3540_4034 131
41 3300061734 Ga0530510_0015782 Ga0530510_0015782_809_1303 131
42 3300005439 Ga0070711_100033476 Ga0070711_1000334763 132
43 3300005563 Ga0068855_101069903 Ga0068855_1010699031 132
44 3300037068 Ga0373925_0132890 Ga0373925_0132890_1256_1744 132
45 3300006237 Ga0097621_100562551 Ga0097621_1005625512 133
46 3300009098 Ga0105245_10095718 Ga0105245_100957182 133
47 3300025927 Ga0207687_10652373 Ga0207687_106523731 133
48 3300035113 Ga0373936_0077520 Ga0373936_0077520_613_1098 133
49 3300053077 Ga0495601_0762332 Ga0495601_0762332_19_504 133
50 3300005842 Ga0068858_100012153 Ga0068858_1000121533 135
51 3300026035 Ga0207703_10005491 Ga0207703_100054913 135
52 3300035118 Ga0373954_0076670 Ga0373954_0076670_67_555 135
53 3300037466 Ga0395898_0002975 Ga0395898_0002975_10860_11372 135
54 3300005330 Ga0070690_100028902 Ga0070690_1000289022 136
55 3300005353 Ga0070669_100383818 Ga0070669_1003838182 136
56 3300005439 Ga0070711_100038138 Ga0070711_1000381383 136
57 3300005440 Ga0070705_100036986 Ga0070705_1000369862 136
58 3300005544 Ga0070686_100012129 Ga0070686_1000121293 136
59 3300005548 Ga0070665_100044467 Ga0070665_1000444675 136
60 3300005615 Ga0070702_100015827 Ga0070702_1000158273 136
61 3300005617 Ga0068859_100029343 Ga0068859_1000293433 136
62 3300005618 Ga0068864_100058408 Ga0068864_1000584082 136
63 3300005618 Ga0068864_100110555 Ga0068864_1001105552 136
64 3300005719 Ga0068861_100032728 Ga0068861_1000327283 136
65 3300005843 Ga0068860_100004120 Ga0068860_1000041204 136
66 3300005843 Ga0068860_100535553 Ga0068860_1005355532 136
67 3300005844 Ga0068862_100017197 Ga0068862_1000171973 136
68 3300006175 Ga0070712_100499625 Ga0070712_1004996252 136
69 3300006237 Ga0097621_100036088 Ga0097621_1000360883 136
70 3300006931 Ga0097620_100029342 Ga0097620_1000293423 136
71 3300009093 Ga0105240_10027407 Ga0105240_100274074 136
72 3300009545 Ga0105237_10706580 Ga0105237_107065802 136
73 3300025913 Ga0207695_10673005 Ga0207695_106730052 136
74 3300025915 Ga0207693_10407983 Ga0207693_104079832 136
75 3300025916 Ga0207663_10352653 Ga0207663_103526532 136
76 3300025918 Ga0207662_10556895 Ga0207662_105568952 136
77 3300025923 Ga0207681_10859309 Ga0207681_108593092 136
78 3300026035 Ga0207703_10006054 Ga0207703_100060545 136
79 3300026095 Ga0207676_10079338 Ga0207676_100793383 136
80 3300026118 Ga0207675_100195654 Ga0207675_1001956542 136
81 3300028379 Ga0268266_10017864 Ga0268266_100178642 136
82 3300028380 Ga0268265_10026239 Ga0268265_100262393 136
83 3300028381 Ga0268264_10132305 Ga0268264_101323053 136
84 3300033180 Ga0307510_10204621 Ga0307510_102046212 136
85 3300048904 Ga0496101_0033626 Ga0496101_0033626_2517_3002 136
86 3300048904 Ga0496101_0161634 Ga0496101_0161634_852_1286 136
87 3300048907 Ga0496104_0008673 Ga0496104_0008673_4481_4915 136
88 3300048908 Ga0496105_0003391 Ga0496105_0003391_7155_7589 136
89 3300048908 Ga0496105_0007873 Ga0496105_0007873_5991_6476 136
90 3300048909 Ga0496106_0287861 Ga0496106_0287861_833_1267 136
91 3300048909 Ga0496106_0340263 Ga0496106_0340263_304_789 136
92 3300048910 Ga0496107_0321950 Ga0496107_0321950_625_1059 136
93 3300048911 Ga0496108_0004690 Ga0496108_0004690_4482_4916 136
94 3300048912 Ga0496109_0003527 Ga0496109_0003527_4901_5335 136
95 3300048913 Ga0496110_0005766 Ga0496110_0005766_9089_9523 136
96 3300048914 Ga0496111_0019835 Ga0496111_0019835_761_1195 136
97 3300048917 Ga0496114_0075955 Ga0496114_0075955_1675_2160 136
98 3300048918 Ga0496115_0004092 Ga0496115_0004092_9502_9987 136
99 3300005336 Ga0070680_100143081 Ga0070680_1001430812 137
100 3300005458 Ga0070681_10144445 Ga0070681_101444453 137
101 3300005530 Ga0070679_100041299 Ga0070679_1000412994 137
102 3300005535 Ga0070684_100037398 Ga0070684_1000373982 137
103 3300005548 Ga0070665_100036879 Ga0070665_1000368792 137
104 3300005548 Ga0070665_100086382 Ga0070665_1000863822 137
105 3300005563 Ga0068855_100004606 Ga0068855_10000460612 137
106 3300009093 Ga0105240_10016790 Ga0105240_100167904 137
107 3300009093 Ga0105240_10753119 Ga0105240_107531192 137
108 3300009545 Ga0105237_10057995 Ga0105237_100579953 137
109 3300009551 Ga0105238_10045883 Ga0105238_100458833 137
110 3300010375 Ga0105239_11156784 Ga0105239_111567842 137
111 3300013104 Ga0157370_10962325 Ga0157370_109623252 137
112 3300013307 Ga0157372_10329082 Ga0157372_103290823 137
113 3300025912 Ga0207707_10266043 Ga0207707_102660432 137
114 3300025913 Ga0207695_10022830 Ga0207695_100228304 137
115 3300025917 Ga0207660_10180711 Ga0207660_101807112 137
116 3300025921 Ga0207652_10275921 Ga0207652_102759212 137
117 3300025949 Ga0207667_10001737 Ga0207667_100017373 137
118 3300028379 Ga0268266_10020712 Ga0268266_100207124 137
119 3300028379 Ga0268266_10043416 Ga0268266_100434163 137
120 3300028800 Ga0265338_10023510 Ga0265338_100235104 137
121 3300036401 Ga0373937_0514590 Ga0373937_0514590_643_1107 137
122 3300053124 Ga0500617_025349 Ga0500617_025349_672_1130 137
123 3300006914 Ga0075436_100159456 Ga0075436_1001594562 138
124 3300050512 nmdc:mga0n895_271827_c1 nmdc:mga0n895_271827_c1_284_772 138
125 3300050514 nmdc:mga08x19_95161_c1 nmdc:mga08x19_95161_c1_975_1463 138
126 3300053134 Ga0500658_0119999 Ga0500658_0119999_196_663 138
127 3300005445 Ga0070708_100097444 Ga0070708_1000974442 139
128 3300005468 Ga0070707_100321188 Ga0070707_1003211881 139
129 3300025922 Ga0207646_10032731 Ga0207646_100327312 139
130 3300031903 Ga0307407_11001557 Ga0307407_110015571 139
131 3300005719 Ga0068861_100106702 Ga0068861_1001067023 140
132 3300009553 Ga0105249_10046698 Ga0105249_100466982 140
133 3300013307 Ga0157372_12575520 Ga0157372_125755201 140
134 3300025961 Ga0207712_10025287 Ga0207712_100252872 140
135 3300026118 Ga0207675_100111950 Ga0207675_1001119503 140
136 3300005289 Ga0065704_10152796 Ga0065704_101527962 141
137 3300005340 Ga0070689_100031042 Ga0070689_1000310422 141
138 3300005577 Ga0068857_101356194 Ga0068857_1013561941 141
139 3300005844 Ga0068862_100128698 Ga0068862_1001286982 141
140 3300014326 Ga0157380_10008495 Ga0157380_100084953 141
141 3300028380 Ga0268265_10122495 Ga0268265_101224952 141
142 3300005334 Ga0068869_100056991 Ga0068869_1000569913 142
143 3300005438 Ga0070701_10029324 Ga0070701_100293242 142
144 3300005441 Ga0070700_100214837 Ga0070700_1002148372 142
145 3300005466 Ga0070685_10107369 Ga0070685_101073692 142
146 3300005548 Ga0070665_100003052 Ga0070665_10000305211 142
147 3300005617 Ga0068859_100278619 Ga0068859_1002786192 142
148 3300005843 Ga0068860_101280192 Ga0068860_1012801922 142
149 3300005844 Ga0068862_100182960 Ga0068862_1001829602 142
150 3300006931 Ga0097620_100278620 Ga0097620_1002786202 142
151 3300025938 Ga0207704_10333891 Ga0207704_103338911 142
152 3300025942 Ga0207689_10165079 Ga0207689_101650792 142
153 3300026075 Ga0207708_10540464 Ga0207708_105404642 142
154 3300028379 Ga0268266_10149702 Ga0268266_101497022 142
155 3300028380 Ga0268265_10528366 Ga0268265_105283662 142
156 3300039437 Ga0436365_0363133 Ga0436365_0363133_478_936 142
157 3300028379 Ga0268266_10521790 Ga0268266_105217902 143
158 3300048918 Ga0496115_0493396 Ga0496115_0493396_207_671 143
159 3300048918 Ga0496115_0823560 Ga0496115_0823560_168_659 143
160 3300005937 Ga0081455_10001456 Ga0081455_1000145635 144
161 3300026078 Ga0207702_11366420 Ga0207702_113664202 144
162 3300031616 Ga0307508_10258420 Ga0307508_102584202 144
163 3300053178 Ga0500637_0019938 Ga0500637_0019938_3101_3538 144
164 3300005616 Ga0068852_101480078 Ga0068852_1014800781 145
165 3300028800 Ga0265338_10008206 Ga0265338_1000820612 145
166 3300030760 Ga0265762_1103350 Ga0265762_11033501 145
167 3300031251 Ga0265327_10004065 Ga0265327_1000406513 145
168 3300031711 Ga0265314_10019244 Ga0265314_100192443 145
169 3300005719 Ga0068861_100409657 Ga0068861_1004096572 146
170 3300026118 Ga0207675_100460892 Ga0207675_1004608921 146
171 3300031548 Ga0307408_100388735 Ga0307408_1003887351 146
172 3300005335 Ga0070666_10001463 Ga0070666_1000146311 147
173 3300005364 Ga0070673_100269703 Ga0070673_1002697032 147
174 3300005367 Ga0070667_100030761 Ga0070667_1000307614 147
175 3300005547 Ga0070693_100821943 Ga0070693_1008219431 147
176 3300005616 Ga0068852_100310307 Ga0068852_1003103072 147
177 3300005617 Ga0068859_100585461 Ga0068859_1005854611 147
178 3300005834 Ga0068851_10286647 Ga0068851_102866471 147
179 3300005842 Ga0068858_100247609 Ga0068858_1002476092 147
180 3300006358 Ga0068871_100214098 Ga0068871_1002140982 147
181 3300006931 Ga0097620_100585422 Ga0097620_1005854221 147
182 3300009098 Ga0105245_10020195 Ga0105245_100201953 147
183 3300009176 Ga0105242_10044259 Ga0105242_100442592 147
184 3300009177 Ga0105248_10006277 Ga0105248_100062779 147
185 3300009551 Ga0105238_10080934 Ga0105238_100809342 147
186 3300013296 Ga0157374_10077160 Ga0157374_100771603 147
187 3300013306 Ga0163162_10081169 Ga0163162_100811692 147
188 3300013306 Ga0163162_11515644 Ga0163162_115156442 147
189 3300013308 Ga0157375_10002928 Ga0157375_1000292812 147
190 3300014325 Ga0163163_10008759 Ga0163163_100087593 147
191 3300014968 Ga0157379_10001605 Ga0157379_100016053 147
192 3300014969 Ga0157376_10000910 Ga0157376_1000091015 147
193 3300025927 Ga0207687_10161564 Ga0207687_101615642 147
194 3300025934 Ga0207686_10135727 Ga0207686_101357272 147
195 3300025938 Ga0207704_10209545 Ga0207704_102095452 147
196 3300025960 Ga0207651_10356025 Ga0207651_103560252 147
197 3300025986 Ga0207658_10242544 Ga0207658_102425442 147
198 3300026142 Ga0207698_10238319 Ga0207698_102383192 147
199 3300037853 Ga0436364_1523198 Ga0436364_1523198_156_617 147
200 3300049588 Ga0501072_0116737 Ga0501072_0116737_154_627 147
201 3300049742 Ga0501080_0939079 Ga0501080_0939079_32_505 147
202 3300049744 Ga0501083_0568410 Ga0501083_0568410_223_696 147
203 3300049824 Ga0501045_0149932 Ga0501045_0149932_201_674 147
204 3300053088 Ga0500644_0016783 Ga0500644_0016783_247_729 147
205 3300005617 Ga0068859_100396864 Ga0068859_1003968642 148
206 3300006931 Ga0097620_100396836 Ga0097620_1003968362 148
207 3300014325 Ga0163163_10755935 Ga0163163_107559352 148
208 3300025913 Ga0207695_10514082 Ga0207695_105140822 148
209 3300025914 Ga0207671_10991550 Ga0207671_109915502 148
210 3300031090 Ga0265760_10141731 Ga0265760_101417312 148
211 3300005330 Ga0070690_100070361 Ga0070690_1000703612 149
212 3300005331 Ga0070670_100037750 Ga0070670_1000377505 149
213 3300005343 Ga0070687_100842909 Ga0070687_1008429091 149
214 3300005366 Ga0070659_101088620 Ga0070659_1010886202 149
215 3300005441 Ga0070700_100600659 Ga0070700_1006006592 149
216 3300005543 Ga0070672_100590164 Ga0070672_1005901642 149
217 3300005617 Ga0068859_100357745 Ga0068859_1003577452 149
218 3300006931 Ga0097620_100357754 Ga0097620_1003577542 149
219 3300009093 Ga0105240_10026583 Ga0105240_100265834 149
220 3300014968 Ga0157379_10897694 Ga0157379_108976941 149
221 3300025918 Ga0207662_10144219 Ga0207662_101442192 149
222 3300025925 Ga0207650_10380551 Ga0207650_103805512 149
223 3300026118 Ga0207675_100101080 Ga0207675_1001010802 149
224 iso_pu_bacteria 2896253425 2896255828 149
225 3300006844 Ga0075428_100008172 Ga0075428_1000081728 150
226 3300006847 Ga0075431_100803803 Ga0075431_1008038032 150
227 3300006880 Ga0075429_100646922 Ga0075429_1006469222 150
228 3300009094 Ga0111539_10193464 Ga0111539_101934643 150
229 3300028380 Ga0268265_11051867 Ga0268265_110518672 150
230 3300042461 Ga0439460_0044358 Ga0439460_0044358_400_870 150
231 3300045049 Ga0466959_0033955 Ga0466959_0033955_259_903 150
232 3300050508 nmdc:mga09592_633740_c1 nmdc:mga09592_633740_c1_102_572 150
233 3300050511 nmdc:mga08y16_308306_c1 nmdc:mga08y16_308306_c1_236_706 150
234 3300044693 Ga0466961_0071694 Ga0466961_0071694_1247_1876 152
235 3300009545 Ga0105237_10151566 Ga0105237_101515662 153
236 3300026078 Ga0207702_11831162 Ga0207702_118311621 153
237 3300053093 Ga0500651_0061178 Ga0500651_0061178_1004_1522 157
238 3300053156 Ga0500622_0003625 Ga0500622_0003625_8645_9163 157
239 3300030760 Ga0265762_1027651 Ga0265762_10276512 158
240 3300031507 Ga0307509_10495630 Ga0307509_104956302 161
241 3300003322 rootL2_10144617 rootL2_101446172 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

94

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9913 90 164
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9366 90 164
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.9347 89 164
1dd2-assembly1.cif.gz_A biotin carboxyl carrier domain of transcarboxylase (tc 1.3s) 0.9208 91 164
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9185 90 164
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9815 90 162 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9605 89 164 2.40.50.100
af_Q93W03_192_271_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9483 88 164 2.40.50.100
af_Q58628_489_566_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9412 91 162 2.40.50.100
af_P9WPQ1_4_71_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9356 91 164 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A6B1HF19-F1-model_v4 deleted 0.9923 89 166
AF-A0A399F3B0-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9908 90 167 GO:0003989
GO:0006633
GO:0009317
AF-A0A3N5N3S2-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9883 92 167 GO:0003989
GO:0006633
GO:0009317
AF-A0A519Y5H1-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9852 89 167 GO:0003989
GO:0006633
GO:0009317
AF-A0A357FV41-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9843 89 167 GO:0003989
GO:0006633
GO:0009317

Feature Viewer

pLDDT pTM Quality
74.92 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map