F353951

General Info

Members Datasets Scaffolds Average Seq Length
241 136 482 240

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0006717|Ga0373925_0006717_884_1693
Length 269
Sequence MIPVKSSAFEDVFCPRERVESMTATSPSMSGASGEPIGFIEPRLVRIPGQWFWMGCESGRDDEKPVHRVWVDSFELAACQVTNAEYRCFLAATSVAAPPCWTDPNFNDPQMPVAAVSWHEATAYCDWLSRATDKPYRLPTEAEWECAARGGAEKFLYPWGDAPPESLPDYANRWKSGPEPVSLYGPNAYGLFNIGDNVHEWCADWYDAGYYKYSPERNPRGPSDGVRKASRGGSWRHHIKVSRSAARSSIPPEFQYADYGFRVACSSKT

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 21.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0006717 3300037068 Bacteria 8439
2 Ga0068868_100168621 3300005338 Unclassified 1812
3 Ga0070660_100476167 3300005339 Unclassified 1037
4 Ga0070667_100382818 3300005367 Unclassified 1278
5 Ga0070709_10000339 3300005434 Bacteria 29052
6 Ga0070709_10004139 3300005434 Bacteria 7825
7 Ga0070709_10164588 3300005434 Bacteria 1545
8 Ga0070709_10218152 3300005434 Bacteria 1359
9 Ga0070714_100434381 3300005435 Bacteria 1245
10 Ga0070713_100000590 3300005436 Bacteria 23065
11 Ga0070713_100092810 3300005436 Bacteria 2600
12 Ga0070710_10023614 3300005437 Bacteria 3234
13 Ga0070710_10077804 3300005437 Bacteria 1928
14 Ga0070710_10206409 3300005437 Bacteria 1243
15 Ga0070711_100093833 3300005439 Bacteria 2168
16 Ga0070711_100258570 3300005439 Bacteria 1369
17 Ga0070705_100116951 3300005440 Bacteria 1714
18 Ga0070694_100225050 3300005444 Bacteria 1409
19 Ga0070694_100474792 3300005444 Unclassified 991
20 Ga0070708_100096242 3300005445 Bacteria 2704
21 Ga0070708_100477462 3300005445 Unclassified 1176
22 Ga0070681_10051431 3300005458 Bacteria 4109
23 Ga0070706_100207483 3300005467 Bacteria 1829
24 Ga0070707_100004911 3300005468 Bacteria 12529
25 Ga0070707_100236912 3300005468 Bacteria 1776
26 Ga0070707_100280248 3300005468 Unclassified 1620
27 Ga0070707_100899115 3300005468 Unclassified 850
28 Ga0070698_100021607 3300005471 Bacteria 6739
29 Ga0070699_100082576 3300005518 Unclassified 2801
30 Ga0070679_100070161 3300005530 Bacteria 3496
31 Ga0070697_100070396 3300005536 Bacteria 2867
32 Ga0070686_100264318 3300005544 Unclassified 1262
33 Ga0070696_100165915 3300005546 Bacteria 1630
34 Ga0070693_100217178 3300005547 Bacteria 1251
35 Ga0070704_100054394 3300005549 Bacteria 2832
36 Ga0068866_10328236 3300005718 Unclassified 965
37 Ga0068863_100010848 3300005841 Bacteria 8836
38 Ga0070717_10044469 3300006028 Bacteria 3626
39 Ga0070717_10304011 3300006028 Bacteria 1418
40 Ga0070715_10018809 3300006163 Bacteria 2639
41 Ga0070715_10053150 3300006163 Unclassified 1750
42 Ga0070716_100000036 3300006173 Bacteria 56048
43 Ga0070716_100003551 3300006173 Bacteria 7361
44 Ga0070716_100239023 3300006173 Unclassified 1230
45 Ga0070712_100000340 3300006175 Bacteria 26355
46 Ga0070712_100001045 3300006175 Bacteria 16718
47 Ga0070712_100012213 3300006175 Bacteria 5459
48 Ga0070712_100236748 3300006175 Bacteria 1452
49 Ga0097621_100788373 3300006237 Unclassified 880
50 Ga0068871_100415455 3300006358 Bacteria 1200
51 Ga0075433_10535120 3300006852 Bacteria 1030
52 Ga0075434_100012954 3300006871 Bacteria 7921
53 Ga0075436_100053465 3300006914 Bacteria 2788
54 Ga0075436_100070218 3300006914 Bacteria 2421
55 Ga0075436_100152485 3300006914 Bacteria 1627
56 Ga0075435_100127061 3300007076 Bacteria 2131
57 Ga0075435_100236204 3300007076 Unclassified 1554
58 Ga0099794_10002818 3300007265 Bacteria 6505
59 Ga0099794_10003550 3300007265 Bacteria 5973
60 Ga0099794_10006673 3300007265 Bacteria 4689
61 Ga0099794_10009251 3300007265 Bacteria 4132
62 Ga0099794_10011565 3300007265 Bacteria 3782
63 Ga0099794_10070896 3300007265 Bacteria 1707
64 Ga0099794_10078323 3300007265 Bacteria 1627
65 Ga0099795_10018526 3300007788 Unclassified 2239
66 Ga0099795_10070243 3300007788 Unclassified 1319
67 Ga0105240_10022103 3300009093 Bacteria 8442
68 Ga0105243_10519392 3300009148 Unclassified 1132
69 Ga0105248_10008595 3300009177 Bacteria 11214
70 Ga0105248_10046700 3300009177 Bacteria 4855
71 Ga0105239_10217729 3300010375 Bacteria 2141
72 Ga0157378_10000316 3300013297 Bacteria 47349
73 Ga0157372_10031121 3300013307 Bacteria 5843
74 Ga0163163_10957812 3300014325 Bacteria 919
75 Ga0207692_10016774 3300025898 Bacteria 3252
76 Ga0207692_10032675 3300025898 Bacteria 2503
77 Ga0207710_10033616 3300025900 Bacteria 2250
78 Ga0207685_10023709 3300025905 Bacteria 2093
79 Ga0207685_10216849 3300025905 Bacteria 908
80 Ga0207699_10001110 3300025906 Bacteria 12729
81 Ga0207699_10075546 3300025906 Bacteria 2073
82 Ga0207699_10268703 3300025906 Bacteria 1181
83 Ga0207699_10328566 3300025906 Unclassified 1074
84 Ga0207684_10054528 3300025910 Bacteria 3391
85 Ga0207695_10097811 3300025913 Bacteria 2935
86 Ga0207671_10649548 3300025914 Unclassified 840
87 Ga0207693_10000182 3300025915 Bacteria 57166
88 Ga0207693_10008388 3300025915 Bacteria 8455
89 Ga0207693_10020277 3300025915 Bacteria 5289
90 Ga0207693_10063493 3300025915 Bacteria 2893
91 Ga0207693_10196420 3300025915 Bacteria 1587
92 Ga0207693_10244530 3300025915 Unclassified 1408
93 Ga0207693_10253249 3300025915 Unclassified 1381
94 Ga0207693_10357238 3300025915 Unclassified 1143
95 Ga0207663_10463070 3300025916 Unclassified 979
96 Ga0207663_10605684 3300025916 Unclassified 861
97 Ga0207646_10001529 3300025922 Bacteria 28312
98 Ga0207646_10005993 3300025922 Bacteria 12667
99 Ga0207687_10041969 3300025927 Bacteria 3144
100 Ga0207700_10000217 3300025928 Bacteria 34284
101 Ga0207690_10041666 3300025932 Bacteria 3010
102 Ga0207709_10284784 3300025935 Unclassified 1222
103 Ga0207665_10000024 3300025939 Bacteria 101596
104 Ga0207665_10007198 3300025939 Bacteria 7361
105 Ga0207665_10009485 3300025939 Bacteria 6391
106 Ga0207711_10019106 3300025941 Bacteria 5702
107 Ga0207689_10373093 3300025942 Bacteria 1187
108 Ga0207658_10382303 3300025986 Unclassified 1233
109 Ga0207677_10615723 3300026023 Unclassified 954
110 Ga0207703_10525778 3300026035 Bacteria 1113
111 Ga0207639_10557762 3300026041 Bacteria 1052
112 Ga0207641_10018389 3300026088 Bacteria 5730
113 Ga0209179_1059010 3300027512 Unclassified 831
114 Ga0209588_1001247 3300027671 Bacteria 6583
115 Ga0209588_1007887 3300027671 Bacteria 3148
116 Ga0209588_1015020 3300027671 Unclassified 2378
117 Ga0209588_1020984 3300027671 Unclassified 2048
118 Ga0209588_1029329 3300027671 Bacteria 1755
119 Ga0265354_1006351 3300028016 Bacteria 1175
120 Ga0268264_10129197 3300028381 Bacteria 2237
121 Ga0265762_1020266 3300030760 Bacteria 1222
122 Ga0265770_1002826 3300030878 Bacteria 2361
123 Ga0265760_10026865 3300031090 Unclassified 1685
124 Ga0265325_10007098 3300031241 Bacteria 6742
125 Ga0265325_10011088 3300031241 Bacteria 5187
126 Ga0265331_10034114 3300031250 Unclassified 2512
127 Ga0265314_10242499 3300031711 Bacteria 1039
128 Ga0265342_10040249 3300031712 Bacteria 2836
129 Ga0265342_10133203 3300031712 Unclassified 1391
130 Ga0373926_0004878 3300035083 Bacteria 4409
131 Ga0373934_0022044 3300035086 Bacteria 2455
132 Ga0373936_0119660 3300035113 Bacteria 1124
133 Ga0373953_0016054 3300035117 Bacteria 2727
134 Ga0373954_0000279 3300035118 Bacteria 18566
135 Ga0373954_0197053 3300035118 Bacteria 989
136 Ga0373954_0237275 3300035118 Unclassified 897
137 Ga0373956_0039056 3300035119 Bacteria 2102
138 Ga0373956_0133561 3300035119 Bacteria 1163
139 Ga0373943_0074441 3300035170 Unclassified 1727
140 Ga0373946_0004124 3300035171 Bacteria 5176
141 Ga0373946_0174964 3300035171 Bacteria 1015
142 Ga0373955_0065463 3300035172 Bacteria 2018
143 Ga0373955_0162335 3300035172 Bacteria 1319
144 Ga0373924_0026498 3300035410 Bacteria 2300
145 Ga0373927_0000442 3300035695 Bacteria 31705
146 Ga0373927_0005578 3300035695 Bacteria 8653
147 Ga0373933_0002821 3300035724 Bacteria 9707
148 Ga0373947_0080938 3300035725 Bacteria 2010
149 Ga0373947_0160602 3300035725 Unclassified 1453
150 Ga0373937_0004030 3300036401 Bacteria 12444
151 Ga0373937_0015654 3300036401 Bacteria 6715
152 Ga0373937_0053141 3300036401 Bacteria 3716
153 Ga0373925_0653606 3300037068 Bacteria 866
154 Ga0451577_0089669 3300042876 Bacteria 2744
155 Ga0453683_0024653 3300044673 Bacteria 3824
156 Ga0453683_0169604 3300044673 Bacteria 1382
157 Ga0495592_0069733 3300046454 Bacteria 2563
158 Ga0495592_0135565 3300046454 Bacteria 1718
159 Ga0495603_0299889 3300046455 Bacteria 923
160 Ga0495651_0000149 3300046462 Bacteria 51195
161 Ga0495651_0013604 3300046462 Bacteria 6290
162 Ga0495651_0042542 3300046462 Unclassified 3527
163 Ga0495651_0046893 3300046462 Bacteria 3344
164 Ga0495651_0064466 3300046462 Bacteria 2800
165 Ga0495653_0061543 3300046463 Bacteria 2840
166 Ga0495653_0127299 3300046463 Bacteria 1807
167 Ga0495580_0018252 3300046472 Bacteria 5225
168 Ga0495580_0027014 3300046472 Bacteria 4180
169 Ga0495580_0037614 3300046472 Bacteria 3470
170 Ga0495582_0051607 3300046473 Bacteria 2267
171 Ga0495664_0011969 3300046477 Bacteria 4902
172 Ga0495608_0012159 3300046511 Bacteria 5982
173 Ga0495608_0044887 3300046511 Bacteria 2948
174 Ga0495608_0069915 3300046511 Bacteria 2292
175 Ga0495618_0027721 3300046514 Unclassified 3527
176 Ga0495618_0070753 3300046514 Bacteria 2219
177 Ga0495628_0000793 3300046516 Bacteria 29118
178 Ga0495628_0142294 3300046516 Bacteria 1830
179 Ga0495630_0049847 3300046517 Bacteria 3134
180 Ga0495630_0068508 3300046517 Unclassified 2669
181 Ga0495666_0060250 3300046526 Unclassified 1814
182 Ga0495666_0236038 3300046526 Bacteria 835
183 Ga0495652_0005912 3300046529 Bacteria 11444
184 Ga0495652_0007252 3300046529 Bacteria 10233
185 Ga0495652_0424441 3300046529 Bacteria 936
186 Ga0495665_0017220 3300046531 Bacteria 3889
187 Ga0495640_0060291 3300046533 Unclassified 2581
188 Ga0495586_0012781 3300046535 Bacteria 4449
189 Ga0495587_0003632 3300046536 Bacteria 10269
190 Ga0495587_0007524 3300046536 Bacteria 7054
191 Ga0495587_0024580 3300046536 Bacteria 3690
192 Ga0495645_0019121 3300046543 Bacteria 4931
193 Ga0495645_0061553 3300046543 Bacteria 2719
194 Ga0495645_0368147 3300046543 Bacteria 922
195 Ga0495667_0002229 3300046559 Bacteria 12964
196 Ga0495667_0014006 3300046559 Bacteria 5414
197 Ga0495667_0065741 3300046559 Bacteria 2372
198 Ga0495667_0190038 3300046559 Unclassified 1316
199 Ga0495634_0035594 3300046642 Bacteria 3408
200 Ga0495635_0038917 3300046663 Bacteria 3292
201 Ga0495635_0115550 3300046663 Bacteria 1832
202 Ga0495657_0189422 3300046675 Bacteria 1258
203 Ga0495623_0017223 3300046679 Bacteria 4667
204 Ga0495623_0259106 3300046679 Bacteria 975
205 Ga0495646_0001956 3300046680 Bacteria 12413
206 Ga0495658_0218261 3300046683 Bacteria 1193
207 Ga0495613_0031343 3300046689 Bacteria 3949
208 Ga0495613_0051694 3300046689 Bacteria 3028
209 Ga0495624_0011938 3300046690 Bacteria 5954
210 Ga0495604_0003708 3300047317 Bacteria 12168
211 Ga0495604_0007059 3300047317 Bacteria 8911
212 Ga0495674_0012287 3300047319 Bacteria 8071
213 Ga0495674_0122951 3300047319 Bacteria 2192
214 Ga0495674_0126459 3300047319 Unclassified 2156
215 Ga0495674_0178077 3300047319 Bacteria 1771
216 Ga0495674_0718207 3300047319 Unclassified 783
217 Ga0495680_0000244 3300047322 Bacteria 60043
218 Ga0495680_0011014 3300047322 Bacteria 8034
219 Ga0495680_0043351 3300047322 Bacteria 3563
220 Ga0495675_0000222 3300047444 Bacteria 41264
221 Ga0495675_0138147 3300047444 Bacteria 1512
222 Ga0495684_0005979 3300047471 Bacteria 9454
223 Ga0495684_0008045 3300047471 Bacteria 8154
224 Ga0495684_0030981 3300047471 Bacteria 4106
225 Ga0495684_0044453 3300047471 Bacteria 3401
226 Ga0495593_0002314 3300047673 Bacteria 11438
227 Ga0495602_0007988 3300048088 Bacteria 11060
228 Ga0495602_0037892 3300048088 Unclassified 4465
229 Ga0495602_0038233 3300048088 Bacteria 4441
230 Ga0496101_0137110 3300048904 Unclassified 1863
231 Ga0496101_0630914 3300048904 Bacteria 847
232 Ga0496106_0171656 3300048909 Unclassified 1719
233 Ga0496107_0599370 3300048910 Unclassified 814
234 Ga0496113_0816797 3300048916 Unclassified 740
235 Ga0496115_0190199 3300048918 Unclassified 1696
236 nmdc:mga0n895_519894_c1 3300050512 Unclassified 1198
237 nmdc:mga0n895_52603_c1 3300050512 Bacteria 3998
238 nmdc:mga0rr50_121965_c1 3300050513 Bacteria 2076
239 nmdc:mga08x19_1439_c1 3300050514 Bacteria 14721
240 nmdc:mga08x19_40320_c1 3300050514 Bacteria 2971
241 Ga0495612_0001676 3300053078 Bacteria 9117
242 Ga0373925_0006717
243 Ga0068868_100168621
244 Ga0070660_100476167
245 Ga0070667_100382818
246 Ga0070709_10000339
247 Ga0070709_10004139
248 Ga0070709_10164588
249 Ga0070709_10218152
250 Ga0070714_100434381
251 Ga0070713_100000590
252 Ga0070713_100092810
253 Ga0070710_10023614
254 Ga0070710_10077804
255 Ga0070710_10206409
256 Ga0070711_100093833
257 Ga0070711_100258570
258 Ga0070705_100116951
259 Ga0070694_100225050
260 Ga0070694_100474792
261 Ga0070708_100096242
262 Ga0070708_100477462
263 Ga0070681_10051431
264 Ga0070706_100207483
265 Ga0070707_100004911
266 Ga0070707_100236912
267 Ga0070707_100280248
268 Ga0070707_100899115
269 Ga0070698_100021607
270 Ga0070699_100082576
271 Ga0070679_100070161
272 Ga0070697_100070396
273 Ga0070686_100264318
274 Ga0070696_100165915
275 Ga0070693_100217178
276 Ga0070704_100054394
277 Ga0068866_10328236
278 Ga0068863_100010848
279 Ga0070717_10044469
280 Ga0070717_10304011
281 Ga0070715_10018809
282 Ga0070715_10053150
283 Ga0070716_100000036
284 Ga0070716_100003551
285 Ga0070716_100239023
286 Ga0070712_100000340
287 Ga0070712_100001045
288 Ga0070712_100012213
289 Ga0070712_100236748
290 Ga0097621_100788373
291 Ga0068871_100415455
292 Ga0075433_10535120
293 Ga0075434_100012954
294 Ga0075436_100053465
295 Ga0075436_100070218
296 Ga0075436_100152485
297 Ga0075435_100127061
298 Ga0075435_100236204
299 Ga0099794_10002818
300 Ga0099794_10003550
301 Ga0099794_10006673
302 Ga0099794_10009251
303 Ga0099794_10011565
304 Ga0099794_10070896
305 Ga0099794_10078323
306 Ga0099795_10018526
307 Ga0099795_10070243
308 Ga0105240_10022103
309 Ga0105243_10519392
310 Ga0105248_10008595
311 Ga0105248_10046700
312 Ga0105239_10217729
313 Ga0157378_10000316
314 Ga0157372_10031121
315 Ga0163163_10957812
316 Ga0207692_10016774
317 Ga0207692_10032675
318 Ga0207710_10033616
319 Ga0207685_10023709
320 Ga0207685_10216849
321 Ga0207699_10001110
322 Ga0207699_10075546
323 Ga0207699_10268703
324 Ga0207699_10328566
325 Ga0207684_10054528
326 Ga0207695_10097811
327 Ga0207671_10649548
328 Ga0207693_10000182
329 Ga0207693_10008388
330 Ga0207693_10020277
331 Ga0207693_10063493
332 Ga0207693_10196420
333 Ga0207693_10244530
334 Ga0207693_10253249
335 Ga0207693_10357238
336 Ga0207663_10463070
337 Ga0207663_10605684
338 Ga0207646_10001529
339 Ga0207646_10005993
340 Ga0207687_10041969
341 Ga0207700_10000217
342 Ga0207690_10041666
343 Ga0207709_10284784
344 Ga0207665_10000024
345 Ga0207665_10007198
346 Ga0207665_10009485
347 Ga0207711_10019106
348 Ga0207689_10373093
349 Ga0207658_10382303
350 Ga0207677_10615723
351 Ga0207703_10525778
352 Ga0207639_10557762
353 Ga0207641_10018389
354 Ga0209179_1059010
355 Ga0209588_1001247
356 Ga0209588_1007887
357 Ga0209588_1015020
358 Ga0209588_1020984
359 Ga0209588_1029329
360 Ga0265354_1006351
361 Ga0268264_10129197
362 Ga0265762_1020266
363 Ga0265770_1002826
364 Ga0265760_10026865
365 Ga0265325_10007098
366 Ga0265325_10011088
367 Ga0265331_10034114
368 Ga0265314_10242499
369 Ga0265342_10040249
370 Ga0265342_10133203
371 Ga0373926_0004878
372 Ga0373934_0022044
373 Ga0373936_0119660
374 Ga0373953_0016054
375 Ga0373954_0000279
376 Ga0373954_0197053
377 Ga0373954_0237275
378 Ga0373956_0039056
379 Ga0373956_0133561
380 Ga0373943_0074441
381 Ga0373946_0004124
382 Ga0373946_0174964
383 Ga0373955_0065463
384 Ga0373955_0162335
385 Ga0373924_0026498
386 Ga0373927_0000442
387 Ga0373927_0005578
388 Ga0373933_0002821
389 Ga0373947_0080938
390 Ga0373947_0160602
391 Ga0373937_0004030
392 Ga0373937_0015654
393 Ga0373937_0053141
394 Ga0373925_0653606
395 Ga0451577_0089669
396 Ga0453683_0024653
397 Ga0453683_0169604
398 Ga0495592_0069733
399 Ga0495592_0135565
400 Ga0495603_0299889
401 Ga0495651_0000149
402 Ga0495651_0013604
403 Ga0495651_0042542
404 Ga0495651_0046893
405 Ga0495651_0064466
406 Ga0495653_0061543
407 Ga0495653_0127299
408 Ga0495580_0018252
409 Ga0495580_0027014
410 Ga0495580_0037614
411 Ga0495582_0051607
412 Ga0495664_0011969
413 Ga0495608_0012159
414 Ga0495608_0044887
415 Ga0495608_0069915
416 Ga0495618_0027721
417 Ga0495618_0070753
418 Ga0495628_0000793
419 Ga0495628_0142294
420 Ga0495630_0049847
421 Ga0495630_0068508
422 Ga0495666_0060250
423 Ga0495666_0236038
424 Ga0495652_0005912
425 Ga0495652_0007252
426 Ga0495652_0424441
427 Ga0495665_0017220
428 Ga0495640_0060291
429 Ga0495586_0012781
430 Ga0495587_0003632
431 Ga0495587_0007524
432 Ga0495587_0024580
433 Ga0495645_0019121
434 Ga0495645_0061553
435 Ga0495645_0368147
436 Ga0495667_0002229
437 Ga0495667_0014006
438 Ga0495667_0065741
439 Ga0495667_0190038
440 Ga0495634_0035594
441 Ga0495635_0038917
442 Ga0495635_0115550
443 Ga0495657_0189422
444 Ga0495623_0017223
445 Ga0495623_0259106
446 Ga0495646_0001956
447 Ga0495658_0218261
448 Ga0495613_0031343
449 Ga0495613_0051694
450 Ga0495624_0011938
451 Ga0495604_0003708
452 Ga0495604_0007059
453 Ga0495674_0012287
454 Ga0495674_0122951
455 Ga0495674_0126459
456 Ga0495674_0178077
457 Ga0495674_0718207
458 Ga0495680_0000244
459 Ga0495680_0011014
460 Ga0495680_0043351
461 Ga0495675_0000222
462 Ga0495675_0138147
463 Ga0495684_0005979
464 Ga0495684_0008045
465 Ga0495684_0030981
466 Ga0495684_0044453
467 Ga0495593_0002314
468 Ga0495602_0007988
469 Ga0495602_0037892
470 Ga0495602_0038233
471 Ga0496101_0137110
472 Ga0496101_0630914
473 Ga0496106_0171656
474 Ga0496107_0599370
475 Ga0496113_0816797
476 Ga0496115_0190199
477 nmdc:mga0n895_519894_c1
478 nmdc:mga0n895_52603_c1
479 nmdc:mga0rr50_121965_c1
480 nmdc:mga08x19_1439_c1
481 nmdc:mga08x19_40320_c1
482 Ga0495612_0001676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

41

265

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y4j-assembly1.cif.gz_B crystal structure of the paralogue of the human formylglycine generating enzyme 0.7807 16 175
4x8e-assembly2.cif.gz_B ergothioneine-biosynthetic sulfoxide synthase egtb in complex with n,n,n-trimethyl-histidine 0.7262 15 175
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.7083 16 240
5nxl-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with ag(i) 0.7073 12 239
6xtn-assembly1.cif.gz_A crystal structure reveals non-coordinative binding of o2 to the copper center of the formylglycine-generating enzyme - fge:ag:s:no complex 0.6997 16 239
ID Description Score Start End Superfamily
af_O94632_506_773_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8008 12 129 3.90.1580.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7797 9 177 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6724 16 239 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6611 4 240 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6483 4 240 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A6L8DQT1-F1-model_v4 Formylglycine-generating enzyme family protein 0.9531 13 129 GO:0120147
AF-A0A382RB71-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9492 13 136 GO:0120147
AF-A0A800JZB1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9459 7 125 GO:0120147
AF-A0A6L8DQT1-F1-model_v4 Formylglycine-generating enzyme family protein 0.9376 13 129 GO:0120147
AF-A0A355B7I1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9318 16 119

Map