F353303

General Info

Members Datasets Scaffolds Average Seq Length
240 181 184 330

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0021485|Ga0500641_0021485_104_1225
Length 373
Sequence LKGQRTPSERRSGLPVGSFQDDNALVSRRITGNGMLMGDENKRGVLLQQRILPFPTSISAEAQSALRRLVSEDGIPLNSLHAMPAAEDHAAWMSVKAAVDAQYAAAVAGLAGTLRSSVETIQVDDTTIHIATPDAPVRPDCAYLDLHGGALVFGGGDACRAGARMQADQHGVRCYGVDYRMPPQHPYPAALDDCLTTYRYMLERHAPENIVIGGRSSGGNLAAAMALRARDEGLPLPAGLVLLSPEVDLTESGDSFEANRMVDVVLPSSLMSTNRMYANGADLAHPYLSPLFGDLRGLPTTFLQTGTRDLFLSNAVRMHRRLLGAGVRAELHVFEAMPHGGFMGGTPEDRELSEEVGRFVRARWRTPTGKGEM

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
5 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
6 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
7 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
8 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
9 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
12 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
13 2643221558 Rhizobium sp. Root149 Isolate Unclassified
14 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
15 2643221719 Rhizobium sp. Root274 Isolate Unclassified
16 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
17 2734482264 Dyella sp. AD052 Isolate Unclassified
18 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
19 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
20 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
21 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
22 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
23 2818991452 Burkholderia cepacia 561 Isolate Unclassified
24 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
25 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
26 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
27 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
28 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
29 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
30 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
31 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
32 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
33 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
34 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
35 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
36 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
37 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
38 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
39 2919085039 Luteibacter sp. 1214 Isolate Unclassified
40 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
41 2928170801 Burkholderia sp. 572 Isolate Unclassified
42 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
43 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
44 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
45 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
46 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
47 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
48 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
49 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
50 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
51 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
77 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
178 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
179 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
180 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
181 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.67
Metatranscriptomes 0
Isolates 23.33

Biome Distribution

Category Percentage (%)
Aerial Root 1.25
Bulb 0
Endosphere 15
Nodule 4.58
Rhizoplane 2.92
Rhizosphere 54.58
Stem 0
Stem Tuber 0
Unclassified 21.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000040 3300002704 Bacteria 89420
2 JGI25156J39149_1000051 3300002705 Bacteria 89412
3 JGI25154J39366_1000079 3300002738 Bacteria 89420
4 JGI25157J39369_1000168 3300002741 Bacteria 55097
5 Ga0055527_1004690 3300003760 Bacteria 1847
6 Ga0055526_1000009 3300003771 Bacteria 257259
7 Ga0055524_1010631 3300003775 Bacteria 3651
8 Ga0055528_1000219 3300003790 Bacteria 48163
9 Ga0055530_10011461 3300003791 Bacteria 3182
10 Ga0065704_10162863 3300005289 Bacteria 1342
11 Ga0070670_100000133 3300005331 Bacteria 69691
12 Ga0075368_10031555 3300006042 Bacteria 2055
13 Ga0075362_10032987 3300006177 Bacteria 2250
14 Ga0075366_10001244 3300006195 Bacteria 12652
15 Ga0075370_10001967 3300006353 Bacteria 9292
16 Ga0105250_10000145 3300009092 Bacteria 62334
17 Ga0105243_10334608 3300009148 Bacteria 1384
18 Ga0157373_10048198 3300013100 Bacteria 3038
19 Ga0157371_10000619 3300013102 Bacteria 42290
20 Ga0157371_10003124 3300013102 Bacteria 15308
21 Ga0157370_10000661 3300013104 Bacteria 42855
22 Ga0157370_10030874 3300013104 Bacteria 5248
23 Ga0157370_10051445 3300013104 Bacteria 3935
24 Ga0157375_10000050 3300013308 Bacteria 134913
25 Ga0182005_1000019 3300015265 Bacteria 296232
26 Ga0183363_1005 3300015690 Bacteria 403020
27 Ga0163161_10009209 3300017792 Bacteria 6827
28 Ga0163161_10089997 3300017792 Bacteria 2270
29 Ga0228711_1008201 3300022739 Bacteria 14772
30 Ga0228710_1004154 3300022740 Bacteria 22854
31 Ga0209435_100052 3300025206 Bacteria 89472
32 Ga0209566_100384 3300025225 Bacteria 35773
33 Ga0209672_104165 3300025228 Bacteria 2756
34 Ga0209147_100145 3300025229 Bacteria 106552
35 Ga0209646_1000163 3300025246 Bacteria 89472
36 Ga0209026_1000190 3300025250 Bacteria 89460
37 Ga0209759_1000213 3300025256 Bacteria 89473
38 Ga0209673_1000005 3300025273 Bacteria 692788
39 Ga0209025_1002147 3300025294 Bacteria 22059
40 Ga0209564_1000069 3300025295 Bacteria 303332
41 Ga0209564_1028957 3300025295 Bacteria 1755
42 Ga0209050_1000682 3300025298 Bacteria 51096
43 Ga0209256_1001571 3300025299 Bacteria 22472
44 Ga0207696_1000002 3300025711 Bacteria 1098043
45 Ga0207655_1014076 3300025728 Bacteria 4544
46 Ga0207650_10000592 3300025925 Bacteria 29057
47 Ga0207698_10283479 3300026142 Bacteria 1534
48 Ga0209371_1001295 3300027312 Bacteria 17563
49 Ga0209813_10016096 3300027866 Bacteria 2036
50 Ga0268256_1000028 3300030500 Bacteria 433179
51 Ga0307412_10000301 3300031911 Bacteria 31415
52 Ga0495617_004155 3300046452 Bacteria 5305
53 Ga0495591_000151 3300046458 Bacteria 73402
54 Ga0495591_016073 3300046458 Unclassified 2620
55 Ga0495638_0000386 3300046460 Bacteria 54523
56 Ga0495653_0007075 3300046463 Bacteria 9202
57 Ga0495650_0001543 3300046471 Bacteria 21838
58 Ga0495605_0000054 3300046474 Bacteria 157560
59 Ga0495584_0002373 3300046491 Bacteria 10710
60 Ga0495585_0030945 3300046492 Bacteria 3042
61 Ga0495596_0001701 3300046500 Bacteria 12413
62 Ga0495596_0005992 3300046500 Bacteria 5670
63 Ga0495607_0000002 3300046501 Bacteria 414833
64 Ga0495607_0001715 3300046501 Bacteria 18792
65 Ga0495607_0001999 3300046501 Bacteria 17153
66 Ga0495607_0002220 3300046501 Bacteria 16077
67 Ga0495607_0105985 3300046501 Bacteria 1497
68 Ga0495583_0002038 3300046506 Bacteria 18400
69 Ga0495606_0000300 3300046507 Bacteria 85461
70 Ga0495606_0000794 3300046507 Bacteria 48239
71 Ga0495606_0001251 3300046507 Bacteria 35455
72 Ga0495606_0071431 3300046507 Bacteria 2185
73 Ga0495610_0002496 3300046512 Bacteria 15375
74 Ga0495610_0007600 3300046512 Bacteria 7177
75 Ga0495610_0023282 3300046512 Bacteria 3371
76 Ga0495616_0034525 3300046513 Bacteria 2627
77 Ga0495620_0000136 3300046515 Bacteria 60464
78 Ga0495620_0000484 3300046515 Bacteria 25815
79 Ga0495620_0030174 3300046515 Bacteria 2500
80 Ga0495630_0006110 3300046517 Bacteria 8536
81 Ga0495632_0001029 3300046519 Bacteria 24117
82 Ga0495632_0003985 3300046519 Bacteria 10218
83 Ga0495637_0000092 3300046520 Bacteria 70294
84 Ga0495643_0000492 3300046522 Bacteria 49769
85 Ga0495643_0004143 3300046522 Bacteria 10307
86 Ga0495644_0000858 3300046523 Bacteria 12550
87 Ga0495648_0000713 3300046524 Bacteria 35458
88 Ga0495648_0001918 3300046524 Bacteria 19812
89 Ga0495648_0098209 3300046524 Bacteria 1622
90 Ga0495663_0000035 3300046525 Bacteria 72251
91 Ga0495666_0003268 3300046526 Bacteria 8177
92 Ga0495665_0005019 3300046531 Bacteria 7134
93 Ga0495640_0114057 3300046533 Bacteria 1762
94 Ga0495611_0000530 3300046648 Bacteria 22502
95 Ga0495625_0000322 3300046660 Bacteria 72914
96 Ga0495625_0002661 3300046660 Bacteria 19020
97 Ga0495661_0000001 3300046665 Bacteria 898372
98 Ga0495661_0000033 3300046665 Bacteria 168033
99 Ga0495661_0079882 3300046665 Bacteria 1889
100 Ga0495623_0001620 3300046679 Bacteria 15120
101 Ga0495646_0006062 3300046680 Bacteria 7668
102 Ga0495613_0013925 3300046689 Bacteria 5968
103 Ga0495624_0007641 3300046690 Bacteria 7590
104 Ga0495670_0001019 3300046691 Bacteria 13614
105 Ga0495671_0001312 3300046692 Bacteria 16904
106 Ga0495671_0005914 3300046692 Bacteria 7113
107 Ga0495649_0001308 3300046694 Bacteria 19038
108 Ga0495649_0009642 3300046694 Bacteria 5724
109 Ga0495649_0018342 3300046694 Bacteria 3938
110 Ga0495589_0000763 3300046794 Bacteria 20550
111 Ga0495589_0133508 3300046794 Bacteria 1191
112 Ga0495600_0202501 3300046809 Bacteria 1274
113 Ga0495581_0020656 3300047315 Bacteria 3819
114 Ga0495674_0039781 3300047319 Bacteria 4211
115 Ga0495672_0001648 3300047320 Bacteria 21695
116 Ga0495672_0052881 3300047320 Bacteria 2383
117 Ga0495676_0039602 3300047321 Bacteria 3901
118 Ga0495680_0014578 3300047322 Bacteria 6804
119 Ga0495687_000202 3300047443 Bacteria 84886
120 Ga0495687_078788 3300047443 Bacteria 1297
121 Ga0495675_0001643 3300047444 Bacteria 13408
122 Ga0495679_001008 3300047446 Bacteria 17324
123 Ga0495673_0001553 3300047469 Bacteria 17990
124 Ga0495673_0036943 3300047469 Bacteria 2235
125 Ga0495673_0049775 3300047469 Bacteria 1843
126 Ga0495681_0000170 3300047470 Bacteria 54525
127 Ga0495681_0003143 3300047470 Bacteria 11558
128 Ga0495681_0010553 3300047470 Bacteria 5587
129 Ga0495681_0031720 3300047470 Bacteria 2670
130 Ga0495686_0000531 3300047472 Bacteria 54712
131 Ga0495686_0000670 3300047472 Bacteria 46425
132 Ga0495686_0038271 3300047472 Bacteria 3068
133 Ga0495686_0059429 3300047472 Bacteria 2380
134 Ga0495602_0062204 3300048088 Bacteria 3239
135 Ga0495614_0032047 3300048089 Bacteria 2262
136 Ga0495626_0000852 3300048091 Bacteria 27166
137 Ga0496111_0000142 3300048914 Bacteria 32155
138 Ga0496116_0006559 3300048919 Bacteria 10536
139 Ga0496117_0044664 3300048920 Bacteria 3207
140 Ga0496118_0127989 3300048921 Bacteria 1637
141 Ga0496119_0012137 3300048922 Bacteria 7035
142 Ga0496121_0005514 3300048924 Bacteria 16166
143 Ga0496121_0009974 3300048924 Bacteria 10802
144 Ga0496121_0058990 3300048924 Bacteria 3167
145 Ga0496121_0074334 3300048924 Bacteria 2719
146 Ga0496122_0003047 3300048925 Bacteria 22665
147 Ga0496122_0003621 3300048925 Bacteria 20112
148 Ga0496122_0131886 3300048925 Bacteria 1585
149 Ga0496123_0002549 3300048926 Bacteria 22213
150 Ga0496123_0006407 3300048926 Bacteria 11412
151 Ga0496124_0000800 3300048927 Bacteria 51160
152 Ga0496124_0001909 3300048927 Bacteria 28595
153 Ga0496124_0006380 3300048927 Bacteria 12861
154 Ga0496124_0007309 3300048927 Bacteria 11779
155 Ga0496124_0011501 3300048927 Bacteria 8839
156 Ga0496124_0032758 3300048927 Bacteria 4583
157 Ga0496124_0097495 3300048927 Bacteria 2387
158 Ga0496125_0223814 3300048928 Bacteria 1210
159 Ga0496125_0257352 3300048928 Bacteria 1096
160 Ga0496126_0009058 3300048929 Bacteria 10639
161 Ga0496126_0056305 3300048929 Bacteria 3555
162 Ga0496126_0260625 3300048929 Bacteria 1442
163 Ga0495678_000858 3300049459 Bacteria 27076
164 Ga0495678_002087 3300049459 Bacteria 14209
165 Ga0495682_0000025 3300049460 Bacteria 147931
166 Ga0495682_0000826 3300049460 Bacteria 19395
167 Ga0495682_0001338 3300049460 Bacteria 13616
168 nmdc:mga00v17_202818_c1 3300050491 Bacteria 1282
169 nmdc:mga0k408_1522_c1 3300050493 Bacteria 12523
170 nmdc:mga06z11_297_c1 3300050494 Bacteria 17486
171 nmdc:mga04h51_12032_c1 3300050495 Bacteria 2418
172 nmdc:mga07m45_1036_c1 3300050496 Bacteria 12352
173 nmdc:mga07m45_104_c1 3300050496 Bacteria 33217
174 Ga0500578_0042326 3300053086 Bacteria 2925
175 Ga0500583_0000668 3300053092 Bacteria 10094
176 Ga0500641_0021485 3300053096 Bacteria 2461
177 Ga0500608_000522 3300053122 Bacteria 14350
178 Ga0500618_001058 3300053125 Bacteria 13668
179 Ga0500568_0009318 3300053139 Bacteria 4674
180 Ga0500574_000054 3300053141 Bacteria 13645
181 Ga0500616_0009791 3300053153 Bacteria 5783
182 Ga0500638_000026 3300053162 Bacteria 55912
183 Ga0500636_0000062 3300053177 Bacteria 52263
184 Ga0500567_062631 3300053723 Bacteria 1660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0000484 Ga0495620_0000484_218_1120 276
2 3300046501 Ga0495607_0105985 Ga0495607_0105985_543_1439 281
3 iso_pu_bacteria 2643221653 2644300913 285
4 iso_pu_bacteria 2643221719 2644659135 285
5 3300048927 Ga0496124_0001909 Ga0496124_0001909_14257_15312 289
6 3300046794 Ga0495589_0000763 Ga0495589_0000763_4314_5210 294
7 3300047446 Ga0495679_001008 Ga0495679_001008_12253_13149 294
8 iso_pu_bacteria 2585427531 2585564314 295
9 iso_pu_bacteria 2585427609 2585903203 295
10 iso_pu_bacteria 2585428125 2587978631 295
11 iso_pu_bacteria 2928526807 2928528372 296
12 3300017792 Ga0163161_10009209 Ga0163161_100092092 301
13 3300046512 Ga0495610_0007600 Ga0495610_0007600_5877_6854 301
14 3300047470 Ga0495681_0031720 Ga0495681_0031720_133_1110 301
15 3300046507 Ga0495606_0000794 Ga0495606_0000794_25920_26888 305
16 3300013308 Ga0157375_10000050 Ga0157375_1000005047 309
17 3300025728 Ga0207655_1014076 Ga0207655_10140765 309
18 3300017792 Ga0163161_10089997 Ga0163161_100899972 312
19 3300048928 Ga0496125_0257352 Ga0496125_0257352_102_1043 312
20 3300003760 Ga0055527_1004690 Ga0055527_10046902 313
21 3300025228 Ga0209672_104165 Ga0209672_1041653 313
22 3300047472 Ga0495686_0000670 Ga0495686_0000670_42398_43342 313
23 3300048928 Ga0496125_0223814 Ga0496125_0223814_206_1150 313
24 3300005331 Ga0070670_100000133 Ga0070670_10000013365 314
25 3300013100 Ga0157373_10048198 Ga0157373_100481982 314
26 3300025925 Ga0207650_10000592 Ga0207650_1000059220 314
27 iso_pu_bacteria 2945961074 2945964008 314
28 3300013104 Ga0157370_10051445 Ga0157370_100514453 315
29 3300026142 Ga0207698_10283479 Ga0207698_102834792 315
30 iso_pu_bacteria 2946006987 2946009508 317
31 iso_pu_bacteria 2734482264 2735835131 319
32 iso_pu_bacteria 2919085039 2919088583 319
33 3300025225 Ga0209566_100384 Ga0209566_1003845 320
34 3300046458 Ga0495591_000151 Ga0495591_000151_45475_46452 321
35 3300046519 Ga0495632_0001029 Ga0495632_0001029_17740_18717 321
36 3300046665 Ga0495661_0000033 Ga0495661_0000033_130274_131251 321
37 3300047320 Ga0495672_0052881 Ga0495672_0052881_1347_2321 321
38 3300047469 Ga0495673_0049775 Ga0495673_0049775_548_1534 321
39 3300047470 Ga0495681_0010553 Ga0495681_0010553_133_1110 321
40 iso_pu_bacteria 2758568016 2758642687 321
41 iso_pu_bacteria 2840764183 2840768613 321
42 iso_pu_bacteria 2501025502 2501079765 322
43 iso_pu_bacteria 2510917013 2511094103 322
44 iso_pu_bacteria 2599185239 2599734843 322
45 iso_pu_bacteria 2643221558 2643814191 322
46 iso_pu_bacteria 2671180115 2671586678 322
47 iso_pu_bacteria 2775507049 2776910964 322
48 iso_pu_bacteria 2818991452 2819635791 322
49 iso_pu_bacteria 2928170801 2928175218 322
50 iso_pu_bacteria 3005416602 3005416688 322
51 iso_pu_bacteria 8005314921 8005320669 322
52 iso_pu_bacteria 8018845410 8018847830 322
53 iso_pu_bacteria 8021120328 8021121872 322
54 3300013104 Ga0157370_10030874 Ga0157370_100308743 323
55 3300015265 Ga0182005_1000019 Ga0182005_1000019175 323
56 3300046501 Ga0495607_0000002 Ga0495607_0000002_314310_315287 323
57 3300046501 Ga0495607_0001715 Ga0495607_0001715_14151_15155 323
58 3300046507 Ga0495606_0071431 Ga0495606_0071431_928_1941 323
59 3300046515 Ga0495620_0030174 Ga0495620_0030174_1202_2200 323
60 3300048925 Ga0496122_0003621 Ga0496122_0003621_1509_2492 323
61 3300048926 Ga0496123_0006407 Ga0496123_0006407_7800_8783 323
62 3300048929 Ga0496126_0009058 Ga0496126_0009058_7695_8678 323
63 iso_pu_bacteria 2558860242 2559298590 323
64 iso_pu_bacteria 2593339239 2595452284 323
65 iso_pu_bacteria 2599185156 2599336390 323
66 iso_pu_bacteria 2599185354 2600202060 323
67 iso_pu_bacteria 2599185354 2600203769 323
68 iso_pu_bacteria 2599185359 2600225251 323
69 iso_pu_bacteria 2808606387 2808989955 323
70 iso_pu_bacteria 2818991438 2819552752 323
71 iso_pu_bacteria 2818991439 2819561646 323
72 iso_pu_bacteria 2818991466 2819712268 323
73 iso_pu_bacteria 2838029111 2838033553 323
74 iso_pu_bacteria 2838714209 2838718535 323
75 iso_pu_bacteria 2838719591 2838723534 323
76 iso_pu_bacteria 2842170452 2842174868 323
77 iso_pu_bacteria 2842187318 2842191349 323
78 iso_pu_bacteria 2842211629 2842215577 323
79 iso_pu_bacteria 2842224351 2842228298 323
80 iso_pu_bacteria 2842475841 2842480175 323
81 iso_pu_bacteria 2842502639 2842508055 323
82 iso_pu_bacteria 2842780639 2842782363 323
83 iso_pu_bacteria 2842871566 2842873029 323
84 iso_pu_bacteria 2852653556 2852653729 323
85 iso_pu_bacteria 2899845264 2899846855 323
86 iso_pu_bacteria 2928968154 2928972519 323
87 iso_pu_bacteria 2984509177 2984514262 323
88 iso_pu_bacteria 2984518228 2984523293 323
89 iso_pu_bacteria 2984537506 2984542685 323
90 iso_pu_bacteria 650716007 650741442 323
91 3300005289 Ga0065704_10162863 Ga0065704_101628631 326
92 3300015690 Ga0183363_1005 Ga0183363_100557 326
93 3300025229 Ga0209147_100145 Ga0209147_10014521 326
94 3300027312 Ga0209371_1001295 Ga0209371_100129511 326
95 3300030500 Ga0268256_1000028 Ga0268256_1000028400 326
96 3300046452 Ga0495617_004155 Ga0495617_004155_4001_5014 326
97 3300046460 Ga0495638_0000386 Ga0495638_0000386_12421_13434 326
98 3300046492 Ga0495585_0030945 Ga0495585_0030945_244_1257 326
99 3300046522 Ga0495643_0000492 Ga0495643_0000492_43944_44957 326
100 3300046524 Ga0495648_0000713 Ga0495648_0000713_21760_22773 326
101 3300046525 Ga0495663_0000035 Ga0495663_0000035_12416_13429 326
102 3300046648 Ga0495611_0000530 Ga0495611_0000530_12423_13436 326
103 3300046660 Ga0495625_0000322 Ga0495625_0000322_59490_60503 326
104 3300046665 Ga0495661_0079882 Ga0495661_0079882_274_1287 326
105 3300046689 Ga0495613_0013925 Ga0495613_0013925_4721_5734 326
106 3300046691 Ga0495670_0001019 Ga0495670_0001019_12311_13324 326
107 3300046692 Ga0495671_0001312 Ga0495671_0001312_12414_13427 326
108 3300046694 Ga0495649_0009642 Ga0495649_0009642_3024_4037 326
109 3300047443 Ga0495687_000202 Ga0495687_000202_12848_13861 326
110 3300047470 Ga0495681_0000170 Ga0495681_0000170_12679_13692 326
111 3300047472 Ga0495686_0000531 Ga0495686_0000531_12428_13441 326
112 3300048920 Ga0496117_0044664 Ga0496117_0044664_1262_2248 326
113 3300048921 Ga0496118_0127989 Ga0496118_0127989_562_1548 326
114 3300048924 Ga0496121_0074334 Ga0496121_0074334_127_1113 326
115 3300049459 Ga0495678_002087 Ga0495678_002087_818_1831 326
116 3300049460 Ga0495682_0001338 Ga0495682_0001338_12425_13438 326
117 3300050496 nmdc:mga07m45_1036_c1 nmdc:mga07m45_1036_c1_6514_7527 326
118 3300053086 Ga0500578_0042326 Ga0500578_0042326_1733_2746 326
119 3300053092 Ga0500583_0000668 Ga0500583_0000668_2066_3079 326
120 3300053122 Ga0500608_000522 Ga0500608_000522_922_1935 326
121 3300053125 Ga0500618_001058 Ga0500618_001058_12439_13452 326
122 3300053141 Ga0500574_000054 Ga0500574_000054_217_1230 326
123 3300053162 Ga0500638_000026 Ga0500638_000026_10773_11786 326
124 3300053177 Ga0500636_0000062 Ga0500636_0000062_12438_13451 326
125 3300053723 Ga0500567_062631 Ga0500567_062631_547_1560 326
126 3300002704 JGI25155J39150_1000040 JGI25155J39150_100004086 327
127 3300002705 JGI25156J39149_1000051 JGI25156J39149_10000518 327
128 3300002738 JGI25154J39366_1000079 JGI25154J39366_10000798 327
129 3300002741 JGI25157J39369_1000168 JGI25157J39369_100016852 327
130 3300003771 Ga0055526_1000009 Ga0055526_100000957 327
131 3300003775 Ga0055524_1010631 Ga0055524_10106314 327
132 3300003790 Ga0055528_1000219 Ga0055528_10002198 327
133 3300003791 Ga0055530_10011461 Ga0055530_100114614 327
134 3300006042 Ga0075368_10031555 Ga0075368_100315552 327
135 3300006177 Ga0075362_10032987 Ga0075362_100329872 327
136 3300006195 Ga0075366_10001244 Ga0075366_1000124410 327
137 3300006353 Ga0075370_10001967 Ga0075370_1000196713 327
138 3300009092 Ga0105250_10000145 Ga0105250_1000014537 327
139 3300009148 Ga0105243_10334608 Ga0105243_103346081 327
140 3300013102 Ga0157371_10000619 Ga0157371_1000061944 327
141 3300013102 Ga0157371_10003124 Ga0157371_100031242 327
142 3300013104 Ga0157370_10000661 Ga0157370_1000066122 327
143 3300022739 Ga0228711_1008201 Ga0228711_100820113 327
144 3300022740 Ga0228710_1004154 Ga0228710_10041543 327
145 3300025206 Ga0209435_100052 Ga0209435_10005282 327
146 3300025246 Ga0209646_1000163 Ga0209646_100016382 327
147 3300025250 Ga0209026_1000190 Ga0209026_100019082 327
148 3300025256 Ga0209759_1000213 Ga0209759_10002137 327
149 3300025273 Ga0209673_1000005 Ga0209673_1000005659 327
150 3300025294 Ga0209025_1002147 Ga0209025_100214718 327
151 3300025295 Ga0209564_1000069 Ga0209564_1000069154 327
152 3300025295 Ga0209564_1028957 Ga0209564_10289572 327
153 3300025298 Ga0209050_1000682 Ga0209050_100068218 327
154 3300025299 Ga0209256_1001571 Ga0209256_10015717 327
155 3300025711 Ga0207696_1000002 Ga0207696_1000002705 327
156 3300027866 Ga0209813_10016096 Ga0209813_100160962 327
157 3300031911 Ga0307412_10000301 Ga0307412_100003019 327
158 3300046458 Ga0495591_016073 Ga0495591_016073_262_1251 327
159 3300046463 Ga0495653_0007075 Ga0495653_0007075_5655_6650 327
160 3300046471 Ga0495650_0001543 Ga0495650_0001543_6240_7229 327
161 3300046474 Ga0495605_0000054 Ga0495605_0000054_14458_15447 327
162 3300046491 Ga0495584_0002373 Ga0495584_0002373_5099_6088 327
163 3300046500 Ga0495596_0001701 Ga0495596_0001701_472_1530 327
164 3300046500 Ga0495596_0005992 Ga0495596_0005992_4162_5154 327
165 3300046501 Ga0495607_0001999 Ga0495607_0001999_12653_13660 327
166 3300046501 Ga0495607_0002220 Ga0495607_0002220_1846_2835 327
167 3300046506 Ga0495583_0002038 Ga0495583_0002038_12488_13483 327
168 3300046507 Ga0495606_0000300 Ga0495606_0000300_5843_6832 327
169 3300046507 Ga0495606_0001251 Ga0495606_0001251_5390_6382 327
170 3300046512 Ga0495610_0002496 Ga0495610_0002496_14335_15327 327
171 3300046512 Ga0495610_0023282 Ga0495610_0023282_25_1056 327
172 3300046513 Ga0495616_0034525 Ga0495616_0034525_274_1263 327
173 3300046515 Ga0495620_0000136 Ga0495620_0000136_45050_46039 327
174 3300046517 Ga0495630_0006110 Ga0495630_0006110_4989_5984 327
175 3300046519 Ga0495632_0003985 Ga0495632_0003985_3958_4947 327
176 3300046520 Ga0495637_0000092 Ga0495637_0000092_54769_55758 327
177 3300046522 Ga0495643_0004143 Ga0495643_0004143_48_1037 327
178 3300046523 Ga0495644_0000858 Ga0495644_0000858_7330_8319 327
179 3300046524 Ga0495648_0001918 Ga0495648_0001918_6330_7325 327
180 3300046524 Ga0495648_0098209 Ga0495648_0098209_51_1049 327
181 3300046526 Ga0495666_0003268 Ga0495666_0003268_2582_3577 327
182 3300046531 Ga0495665_0005019 Ga0495665_0005019_5565_6560 327
183 3300046533 Ga0495640_0114057 Ga0495640_0114057_176_1171 327
184 3300046660 Ga0495625_0002661 Ga0495625_0002661_3637_4629 327
185 3300046665 Ga0495661_0000001 Ga0495661_0000001_503851_504840 327
186 3300046679 Ga0495623_0001620 Ga0495623_0001620_6095_7090 327
187 3300046680 Ga0495646_0006062 Ga0495646_0006062_337_1332 327
188 3300046690 Ga0495624_0007641 Ga0495624_0007641_5977_6972 327
189 3300046692 Ga0495671_0005914 Ga0495671_0005914_1497_2486 327
190 3300046694 Ga0495649_0001308 Ga0495649_0001308_4315_5310 327
191 3300046694 Ga0495649_0018342 Ga0495649_0018342_1314_2303 327
192 3300046794 Ga0495589_0133508 Ga0495589_0133508_103_1098 327
193 3300046809 Ga0495600_0202501 Ga0495600_0202501_260_1255 327
194 3300047315 Ga0495581_0020656 Ga0495581_0020656_2205_3200 327
195 3300047319 Ga0495674_0039781 Ga0495674_0039781_294_1289 327
196 3300047320 Ga0495672_0001648 Ga0495672_0001648_8595_9581 327
197 3300047321 Ga0495676_0039602 Ga0495676_0039602_1791_2786 327
198 3300047322 Ga0495680_0014578 Ga0495680_0014578_5633_6628 327
199 3300047443 Ga0495687_078788 Ga0495687_078788_34_1029 327
200 3300047444 Ga0495675_0001643 Ga0495675_0001643_5446_6441 327
201 3300047469 Ga0495673_0001553 Ga0495673_0001553_12478_13473 327
202 3300047469 Ga0495673_0036943 Ga0495673_0036943_509_1498 327
203 3300047470 Ga0495681_0003143 Ga0495681_0003143_7142_8131 327
204 3300047472 Ga0495686_0038271 Ga0495686_0038271_478_1467 327
205 3300047472 Ga0495686_0059429 Ga0495686_0059429_146_1153 327
206 3300048088 Ga0495602_0062204 Ga0495602_0062204_2068_3063 327
207 3300048089 Ga0495614_0032047 Ga0495614_0032047_1170_2165 327
208 3300048091 Ga0495626_0000852 Ga0495626_0000852_2199_3257 327
209 3300048914 Ga0496111_0000142 Ga0496111_0000142_23453_24451 327
210 3300048919 Ga0496116_0006559 Ga0496116_0006559_4300_5379 327
211 3300048922 Ga0496119_0012137 Ga0496119_0012137_5767_6768 327
212 3300048924 Ga0496121_0005514 Ga0496121_0005514_12498_13514 327
213 3300048924 Ga0496121_0009974 Ga0496121_0009974_4933_5925 327
214 3300048924 Ga0496121_0058990 Ga0496121_0058990_1593_2672 327
215 3300048925 Ga0496122_0003047 Ga0496122_0003047_119_1198 327
216 3300048925 Ga0496122_0131886 Ga0496122_0131886_179_1177 327
217 3300048926 Ga0496123_0002549 Ga0496123_0002549_9449_10528 327
218 3300048927 Ga0496124_0000800 Ga0496124_0000800_49141_50133 327
219 3300048927 Ga0496124_0006380 Ga0496124_0006380_9513_10514 327
220 3300048927 Ga0496124_0007309 Ga0496124_0007309_1220_2236 327
221 3300048927 Ga0496124_0011501 Ga0496124_0011501_5412_6491 327
222 3300048927 Ga0496124_0032758 Ga0496124_0032758_2564_3556 327
223 3300048927 Ga0496124_0097495 Ga0496124_0097495_51_1049 327
224 3300048929 Ga0496126_0056305 Ga0496126_0056305_1411_2445 327
225 3300048929 Ga0496126_0260625 Ga0496126_0260625_231_1271 327
226 3300049459 Ga0495678_000858 Ga0495678_000858_24792_25781 327
227 3300049460 Ga0495682_0000025 Ga0495682_0000025_132595_133584 327
228 3300049460 Ga0495682_0000826 Ga0495682_0000826_5913_6908 327
229 3300050491 nmdc:mga00v17_202818_c1 nmdc:mga00v17_202818_c1_181_1215 327
230 3300050493 nmdc:mga0k408_1522_c1 nmdc:mga0k408_1522_c1_5973_7007 327
231 3300050494 nmdc:mga06z11_297_c1 nmdc:mga06z11_297_c1_5136_6170 327
232 3300050495 nmdc:mga04h51_12032_c1 nmdc:mga04h51_12032_c1_953_1987 327
233 3300050496 nmdc:mga07m45_104_c1 nmdc:mga07m45_104_c1_23825_24859 327
234 3300053096 Ga0500641_0021485 Ga0500641_0021485_104_1225 327
235 3300053139 Ga0500568_0009318 Ga0500568_0009318_2071_3192 327
236 3300053153 Ga0500616_0009791 Ga0500616_0009791_2802_3923 327
237 iso_pu_bacteria 2511231027 2511389362 327
238 iso_pu_bacteria 2926760298 2926765343 327
239 iso_pu_bacteria 2979089926 2979095413 327
240 iso_pu_bacteria 2979095461 2979097666 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

143

343

0.95

PF10340

Say1_Mug180

Steryl acetyl hydrolase

172

294

0.87

PF20434

BD-FAE

BD-FAE

130

294

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q05-assembly1.cif.gz_B crystal structure of an esterase e25 0.922 7 323
3d7r-assembly2.cif.gz_B crystal structure of a putative esterase from staphylococcus aureus 0.9073 76 321
7at4-assembly1.cif.gz_A structure of estd11 in complex with naproxen 0.9033 22 326
7at4-assembly1.cif.gz_A structure of estd11 in complex with naproxen 0.8917 22 326
5mif-assembly2.cif.gz_B crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum 0.89 76 326
ID Description Score Start End Superfamily
4q05B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.922 7 323 3.40.50.1820
af_I6Y2J4_205_430_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9029 79 319 3.40.50.1820
af_Q2G2W3_3_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9026 76 321 3.40.50.1820
4q3oF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8889 18 322 3.40.50.1820
af_I6Y2J4_205_430_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8764 79 319 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A558QV57-F1-model_v4 Alpha/beta hydrolase 0.9927 164 323 GO:0004806
AF-K2QKB8-F1-model_v4 Esterase/lipase/thioesterase family protein 0.9833 106 326 GO:0004806
AF-A0A839YJX2-F1-model_v4 Acetyl esterase/lipase 0.983 1 323 GO:0004806
AF-A0A829N4C8-F1-model_v4 deleted 0.9774 29 323
AF-A0A0A2VT47-F1-model_v4 Monoterpene epsilon-lactone hydrolase 0.9773 3 326 GO:0016491
GO:0016787

Feature Viewer

pLDDT pTM Quality
93.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map