F352760

General Info

Members Datasets Scaffolds Average Seq Length
240 164 480 322

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100061469|Ga0075434_1000614692
Length 353
Sequence MGGSLSGGRSAGLCIISRAAPAGTGIRAAQSGRAPSQRIGALVAAFLFWACAAVAQQPGQTITIIVPYTPGTGPDILARLLGQEIQVRWRQPVVVENKPGASGNIGTQVAARAPADGSTLLLTTSPFTQNVSLFKSVPYDPETDFAPIVHLTDAFMALAVHPSLPVTSAPDFVAHLKAHPGQVDYASPGRGTVHHLAMELFKLATGTDVKHVAYRGSAPAVQDLIGGHIGSMFLPVHVGLPLAKDNQIRLLAVANNERVSVAPDVPTLSEQGIQGVDIDFWLGMLAPAATPVPTVERYNSALNDILRTPRIADTLKAQGFVAVGGSARDFGELIAKDLAKWRKVVRDAGISPE

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
159 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
160 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
161 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
162 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
163 2928070936 Variovorax gossypii 1167 Isolate Unclassified
164 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 0
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 1.25
Rhizoplane 10.42
Rhizosphere 72.5
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100061469 3300006871 Bacteria 3737
2 Ga0065712_10122497 3300005290 Bacteria 1630
3 Ga0068869_100136316 3300005334 Bacteria 1891
4 Ga0068869_100192760 3300005334 Bacteria 1603
5 Ga0070666_10169998 3300005335 Bacteria 1526
6 Ga0070682_100063653 3300005337 Bacteria 2339
7 Ga0068868_100141954 3300005338 Bacteria 1972
8 Ga0068868_100269061 3300005338 Bacteria 1439
9 Ga0070689_100111637 3300005340 Unclassified 2175
10 Ga0070661_100182016 3300005344 Bacteria 1599
11 Ga0070669_100031210 3300005353 Bacteria 3849
12 Ga0070669_100087062 3300005353 Bacteria 2335
13 Ga0070675_100245514 3300005354 Bacteria 1565
14 Ga0070671_100012673 3300005355 Bacteria 6796
15 Ga0070671_100212990 3300005355 Bacteria 1639
16 Ga0070674_100074852 3300005356 Bacteria 2403
17 Ga0070688_100009663 3300005365 Bacteria 5289
18 Ga0070688_100286742 3300005365 Bacteria 1185
19 Ga0070667_100129546 3300005367 Bacteria 2201
20 Ga0070678_100057372 3300005456 Bacteria 2852
21 Ga0070681_10009645 3300005458 Bacteria 9496
22 Ga0068867_100081535 3300005459 Bacteria 2439
23 Ga0070685_10114646 3300005466 Bacteria 1666
24 Ga0070679_100017582 3300005530 Bacteria 6921
25 Ga0070672_100092519 3300005543 Bacteria 2442
26 Ga0070686_100023794 3300005544 Bacteria 3666
27 Ga0070686_100084857 3300005544 Bacteria 2106
28 Ga0070665_100030316 3300005548 Bacteria 5444
29 Ga0070665_100221224 3300005548 Bacteria 1894
30 Ga0068855_100517174 3300005563 Bacteria 1295
31 Ga0068864_100022169 3300005618 Bacteria 5325
32 Ga0068861_100117662 3300005719 Bacteria 2139
33 Ga0068860_100180527 3300005843 Bacteria 2040
34 Ga0068860_100344660 3300005843 Bacteria 1465
35 Ga0081540_1000068 3300005983 Bacteria 112697
36 Ga0081540_1015461 3300005983 Bacteria 4833
37 Ga0081540_1112506 3300005983 Unclassified 1147
38 Ga0075368_10000486 3300006042 Bacteria 11748
39 Ga0075368_10002649 3300006042 Bacteria 5883
40 Ga0075368_10017480 3300006042 Bacteria 2685
41 Ga0075363_100006562 3300006048 Bacteria 5299
42 Ga0075363_100015054 3300006048 Bacteria 3793
43 Ga0075363_100038484 3300006048 Bacteria 2515
44 Ga0075364_10001076 3300006051 Bacteria 14552
45 Ga0075364_10009637 3300006051 Bacteria 5803
46 Ga0075364_10150499 3300006051 Bacteria 1568
47 Ga0075432_10011879 3300006058 Bacteria 2960
48 Ga0075362_10048749 3300006177 Unclassified 1890
49 Ga0075362_10054115 3300006177 Bacteria 1803
50 Ga0075367_10000177 3300006178 Bacteria 20664
51 Ga0075367_10004469 3300006178 Bacteria 6833
52 Ga0075367_10018369 3300006178 Bacteria 3857
53 Ga0075367_10094388 3300006178 Bacteria 1824
54 Ga0075366_10062428 3300006195 Bacteria 2214
55 Ga0075370_10000459 3300006353 Bacteria 15177
56 Ga0068871_100100433 3300006358 Unclassified 2423
57 Ga0075428_100031136 3300006844 Bacteria 5899
58 Ga0075430_100008743 3300006846 Bacteria 8547
59 Ga0075430_100064493 3300006846 Bacteria 3077
60 Ga0075430_100097936 3300006846 Bacteria 2450
61 Ga0075431_100003320 3300006847 Bacteria 15586
62 Ga0075431_100041089 3300006847 Bacteria 4768
63 Ga0075431_100130309 3300006847 Bacteria 2594
64 Ga0075431_100268724 3300006847 Bacteria 1729
65 Ga0075431_100349321 3300006847 Bacteria 1487
66 Ga0075433_10239103 3300006852 Bacteria 1612
67 Ga0075434_100091102 3300006871 Bacteria 3051
68 Ga0075429_100114013 3300006880 Bacteria 2362
69 Ga0075435_100169427 3300007076 Bacteria 1842
70 Ga0075435_100326639 3300007076 Bacteria 1313
71 Ga0111539_10051816 3300009094 Bacteria 4886
72 Ga0111539_10062599 3300009094 Bacteria 4403
73 Ga0105245_10021058 3300009098 Bacteria 5720
74 Ga0114129_10005784 3300009147 Bacteria 17509
75 Ga0114129_10043789 3300009147 Bacteria 6298
76 Ga0105243_10182165 3300009148 Bacteria 1828
77 Ga0105243_10564962 3300009148 Bacteria 1089
78 Ga0105242_10081146 3300009176 Bacteria 2712
79 Ga0105248_10057680 3300009177 Bacteria 4359
80 Ga0105248_10086855 3300009177 Bacteria 3520
81 Ga0105248_10168727 3300009177 Bacteria 2467
82 Ga0105248_10620751 3300009177 Bacteria 1220
83 Ga0105239_10442040 3300010375 Bacteria 1475
84 Ga0105246_10059444 3300011119 Bacteria 2652
85 Ga0157378_10426237 3300013297 Bacteria 1312
86 Ga0163162_10097831 3300013306 Bacteria 3023
87 Ga0163162_10128815 3300013306 Bacteria 2639
88 Ga0157375_10601736 3300013308 Bacteria 1258
89 Ga0163163_10043201 3300014325 Bacteria 4418
90 Ga0163163_10083725 3300014325 Bacteria 3195
91 Ga0157380_10058250 3300014326 Bacteria 3079
92 Ga0157380_10440461 3300014326 Bacteria 1248
93 Ga0157379_10112106 3300014968 Bacteria 2451
94 Ga0209758_1000523 3300025297 Bacteria 61460
95 Ga0209758_1037011 3300025297 Bacteria 1893
96 Ga0207688_10031763 3300025901 Bacteria 2916
97 Ga0207680_10098169 3300025903 Bacteria 1877
98 Ga0207645_10036311 3300025907 Bacteria 3164
99 Ga0207643_10215768 3300025908 Bacteria 1173
100 Ga0207652_10167761 3300025921 Unclassified 1969
101 Ga0207687_10067929 3300025927 Bacteria 2538
102 Ga0207670_10000529 3300025936 Bacteria 21100
103 Ga0207670_10083545 3300025936 Unclassified 2240
104 Ga0207669_10010103 3300025937 Bacteria 4531
105 Ga0207691_10101057 3300025940 Bacteria 2574
106 Ga0207711_10215793 3300025941 Bacteria 1753
107 Ga0207689_10217193 3300025942 Bacteria 1580
108 Ga0207667_10446394 3300025949 Bacteria 1315
109 Ga0207668_10145548 3300025972 Bacteria 1828
110 Ga0207668_10159939 3300025972 Bacteria 1754
111 Ga0207658_10070122 3300025986 Bacteria 2651
112 Ga0207703_10081759 3300026035 Bacteria 2694
113 Ga0207678_10001301 3300026067 Bacteria 23137
114 Ga0207678_10167767 3300026067 Bacteria 1874
115 Ga0207708_10154960 3300026075 Bacteria 1806
116 Ga0207641_10412838 3300026088 Bacteria 1298
117 Ga0207648_10029284 3300026089 Bacteria 4883
118 Ga0207676_10025205 3300026095 Bacteria 4412
119 Ga0207676_10093238 3300026095 Bacteria 2478
120 Ga0207674_10192363 3300026116 Bacteria 1990
121 Ga0207675_100095320 3300026118 Bacteria 2800
122 Ga0207675_100118167 3300026118 Bacteria 2507
123 Ga0207683_10047653 3300026121 Bacteria 3752
124 Ga0209813_10001064 3300027866 Bacteria 6176
125 Ga0209813_10001959 3300027866 Bacteria 4656
126 Ga0207428_10019937 3300027907 Bacteria 5710
127 Ga0207428_10106181 3300027907 Bacteria 2165
128 Ga0268265_10155229 3300028380 Bacteria 1936
129 Ga0265325_10000828 3300031241 Bacteria 22440
130 Ga0265340_10009093 3300031247 Bacteria 5342
131 Ga0265340_10019356 3300031247 Bacteria 3505
132 Ga0265313_10098370 3300031595 Bacteria 1302
133 Ga0265314_10055987 3300031711 Unclassified 2717
134 Ga0265314_10133936 3300031711 Bacteria 1542
135 Ga0373946_0054540 3300035171 Bacteria 1683
136 Ga0373935_0112281 3300035692 Bacteria 1810
137 Ga0373927_0065065 3300035695 Unclassified 2359
138 Ga0373947_0043107 3300035725 Bacteria 2695
139 Ga0373947_0113373 3300035725 Unclassified 1716
140 Ga0495603_0077631 3300046455 Bacteria 1948
141 Ga0495629_0123438 3300046459 Bacteria 1804
142 Ga0495585_0104247 3300046492 Unclassified 1514
143 Ga0495608_0128899 3300046511 Bacteria 1620
144 Ga0495608_0225664 3300046511 Bacteria 1174
145 Ga0495634_0145477 3300046642 Unclassified 1502
146 Ga0495658_0187774 3300046683 Bacteria 1284
147 Ga0495613_0140583 3300046689 Bacteria 1725
148 Ga0495680_0208434 3300047322 Bacteria 1400
149 Ga0495687_003214 3300047443 Bacteria 12112
150 Ga0495593_0153317 3300047673 Bacteria 1165
151 Ga0495602_0123360 3300048088 Bacteria 2080
152 Ga0496100_0143052 3300048903 Bacteria 1697
153 Ga0496101_0001616 3300048904 Bacteria 13540
154 Ga0496101_0201571 3300048904 Bacteria 1539
155 Ga0496102_0020372 3300048905 Bacteria 5861
156 Ga0496104_0000527 3300048907 Bacteria 32851
157 Ga0496104_0001109 3300048907 Bacteria 23033
158 Ga0496104_0003432 3300048907 Bacteria 13669
159 Ga0496104_0004224 3300048907 Bacteria 12473
160 Ga0496104_0020440 3300048907 Bacteria 6069
161 Ga0496105_0044949 3300048908 Bacteria 3643
162 Ga0496105_0132073 3300048908 Bacteria 2058
163 Ga0496107_0056946 3300048910 Bacteria 2825
164 Ga0496108_0002832 3300048911 Bacteria 13917
165 Ga0496108_0089989 3300048911 Bacteria 2609
166 Ga0496108_0421691 3300048911 Bacteria 1165
167 Ga0496109_0062387 3300048912 Bacteria 3408
168 Ga0496109_0101646 3300048912 Bacteria 2668
169 Ga0496110_0006062 3300048913 Bacteria 9530
170 Ga0496111_0018217 3300048914 Bacteria 4863
171 Ga0496111_0094266 3300048914 Bacteria 2195
172 Ga0496112_0201553 3300048915 Bacteria 1949
173 Ga0496114_0009945 3300048917 Bacteria 7560
174 Ga0496115_0005508 3300048918 Bacteria 9214
175 Ga0496115_0045669 3300048918 Bacteria 3498
176 Ga0496115_0056399 3300048918 Bacteria 3157
177 Ga0496126_0077106 3300048929 Bacteria 2956
178 Ga0501032_0158614 3300049569 Unclassified 1486
179 Ga0501033_0190020 3300049570 Unclassified 1470
180 Ga0501034_0225305 3300049571 Bacteria 1826
181 Ga0501036_0055446 3300049572 Bacteria 3357
182 Ga0501038_0162954 3300049574 Bacteria 1810
183 Ga0501039_0010832 3300049575 Bacteria 6949
184 Ga0501039_0230843 3300049575 Bacteria 1455
185 Ga0501042_0063322 3300049578 Bacteria 2643
186 Ga0501043_0088848 3300049579 Bacteria 2428
187 Ga0501048_0017597 3300049582 Bacteria 5262
188 Ga0501048_0192583 3300049582 Bacteria 1445
189 Ga0501067_0154313 3300049583 Bacteria 1279
190 Ga0501069_0005260 3300049585 Bacteria 6721
191 Ga0501070_0079666 3300049586 Bacteria 2710
192 Ga0501072_0132903 3300049588 Bacteria 1984
193 Ga0501073_0011803 3300049589 Bacteria 6377
194 Ga0501074_0002382 3300049590 Bacteria 13107
195 Ga0501076_0228638 3300049592 Bacteria 1521
196 Ga0501076_0304416 3300049592 Bacteria 1307
197 Ga0501079_0142504 3300049741 Bacteria 1867
198 Ga0501083_0310110 3300049744 Bacteria 1026
199 Ga0501035_0169367 3300049822 Bacteria 1887
200 Ga0501044_0000458 3300049823 Bacteria 49695
201 Ga0501045_0223319 3300049824 Bacteria 1402
202 nmdc:mga03683_109463_c1 3300050489 Bacteria 1220
203 nmdc:mga03683_5866_c1 3300050489 Bacteria 4175
204 nmdc:mga03683_96885_c1 3300050489 Bacteria 1292
205 nmdc:mga03n38_87_c2 3300050490 Bacteria 5079
206 nmdc:mga00v17_24758_c1 3300050491 Bacteria 3483
207 nmdc:mga00v17_3668_c2 3300050491 Bacteria 6942
208 nmdc:mga0yw44_246548_c1 3300050492 Bacteria 1188
209 nmdc:mga0k408_94045_c1 3300050493 Bacteria 1763
210 nmdc:mga06z11_2570_c1 3300050494 Bacteria 6946
211 nmdc:mga06z11_283_c1 3300050494 Bacteria 19709
212 nmdc:mga06z11_31909_c1 3300050494 Bacteria 2565
213 nmdc:mga04h51_1117_c1 3300050495 Bacteria 6183
214 nmdc:mga07m45_1799_c1 3300050496 Bacteria 9874
215 nmdc:mga05p37_44331_c1 3300050507 Bacteria 5472
216 nmdc:mga05p37_46650_c1 3300050507 Bacteria 5327
217 nmdc:mga05p37_94890_c1 3300050507 Bacteria 3675
218 nmdc:mga0qj67_12311_c1 3300050509 Bacteria 6441
219 nmdc:mga0qj67_20592_c1 3300050509 Bacteria 5052
220 nmdc:mga06r32_105179_c1 3300050510 Bacteria 2773
221 nmdc:mga06r32_155682_c1 3300050510 Bacteria 2266
222 nmdc:mga06r32_16327_c1 3300050510 Bacteria 6764
223 nmdc:mga06r32_7304_c1 3300050510 Bacteria 9947
224 nmdc:mga08y16_69931_c1 3300050511 Bacteria 3659
225 nmdc:mga0n895_187058_c1 3300050512 Bacteria 2102
226 nmdc:mga0n895_60258_c1 3300050512 Bacteria 3745
227 nmdc:mga0rr50_7816_c1 3300050513 Bacteria 6628
228 nmdc:mga0a205_296485_c1 3300050515 Bacteria 1490
229 Ga0495612_0018871 3300053078 Bacteria 2761
230 Ga0495655_0022175 3300053083 Bacteria 1448
231 Ga0495619_0015881 3300053085 Bacteria 4767
232 Ga0501084_0085516 3300054114 Bacteria 2648
233 Ga0501082_0327211 3300060353 Bacteria 1335
234 2513696704 2513237101 Bacteria 7952346
235 2828307700 2828305725 Bacteria 4916900
236 2842776391 2842775625 Bacteria 5587290
237 2881103782 2881101125 Bacteria 4590519
238 2922387724 2922386360 Bacteria 7017218
239 2928078211 2928070936 Bacteria 8062541
240 8006971751 8006964411 Bacteria 8966052
241 Ga0075434_100061469
242 Ga0065712_10122497
243 Ga0068869_100136316
244 Ga0068869_100192760
245 Ga0070666_10169998
246 Ga0070682_100063653
247 Ga0068868_100141954
248 Ga0068868_100269061
249 Ga0070689_100111637
250 Ga0070661_100182016
251 Ga0070669_100031210
252 Ga0070669_100087062
253 Ga0070675_100245514
254 Ga0070671_100012673
255 Ga0070671_100212990
256 Ga0070674_100074852
257 Ga0070688_100009663
258 Ga0070688_100286742
259 Ga0070667_100129546
260 Ga0070678_100057372
261 Ga0070681_10009645
262 Ga0068867_100081535
263 Ga0070685_10114646
264 Ga0070679_100017582
265 Ga0070672_100092519
266 Ga0070686_100023794
267 Ga0070686_100084857
268 Ga0070665_100030316
269 Ga0070665_100221224
270 Ga0068855_100517174
271 Ga0068864_100022169
272 Ga0068861_100117662
273 Ga0068860_100180527
274 Ga0068860_100344660
275 Ga0081540_1000068
276 Ga0081540_1015461
277 Ga0081540_1112506
278 Ga0075368_10000486
279 Ga0075368_10002649
280 Ga0075368_10017480
281 Ga0075363_100006562
282 Ga0075363_100015054
283 Ga0075363_100038484
284 Ga0075364_10001076
285 Ga0075364_10009637
286 Ga0075364_10150499
287 Ga0075432_10011879
288 Ga0075362_10048749
289 Ga0075362_10054115
290 Ga0075367_10000177
291 Ga0075367_10004469
292 Ga0075367_10018369
293 Ga0075367_10094388
294 Ga0075366_10062428
295 Ga0075370_10000459
296 Ga0068871_100100433
297 Ga0075428_100031136
298 Ga0075430_100008743
299 Ga0075430_100064493
300 Ga0075430_100097936
301 Ga0075431_100003320
302 Ga0075431_100041089
303 Ga0075431_100130309
304 Ga0075431_100268724
305 Ga0075431_100349321
306 Ga0075433_10239103
307 Ga0075434_100091102
308 Ga0075429_100114013
309 Ga0075435_100169427
310 Ga0075435_100326639
311 Ga0111539_10051816
312 Ga0111539_10062599
313 Ga0105245_10021058
314 Ga0114129_10005784
315 Ga0114129_10043789
316 Ga0105243_10182165
317 Ga0105243_10564962
318 Ga0105242_10081146
319 Ga0105248_10057680
320 Ga0105248_10086855
321 Ga0105248_10168727
322 Ga0105248_10620751
323 Ga0105239_10442040
324 Ga0105246_10059444
325 Ga0157378_10426237
326 Ga0163162_10097831
327 Ga0163162_10128815
328 Ga0157375_10601736
329 Ga0163163_10043201
330 Ga0163163_10083725
331 Ga0157380_10058250
332 Ga0157380_10440461
333 Ga0157379_10112106
334 Ga0209758_1000523
335 Ga0209758_1037011
336 Ga0207688_10031763
337 Ga0207680_10098169
338 Ga0207645_10036311
339 Ga0207643_10215768
340 Ga0207652_10167761
341 Ga0207687_10067929
342 Ga0207670_10000529
343 Ga0207670_10083545
344 Ga0207669_10010103
345 Ga0207691_10101057
346 Ga0207711_10215793
347 Ga0207689_10217193
348 Ga0207667_10446394
349 Ga0207668_10145548
350 Ga0207668_10159939
351 Ga0207658_10070122
352 Ga0207703_10081759
353 Ga0207678_10001301
354 Ga0207678_10167767
355 Ga0207708_10154960
356 Ga0207641_10412838
357 Ga0207648_10029284
358 Ga0207676_10025205
359 Ga0207676_10093238
360 Ga0207674_10192363
361 Ga0207675_100095320
362 Ga0207675_100118167
363 Ga0207683_10047653
364 Ga0209813_10001064
365 Ga0209813_10001959
366 Ga0207428_10019937
367 Ga0207428_10106181
368 Ga0268265_10155229
369 Ga0265325_10000828
370 Ga0265340_10009093
371 Ga0265340_10019356
372 Ga0265313_10098370
373 Ga0265314_10055987
374 Ga0265314_10133936
375 Ga0373946_0054540
376 Ga0373935_0112281
377 Ga0373927_0065065
378 Ga0373947_0043107
379 Ga0373947_0113373
380 Ga0495603_0077631
381 Ga0495629_0123438
382 Ga0495585_0104247
383 Ga0495608_0128899
384 Ga0495608_0225664
385 Ga0495634_0145477
386 Ga0495658_0187774
387 Ga0495613_0140583
388 Ga0495680_0208434
389 Ga0495687_003214
390 Ga0495593_0153317
391 Ga0495602_0123360
392 Ga0496100_0143052
393 Ga0496101_0001616
394 Ga0496101_0201571
395 Ga0496102_0020372
396 Ga0496104_0000527
397 Ga0496104_0001109
398 Ga0496104_0003432
399 Ga0496104_0004224
400 Ga0496104_0020440
401 Ga0496105_0044949
402 Ga0496105_0132073
403 Ga0496107_0056946
404 Ga0496108_0002832
405 Ga0496108_0089989
406 Ga0496108_0421691
407 Ga0496109_0062387
408 Ga0496109_0101646
409 Ga0496110_0006062
410 Ga0496111_0018217
411 Ga0496111_0094266
412 Ga0496112_0201553
413 Ga0496114_0009945
414 Ga0496115_0005508
415 Ga0496115_0045669
416 Ga0496115_0056399
417 Ga0496126_0077106
418 Ga0501032_0158614
419 Ga0501033_0190020
420 Ga0501034_0225305
421 Ga0501036_0055446
422 Ga0501038_0162954
423 Ga0501039_0010832
424 Ga0501039_0230843
425 Ga0501042_0063322
426 Ga0501043_0088848
427 Ga0501048_0017597
428 Ga0501048_0192583
429 Ga0501067_0154313
430 Ga0501069_0005260
431 Ga0501070_0079666
432 Ga0501072_0132903
433 Ga0501073_0011803
434 Ga0501074_0002382
435 Ga0501076_0228638
436 Ga0501076_0304416
437 Ga0501079_0142504
438 Ga0501083_0310110
439 Ga0501035_0169367
440 Ga0501044_0000458
441 Ga0501045_0223319
442 nmdc:mga03683_109463_c1
443 nmdc:mga03683_5866_c1
444 nmdc:mga03683_96885_c1
445 nmdc:mga03n38_87_c2
446 nmdc:mga00v17_24758_c1
447 nmdc:mga00v17_3668_c2
448 nmdc:mga0yw44_246548_c1
449 nmdc:mga0k408_94045_c1
450 nmdc:mga06z11_2570_c1
451 nmdc:mga06z11_283_c1
452 nmdc:mga06z11_31909_c1
453 nmdc:mga04h51_1117_c1
454 nmdc:mga07m45_1799_c1
455 nmdc:mga05p37_44331_c1
456 nmdc:mga05p37_46650_c1
457 nmdc:mga05p37_94890_c1
458 nmdc:mga0qj67_12311_c1
459 nmdc:mga0qj67_20592_c1
460 nmdc:mga06r32_105179_c1
461 nmdc:mga06r32_155682_c1
462 nmdc:mga06r32_16327_c1
463 nmdc:mga06r32_7304_c1
464 nmdc:mga08y16_69931_c1
465 nmdc:mga0n895_187058_c1
466 nmdc:mga0n895_60258_c1
467 nmdc:mga0rr50_7816_c1
468 nmdc:mga0a205_296485_c1
469 Ga0495612_0018871
470 Ga0495655_0022175
471 Ga0495619_0015881
472 Ga0501084_0085516
473 Ga0501082_0327211
474 2513696704
475 2828307700
476 2842776391
477 2881103782
478 2922387724
479 2928078211
480 8006971751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

77

350

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9474 35 331
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9421 35 331
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.942 38 333
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9382 35 331
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.93 35 331
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9463 135 256 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9307 135 252 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9246 135 256 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9233 136 256 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9232 40 333 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9726 61 329
AF-A0A1F4DIF3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9709 130 333
AF-A0A439F197-F1-model_v4 deleted 0.9664 90 333
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9643 54 333
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9621 61 329

Map