F353282

General Info

Members Datasets Scaffolds Average Seq Length
240 143 480 199

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0254611|Ga0501081_0254611_395_1078
Length 227
Sequence MTVIASNILARSFHAVFACASFFGMSFTQYLKILAHPVFTGLNFHMPMVVDLSHPLIMLKGENGSGKSTLLHSLHFALRGEQVEGYVYRTEVQGIDPKNVMLFDAEQHNPRHQLHLFEGNPAMKEFLSTASHGQVMLSLFRESFPKLPDGTVLLLDEPEMALSQSNQRRILKMLKELVDHKKFRIVTATHSPALIDDPETYVIDLDRHVNRNVVPEDMGVEGQSTLH

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0254611 3300049743 Bacteria 1282
2 rootH2_10157007 3300003320 Bacteria 1303
3 Ga0070658_10008163 3300005327 Bacteria 8418
4 Ga0070658_10945963 3300005327 Bacteria 749
5 Ga0070683_100000004 3300005329 Bacteria 373231
6 Ga0070683_100019059 3300005329 Bacteria 6088
7 Ga0070683_100208957 3300005329 Bacteria 1854
8 Ga0070666_10409762 3300005335 Bacteria 975
9 Ga0070680_100028973 3300005336 Bacteria 4445
10 Ga0068868_100646363 3300005338 Bacteria 941
11 Ga0070660_100317461 3300005339 Bacteria 1279
12 Ga0070709_10210560 3300005434 Bacteria 1382
13 Ga0070714_100017030 3300005435 Bacteria 5882
14 Ga0070714_101166756 3300005435 Unclassified 751
15 Ga0070713_100004015 3300005436 Bacteria 9799
16 Ga0070681_10070887 3300005458 Bacteria 3450
17 Ga0070681_10363638 3300005458 Bacteria 1357
18 Ga0070681_10379012 3300005458 Unclassified 1325
19 Ga0070681_10386477 3300005458 Bacteria 1310
20 Ga0068867_100374598 3300005459 Bacteria 1194
21 Ga0068867_100798842 3300005459 Bacteria 841
22 Ga0070699_100188425 3300005518 Bacteria 1832
23 Ga0070679_100076558 3300005530 Bacteria 3335
24 Ga0070679_100252626 3300005530 Bacteria 1719
25 Ga0070684_100000009 3300005535 Bacteria 209881
26 Ga0068853_100841783 3300005539 Bacteria 880
27 Ga0070696_100003432 3300005546 Bacteria 10562
28 Ga0070665_100031628 3300005548 Bacteria 5327
29 Ga0068855_100033860 3300005563 Bacteria 6093
30 Ga0068855_100107107 3300005563 Bacteria 3212
31 Ga0068855_100258307 3300005563 Bacteria 1941
32 Ga0070664_101321774 3300005564 Bacteria 681
33 Ga0068857_100924183 3300005577 Unclassified 837
34 Ga0068856_100089346 3300005614 Bacteria 3064
35 Ga0068856_100273635 3300005614 Bacteria 1705
36 Ga0068852_100067235 3300005616 Bacteria 3133
37 Ga0068863_100038939 3300005841 Bacteria 4524
38 Ga0070717_10013445 3300006028 Bacteria 6274
39 Ga0070717_10342504 3300006028 Bacteria 1335
40 Ga0070717_10393087 3300006028 Unclassified 1245
41 Ga0070717_10639726 3300006028 Bacteria 965
42 Ga0070717_10907677 3300006028 Bacteria 802
43 Ga0070716_100582091 3300006173 Bacteria 839
44 Ga0070712_100358462 3300006175 Bacteria 1195
45 Ga0097621_100730365 3300006237 Bacteria 913
46 Ga0068871_100560963 3300006358 Bacteria 1035
47 Ga0068871_100638247 3300006358 Bacteria 971
48 Ga0075428_100729445 3300006844 Bacteria 1055
49 Ga0075433_10781951 3300006852 Unclassified 834
50 Ga0075436_100000570 3300006914 Bacteria 24112
51 Ga0075436_100721977 3300006914 Bacteria 739
52 Ga0105240_10001488 3300009093 Bacteria 39873
53 Ga0105240_10003530 3300009093 Bacteria 24260
54 Ga0105240_10053614 3300009093 Bacteria 5061
55 Ga0105240_10190524 3300009093 Bacteria 2412
56 Ga0105240_11027052 3300009093 Bacteria 880
57 Ga0105245_10538435 3300009098 Bacteria 1188
58 Ga0105245_10634053 3300009098 Bacteria 1098
59 Ga0114129_10119470 3300009147 Bacteria 3630
60 Ga0114129_10974717 3300009147 Bacteria 1069
61 Ga0105241_10354420 3300009174 Unclassified 1275
62 Ga0105241_10431473 3300009174 Bacteria 1162
63 Ga0105242_11666545 3300009176 Bacteria 673
64 Ga0105248_10013205 3300009177 Bacteria 9092
65 Ga0105248_10142529 3300009177 Bacteria 2703
66 Ga0105248_11210628 3300009177 Bacteria 854
67 Ga0105248_11299518 3300009177 Bacteria 823
68 Ga0105248_11562235 3300009177 Bacteria 747
69 Ga0105237_10004035 3300009545 Bacteria 17147
70 Ga0105237_10033421 3300009545 Bacteria 5210
71 Ga0105237_10868707 3300009545 Unclassified 909
72 Ga0105238_10235632 3300009551 Bacteria 1807
73 Ga0105249_10027281 3300009553 Bacteria 5152
74 Ga0157371_10743557 3300013102 Unclassified 736
75 Ga0157370_10006867 3300013104 Bacteria 12465
76 Ga0157370_10088376 3300013104 Bacteria 2910
77 Ga0157370_10195192 3300013104 Bacteria 1879
78 Ga0157370_10536326 3300013104 Bacteria 1073
79 Ga0157370_10910587 3300013104 Bacteria 798
80 Ga0157369_10001528 3300013105 Bacteria 28371
81 Ga0157369_10224970 3300013105 Bacteria 1963
82 Ga0157369_10239296 3300013105 Unclassified 1896
83 Ga0157369_10302878 3300013105 Bacteria 1662
84 Ga0157369_11030620 3300013105 Bacteria 842
85 Ga0157374_10172232 3300013296 Bacteria 2112
86 Ga0157378_10916012 3300013297 Unclassified 908
87 Ga0163162_10659084 3300013306 Unclassified 1170
88 Ga0163162_12253994 3300013306 Bacteria 625
89 Ga0157372_10140018 3300013307 Bacteria 2787
90 Ga0157372_10581379 3300013307 Bacteria 1305
91 Ga0157375_10387889 3300013308 Bacteria 1563
92 Ga0163163_10003438 3300014325 Bacteria 13454
93 Ga0163163_10023720 3300014325 Bacteria 5828
94 Ga0163163_10740395 3300014325 Unclassified 1046
95 Ga0157379_10467755 3300014968 Bacteria 1166
96 Ga0157376_10080505 3300014969 Unclassified 2794
97 Ga0157376_10258751 3300014969 Bacteria 1629
98 Ga0157376_10377649 3300014969 Unclassified 1364
99 Ga0157376_10685942 3300014969 Bacteria 1028
100 Ga0157376_11064467 3300014969 Bacteria 833
101 Ga0163161_10196717 3300017792 Bacteria 1552
102 Ga0206352_10661720 3300020078 Bacteria 972
103 Ga0206352_10838994 3300020078 Bacteria 837
104 Ga0213875_10027560 3300021388 Bacteria 2703
105 Ga0224712_10087255 3300022467 Unclassified 1300
106 Ga0207680_10590390 3300025903 Bacteria 794
107 Ga0207699_10118141 3300025906 Bacteria 1710
108 Ga0207643_10349475 3300025908 Unclassified 928
109 Ga0207705_10023313 3300025909 Bacteria 4416
110 Ga0207705_10242653 3300025909 Bacteria 1373
111 Ga0207654_10331402 3300025911 Bacteria 1043
112 Ga0207707_10042713 3300025912 Bacteria 3956
113 Ga0207707_10211652 3300025912 Archaea 1688
114 Ga0207707_10265317 3300025912 Bacteria 1489
115 Ga0207695_10011284 3300025913 Bacteria 10832
116 Ga0207695_10018768 3300025913 Bacteria 7982
117 Ga0207695_10186725 3300025913 Archaea 1991
118 Ga0207671_10013649 3300025914 Bacteria 6457
119 Ga0207693_10174895 3300025915 Bacteria 1690
120 Ga0207663_10219743 3300025916 Bacteria 1382
121 Ga0207660_10174051 3300025917 Bacteria 1668
122 Ga0207652_10139143 3300025921 Bacteria 2169
123 Ga0207652_10156067 3300025921 Bacteria 2045
124 Ga0207652_10223074 3300025921 Bacteria 1698
125 Ga0207659_10549091 3300025926 Bacteria 982
126 Ga0207700_10058398 3300025928 Bacteria 2914
127 Ga0207700_10269642 3300025928 Bacteria 1460
128 Ga0207664_10229420 3300025929 Unclassified 1613
129 Ga0207644_10058598 3300025931 Bacteria 2784
130 Ga0207686_10507187 3300025934 Bacteria 937
131 Ga0207670_10132075 3300025936 Bacteria 1831
132 Ga0207669_10392216 3300025937 Bacteria 1085
133 Ga0207691_10763362 3300025940 Unclassified 814
134 Ga0207711_10190112 3300025941 Bacteria 1871
135 Ga0207711_10788971 3300025941 Bacteria 885
136 Ga0207711_11116349 3300025941 Unclassified 729
137 Ga0207661_10000017 3300025944 Bacteria 289163
138 Ga0207661_10018546 3300025944 Bacteria 5171
139 Ga0207667_10033699 3300025949 Bacteria 5505
140 Ga0207667_10047248 3300025949 Bacteria 4557
141 Ga0207667_10686653 3300025949 Bacteria 1027
142 Ga0207651_10070008 3300025960 Bacteria 2480
143 Ga0207651_10591477 3300025960 Unclassified 969
144 Ga0207677_10401194 3300026023 Bacteria 1163
145 Ga0207677_10440231 3300026023 Bacteria 1114
146 Ga0207702_10485372 3300026078 Unclassified 1203
147 Ga0207641_10029339 3300026088 Bacteria 4548
148 Ga0207676_10386591 3300026095 Bacteria 1304
149 Ga0207676_10704449 3300026095 Bacteria 979
150 Ga0207683_10348224 3300026121 Bacteria 1359
151 Ga0207698_10086667 3300026142 Bacteria 2547
152 Ga0268266_10144384 3300028379 Unclassified 2138
153 Ga0265338_10159685 3300028800 Bacteria 1742
154 Ga0265331_10170757 3300031250 Bacteria 984
155 Ga0265316_10000993 3300031344 Bacteria 30812
156 Ga0265314_10169847 3300031711 Bacteria 1318
157 Ga0265342_10056336 3300031712 Bacteria 2330
158 Ga0373943_0137353 3300035170 Bacteria 1314
159 Ga0373943_0208787 3300035170 Bacteria 1084
160 Ga0373935_0033777 3300035692 Bacteria 3186
161 Ga0373935_0505646 3300035692 Unclassified 878
162 Ga0373927_0004067 3300035695 Bacteria 10319
163 Ga0373927_0093176 3300035695 Bacteria 1957
164 Ga0373927_0176060 3300035695 Bacteria 1403
165 Ga0373947_0000161 3300035725 Bacteria 35815
166 Ga0373947_0560652 3300035725 Bacteria 778
167 Ga0373925_0000188 3300037068 Bacteria 67960
168 Ga0373925_0059293 3300037068 Bacteria 2871
169 Ga0373925_0218139 3300037068 Bacteria 1522
170 Ga0373925_0410699 3300037068 Bacteria 1105
171 Ga0373925_0464066 3300037068 Bacteria 1038
172 Ga0373925_0586172 3300037068 Bacteria 918
173 Ga0395898_0053960 3300037466 Bacteria 3924
174 Ga0436364_0102025 3300037853 Bacteria 7854
175 Ga0436365_0827026 3300039437 Bacteria 1393
176 Ga0451577_0943254 3300042876 Bacteria 776
177 Ga0453684_1362342 3300044712 Bacteria 737
178 Ga0451576_0017184 3300045051 Bacteria 7958
179 Ga0451576_0036740 3300045051 Bacteria 5191
180 Ga0495592_0077808 3300046454 Bacteria 2403
181 Ga0495603_0476330 3300046455 Bacteria 715
182 Ga0495651_0018698 3300046462 Bacteria 5368
183 Ga0495651_0018998 3300046462 Bacteria 5325
184 Ga0495653_0056110 3300046463 Bacteria 3004
185 Ga0495580_0002010 3300046472 Bacteria 17901
186 Ga0495580_0075601 3300046472 Unclassified 2350
187 Ga0495580_0080151 3300046472 Bacteria 2277
188 Ga0495580_0392139 3300046472 Bacteria 937
189 Ga0495662_0006837 3300046476 Bacteria 5676
190 Ga0495664_0004023 3300046477 Bacteria 8023
191 Ga0495664_0347682 3300046477 Bacteria 893
192 Ga0495594_0085823 3300046499 Bacteria 1761
193 Ga0495628_0028873 3300046516 Bacteria 4503
194 Ga0495630_0004420 3300046517 Bacteria 9869
195 Ga0495652_0034171 3300046529 Bacteria 4433
196 Ga0495665_0103958 3300046531 Bacteria 1490
197 Ga0495640_0002130 3300046533 Bacteria 15799
198 Ga0495586_0141168 3300046535 Bacteria 1352
199 Ga0495587_0018235 3300046536 Bacteria 4354
200 Ga0495621_0103850 3300046539 Bacteria 1084
201 Ga0495645_0001313 3300046543 Bacteria 16884
202 Ga0495645_0179310 3300046543 Bacteria 1452
203 Ga0495667_0033559 3300046559 Bacteria 3435
204 Ga0495667_0136392 3300046559 Bacteria 1582
205 Ga0495634_0045600 3300046642 Bacteria 2962
206 Ga0495635_0021259 3300046663 Bacteria 4523
207 Ga0495635_0158622 3300046663 Bacteria 1540
208 Ga0495657_0347025 3300046675 Bacteria 879
209 Ga0495599_0033036 3300046678 Bacteria 3250
210 Ga0495599_0456338 3300046678 Bacteria 756
211 Ga0495599_0487373 3300046678 Bacteria 727
212 Ga0495623_0032536 3300046679 Bacteria 3352
213 Ga0495623_0035741 3300046679 Bacteria 3184
214 Ga0495623_0064112 3300046679 Bacteria 2300
215 Ga0495646_0020941 3300046680 Bacteria 4135
216 Ga0495613_0011778 3300046689 Bacteria 6500
217 Ga0495624_0115782 3300046690 Bacteria 1648
218 Ga0495600_0006528 3300046809 Bacteria 7099
219 Ga0495600_0065105 3300046809 Bacteria 2383
220 Ga0495674_0005339 3300047319 Bacteria 12327
221 Ga0495674_0018385 3300047319 Bacteria 6506
222 Ga0495674_0209494 3300047319 Bacteria 1615
223 Ga0495674_0236043 3300047319 Bacteria 1508
224 Ga0495680_0043316 3300047322 Bacteria 3565
225 Ga0495675_0095849 3300047444 Bacteria 1860
226 Ga0495675_0259179 3300047444 Bacteria 1042
227 Ga0495684_0010071 3300047471 Bacteria 7307
228 Ga0495684_0087970 3300047471 Bacteria 2354
229 Ga0495684_0187095 3300047471 Bacteria 1533
230 Ga0495684_0190129 3300047471 Bacteria 1518
231 Ga0495684_0623572 3300047471 Bacteria 725
232 Ga0495602_0031684 3300048088 Bacteria 4994
233 Ga0496115_0302916 3300048918 Bacteria 1309
234 Ga0501268_003536 3300049765 Bacteria 2145
235 nmdc:mga05p37_178071_c1 3300050507 Bacteria 2589
236 nmdc:mga06r32_30224_c1 3300050510 Bacteria 5083
237 nmdc:mga06r32_785979_c1 3300050510 Bacteria 913
238 nmdc:mga08x19_1094_c1 3300050514 Bacteria 16900
239 Ga0495612_0311738 3300053078 Bacteria 707
240 Ga0501082_0000031 3300060353 Bacteria 99816
241 Ga0501081_0254611
242 rootH2_10157007
243 Ga0070658_10008163
244 Ga0070658_10945963
245 Ga0070683_100000004
246 Ga0070683_100019059
247 Ga0070683_100208957
248 Ga0070666_10409762
249 Ga0070680_100028973
250 Ga0068868_100646363
251 Ga0070660_100317461
252 Ga0070709_10210560
253 Ga0070714_100017030
254 Ga0070714_101166756
255 Ga0070713_100004015
256 Ga0070681_10070887
257 Ga0070681_10363638
258 Ga0070681_10379012
259 Ga0070681_10386477
260 Ga0068867_100374598
261 Ga0068867_100798842
262 Ga0070699_100188425
263 Ga0070679_100076558
264 Ga0070679_100252626
265 Ga0070684_100000009
266 Ga0068853_100841783
267 Ga0070696_100003432
268 Ga0070665_100031628
269 Ga0068855_100033860
270 Ga0068855_100107107
271 Ga0068855_100258307
272 Ga0070664_101321774
273 Ga0068857_100924183
274 Ga0068856_100089346
275 Ga0068856_100273635
276 Ga0068852_100067235
277 Ga0068863_100038939
278 Ga0070717_10013445
279 Ga0070717_10342504
280 Ga0070717_10393087
281 Ga0070717_10639726
282 Ga0070717_10907677
283 Ga0070716_100582091
284 Ga0070712_100358462
285 Ga0097621_100730365
286 Ga0068871_100560963
287 Ga0068871_100638247
288 Ga0075428_100729445
289 Ga0075433_10781951
290 Ga0075436_100000570
291 Ga0075436_100721977
292 Ga0105240_10001488
293 Ga0105240_10003530
294 Ga0105240_10053614
295 Ga0105240_10190524
296 Ga0105240_11027052
297 Ga0105245_10538435
298 Ga0105245_10634053
299 Ga0114129_10119470
300 Ga0114129_10974717
301 Ga0105241_10354420
302 Ga0105241_10431473
303 Ga0105242_11666545
304 Ga0105248_10013205
305 Ga0105248_10142529
306 Ga0105248_11210628
307 Ga0105248_11299518
308 Ga0105248_11562235
309 Ga0105237_10004035
310 Ga0105237_10033421
311 Ga0105237_10868707
312 Ga0105238_10235632
313 Ga0105249_10027281
314 Ga0157371_10743557
315 Ga0157370_10006867
316 Ga0157370_10088376
317 Ga0157370_10195192
318 Ga0157370_10536326
319 Ga0157370_10910587
320 Ga0157369_10001528
321 Ga0157369_10224970
322 Ga0157369_10239296
323 Ga0157369_10302878
324 Ga0157369_11030620
325 Ga0157374_10172232
326 Ga0157378_10916012
327 Ga0163162_10659084
328 Ga0163162_12253994
329 Ga0157372_10140018
330 Ga0157372_10581379
331 Ga0157375_10387889
332 Ga0163163_10003438
333 Ga0163163_10023720
334 Ga0163163_10740395
335 Ga0157379_10467755
336 Ga0157376_10080505
337 Ga0157376_10258751
338 Ga0157376_10377649
339 Ga0157376_10685942
340 Ga0157376_11064467
341 Ga0163161_10196717
342 Ga0206352_10661720
343 Ga0206352_10838994
344 Ga0213875_10027560
345 Ga0224712_10087255
346 Ga0207680_10590390
347 Ga0207699_10118141
348 Ga0207643_10349475
349 Ga0207705_10023313
350 Ga0207705_10242653
351 Ga0207654_10331402
352 Ga0207707_10042713
353 Ga0207707_10211652
354 Ga0207707_10265317
355 Ga0207695_10011284
356 Ga0207695_10018768
357 Ga0207695_10186725
358 Ga0207671_10013649
359 Ga0207693_10174895
360 Ga0207663_10219743
361 Ga0207660_10174051
362 Ga0207652_10139143
363 Ga0207652_10156067
364 Ga0207652_10223074
365 Ga0207659_10549091
366 Ga0207700_10058398
367 Ga0207700_10269642
368 Ga0207664_10229420
369 Ga0207644_10058598
370 Ga0207686_10507187
371 Ga0207670_10132075
372 Ga0207669_10392216
373 Ga0207691_10763362
374 Ga0207711_10190112
375 Ga0207711_10788971
376 Ga0207711_11116349
377 Ga0207661_10000017
378 Ga0207661_10018546
379 Ga0207667_10033699
380 Ga0207667_10047248
381 Ga0207667_10686653
382 Ga0207651_10070008
383 Ga0207651_10591477
384 Ga0207677_10401194
385 Ga0207677_10440231
386 Ga0207702_10485372
387 Ga0207641_10029339
388 Ga0207676_10386591
389 Ga0207676_10704449
390 Ga0207683_10348224
391 Ga0207698_10086667
392 Ga0268266_10144384
393 Ga0265338_10159685
394 Ga0265331_10170757
395 Ga0265316_10000993
396 Ga0265314_10169847
397 Ga0265342_10056336
398 Ga0373943_0137353
399 Ga0373943_0208787
400 Ga0373935_0033777
401 Ga0373935_0505646
402 Ga0373927_0004067
403 Ga0373927_0093176
404 Ga0373927_0176060
405 Ga0373947_0000161
406 Ga0373947_0560652
407 Ga0373925_0000188
408 Ga0373925_0059293
409 Ga0373925_0218139
410 Ga0373925_0410699
411 Ga0373925_0464066
412 Ga0373925_0586172
413 Ga0395898_0053960
414 Ga0436364_0102025
415 Ga0436365_0827026
416 Ga0451577_0943254
417 Ga0453684_1362342
418 Ga0451576_0017184
419 Ga0451576_0036740
420 Ga0495592_0077808
421 Ga0495603_0476330
422 Ga0495651_0018698
423 Ga0495651_0018998
424 Ga0495653_0056110
425 Ga0495580_0002010
426 Ga0495580_0075601
427 Ga0495580_0080151
428 Ga0495580_0392139
429 Ga0495662_0006837
430 Ga0495664_0004023
431 Ga0495664_0347682
432 Ga0495594_0085823
433 Ga0495628_0028873
434 Ga0495630_0004420
435 Ga0495652_0034171
436 Ga0495665_0103958
437 Ga0495640_0002130
438 Ga0495586_0141168
439 Ga0495587_0018235
440 Ga0495621_0103850
441 Ga0495645_0001313
442 Ga0495645_0179310
443 Ga0495667_0033559
444 Ga0495667_0136392
445 Ga0495634_0045600
446 Ga0495635_0021259
447 Ga0495635_0158622
448 Ga0495657_0347025
449 Ga0495599_0033036
450 Ga0495599_0456338
451 Ga0495599_0487373
452 Ga0495623_0032536
453 Ga0495623_0035741
454 Ga0495623_0064112
455 Ga0495646_0020941
456 Ga0495613_0011778
457 Ga0495624_0115782
458 Ga0495600_0006528
459 Ga0495600_0065105
460 Ga0495674_0005339
461 Ga0495674_0018385
462 Ga0495674_0209494
463 Ga0495674_0236043
464 Ga0495680_0043316
465 Ga0495675_0095849
466 Ga0495675_0259179
467 Ga0495684_0010071
468 Ga0495684_0087970
469 Ga0495684_0187095
470 Ga0495684_0190129
471 Ga0495684_0623572
472 Ga0495602_0031684
473 Ga0496115_0302916
474 Ga0501268_003536
475 nmdc:mga05p37_178071_c1
476 nmdc:mga06r32_30224_c1
477 nmdc:mga06r32_785979_c1
478 nmdc:mga08x19_1094_c1
479 Ga0495612_0311738
480 Ga0501082_0000031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

137

196

0.91

PF13476

AAA_23

AAA domain

41

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qpq-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8613 124 168
6yuf-assembly1.cif.gz_A cohesin complex with loader gripping dna 0.7806 1 50
3zqj-assembly5.cif.gz_E mycobacterium tuberculosis uvra 0.7513 99 176
3zqj-assembly1.cif.gz_A mycobacterium tuberculosis uvra 0.7489 99 176
3zqj-assembly3.cif.gz_C mycobacterium tuberculosis uvra 0.7482 99 176
ID Description Score Start End Superfamily
af_Q54Z35_8_130_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8331 29 58 3.40.50.300
af_Q60273_1_105_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8317 105 168 3.40.50.300
af_A0A1D6F5K1_116_301_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7992 124 168 3.40.50.300
af_Q8IAX3_573_668_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7898 99 168 3.40.50.300
af_A0A1D6JKA3_4_149_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7815 102 161 3.40.50.300
ID Description Score Start End GO Terms
AF-A9WJK2-F1-model_v4 DUF3696 domain-containing protein 0.8436 102 168 GO:0005524
GO:0016887
AF-A0A1J0LPN4-F1-model_v4 Endonuclease GajA/Old nuclease/RecF-like AAA domain-containing protein 0.8391 105 176
AF-A0A850ARD1-F1-model_v4 DUF3696 domain-containing protein 0.8376 102 176 GO:0005524
GO:0016887
AF-A0A1I0YUF8-F1-model_v4 Predicted ATPase 0.8328 102 171
AF-A0A429GAA9-F1-model_v4 ATPase AAA-type core domain-containing protein 0.832 104 168 GO:0005524
GO:0016887

Map