F352689

General Info

Members Datasets Scaffolds Average Seq Length
240 161 480 223

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100033490|Ga0068852_1000334903
Length 252
Sequence VSPQGLLLPPGKKPAADDTNEYMACTVVLEVVKPRANLSLVSAPAVLDEESREWLRGLRAEGAERDLAIARLHLLLLRAARFEVARRRPTLPHVRGDELDDIALEAADDAMMSVLARVDDFRGESRFTTWVYKFALLEAAVKLRKRAWQGREVPVEPETWSLFESGSPEPAQEALQVELLDAVRAGIAELTPHQRRVLVALALNGVPIDVLAERLDTTRGALYKTLHDARRALRVNLNARGFDPTTWFEEAR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 5.42
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100033490 3300005616 Unclassified 4267
2 Ga0070676_10193323 3300005328 Bacteria 1330
3 Ga0070683_100002922 3300005329 Bacteria 13693
4 Ga0070680_100136905 3300005336 Bacteria 2052
5 Ga0068868_100008137 3300005338 Bacteria 7503
6 Ga0070691_10421943 3300005341 Bacteria 756
7 Ga0070692_10103364 3300005345 Bacteria 1565
8 Ga0070668_100202202 3300005347 Bacteria 1631
9 Ga0070675_100394605 3300005354 Bacteria 1233
10 Ga0070674_100200799 3300005356 Unclassified 1540
11 Ga0070714_100583826 3300005435 Unclassified 1072
12 Ga0070713_100130497 3300005436 Bacteria 2215
13 Ga0070711_100097642 3300005439 Bacteria 2131
14 Ga0070700_100335618 3300005441 Bacteria 1115
15 Ga0070694_100069807 3300005444 Bacteria 2418
16 Ga0070708_100010667 3300005445 Bacteria 7453
17 Ga0070663_100099970 3300005455 Bacteria 2163
18 Ga0070678_100011103 3300005456 Bacteria 5540
19 Ga0070681_10006371 3300005458 Bacteria 11472
20 Ga0070681_10058451 3300005458 Bacteria 3836
21 Ga0068867_100725884 3300005459 Bacteria 879
22 Ga0070685_10156336 3300005466 Unclassified 1449
23 Ga0070706_100037349 3300005467 Bacteria 4486
24 Ga0070707_100023151 3300005468 Bacteria 5876
25 Ga0070707_100377707 3300005468 Bacteria 1377
26 Ga0070698_100070889 3300005471 Bacteria 3496
27 Ga0070699_100029327 3300005518 Bacteria 4744
28 Ga0070679_100172137 3300005530 Unclassified 2138
29 Ga0070684_100000721 3300005535 Bacteria 22898
30 Ga0070696_100230053 3300005546 Bacteria 1394
31 Ga0070693_100004452 3300005547 Bacteria 6626
32 Ga0070665_100334223 3300005548 Unclassified 1520
33 Ga0068854_100311552 3300005578 Bacteria 1277
34 Ga0068856_100039848 3300005614 Bacteria 4613
35 Ga0070702_100205567 3300005615 Unclassified 1307
36 Ga0068864_100012754 3300005618 Bacteria 6947
37 Ga0068861_100215960 3300005719 Bacteria 1618
38 Ga0081455_10332189 3300005937 Bacteria 1079
39 Ga0081538_10001820 3300005981 Bacteria 21461
40 Ga0081538_10009165 3300005981 Bacteria 8301
41 Ga0081538_10063697 3300005981 Bacteria 2091
42 Ga0081538_10106037 3300005981 Bacteria 1397
43 Ga0081539_10008215 3300005985 Bacteria 9184
44 Ga0070717_10254571 3300006028 Bacteria 1552
45 Ga0070712_100053646 3300006175 Bacteria 2816
46 Ga0070712_100115495 3300006175 Bacteria 2011
47 Ga0075367_10227435 3300006178 Bacteria 1168
48 Ga0097621_100207822 3300006237 Unclassified 1702
49 Ga0075428_100180049 3300006844 Bacteria 2288
50 Ga0075428_100602152 3300006844 Bacteria 1174
51 Ga0075434_100498217 3300006871 Bacteria 1239
52 Ga0075429_100762040 3300006880 Bacteria 848
53 Ga0068865_100114158 3300006881 Bacteria 1997
54 Ga0068865_100231180 3300006881 Unclassified 1451
55 Ga0111539_10016075 3300009094 Bacteria 9288
56 Ga0105245_10000886 3300009098 Bacteria 27215
57 Ga0105245_10029037 3300009098 Bacteria 4884
58 Ga0105245_10305622 3300009098 Bacteria 1562
59 Ga0114129_10058683 3300009147 Bacteria 5383
60 Ga0114129_10157782 3300009147 Bacteria 3102
61 Ga0105243_10235009 3300009148 Bacteria 1628
62 Ga0105243_10347639 3300009148 Bacteria 1360
63 Ga0105242_10489727 3300009176 Bacteria 1167
64 Ga0105238_10082931 3300009551 Bacteria 3195
65 Ga0105249_10059712 3300009553 Bacteria 3498
66 Ga0105239_10786550 3300010375 Bacteria 1090
67 Ga0157369_10449880 3300013105 Bacteria 1334
68 Ga0157374_10032162 3300013296 Bacteria 4775
69 Ga0163162_10503991 3300013306 Bacteria 1341
70 Ga0157375_10086746 3300013308 Bacteria 3181
71 Ga0157375_11303557 3300013308 Bacteria 854
72 Ga0163163_10013246 3300014325 Bacteria 7542
73 Ga0163163_10427516 3300014325 Unclassified 1384
74 Ga0157380_10842191 3300014326 Unclassified 938
75 Ga0157376_10190361 3300014969 Bacteria 1881
76 Ga0157376_10311233 3300014969 Bacteria 1494
77 Ga0206356_10997765 3300020070 Bacteria 3409
78 Ga0206354_10073080 3300020081 Bacteria 2277
79 Ga0206353_10581558 3300020082 Bacteria 12890
80 Ga0207642_10248526 3300025899 Bacteria 1008
81 Ga0207688_10008356 3300025901 Bacteria 5630
82 Ga0207699_10050165 3300025906 Bacteria 2459
83 Ga0207645_10046346 3300025907 Bacteria 2777
84 Ga0207643_10023866 3300025908 Bacteria 3375
85 Ga0207684_10153369 3300025910 Bacteria 1982
86 Ga0207684_10216272 3300025910 Bacteria 1653
87 Ga0207707_10020785 3300025912 Bacteria 5733
88 Ga0207707_10474969 3300025912 Unclassified 1068
89 Ga0207693_10025613 3300025915 Bacteria 4676
90 Ga0207693_10727127 3300025915 Bacteria 768
91 Ga0207660_10099336 3300025917 Bacteria 2172
92 Ga0207660_10155654 3300025917 Bacteria 1759
93 Ga0207646_10011178 3300025922 Bacteria 8716
94 Ga0207646_10212405 3300025922 Bacteria 1747
95 Ga0207687_10013050 3300025927 Bacteria 5429
96 Ga0207700_10000001 3300025928 Bacteria 1122509
97 Ga0207664_10526968 3300025929 Bacteria 1059
98 Ga0207704_10083328 3300025938 Unclassified 2075
99 Ga0207665_10004897 3300025939 Bacteria 8923
100 Ga0207689_10075820 3300025942 Bacteria 2764
101 Ga0207661_10051729 3300025944 Bacteria 3278
102 Ga0207667_10586537 3300025949 Unclassified 1125
103 Ga0207640_10371202 3300025981 Bacteria 1156
104 Ga0207678_10172781 3300026067 Bacteria 1845
105 Ga0207708_10073076 3300026075 Bacteria 2628
106 Ga0207702_10004098 3300026078 Bacteria 13072
107 Ga0207648_10791775 3300026089 Bacteria 882
108 Ga0207675_100149949 3300026118 Bacteria 2219
109 Ga0207683_10010822 3300026121 Bacteria 7778
110 Ga0268266_10036563 3300028379 Bacteria 4181
111 Ga0268265_10367224 3300028380 Bacteria 1320
112 Ga0307408_100449090 3300031548 Bacteria 1118
113 Ga0307406_10464482 3300031901 Bacteria 1018
114 Ga0373936_0214079 3300035113 Bacteria 853
115 Ga0395899_0007828 3300037312 Bacteria 8236
116 Ga0395899_0028486 3300037312 Bacteria 4206
117 Ga0395899_0066507 3300037312 Unclassified 2646
118 Ga0395900_0022614 3300037418 Bacteria 6434
119 Ga0395900_0022679 3300037418 Bacteria 6425
120 Ga0395900_0023996 3300037418 Bacteria 6242
121 Ga0395900_0055656 3300037418 Bacteria 4073
122 Ga0395900_0170930 3300037418 Bacteria 2213
123 Ga0395900_0378820 3300037418 Bacteria 1383
124 Ga0395900_1016554 3300037418 Unclassified 748
125 Ga0395898_0002858 3300037466 Bacteria 19705
126 Ga0395898_0093507 3300037466 Bacteria 2889
127 Ga0395898_0106985 3300037466 Bacteria 2682
128 Ga0395898_0546223 3300037466 Bacteria 1100
129 Ga0395898_0771672 3300037466 Bacteria 902
130 Ga0395898_0850276 3300037466 Bacteria 852
131 Ga0395905_0002826 3300037471 Bacteria 19022
132 Ga0395905_0029705 3300037471 Bacteria 5151
133 Ga0395905_0064347 3300037471 Bacteria 3432
134 Ga0395905_0150369 3300037471 Unclassified 2190
135 Ga0395901_0007417 3300038443 Bacteria 11065
136 Ga0395901_0010617 3300038443 Bacteria 9331
137 Ga0395901_0078559 3300038443 Bacteria 3445
138 Ga0395901_0114450 3300038443 Bacteria 2833
139 Ga0395901_0367390 3300038443 Bacteria 1482
140 Ga0395901_0603207 3300038443 Bacteria 1107
141 Ga0395901_0606655 3300038443 Bacteria 1103
142 Ga0439438_065092 3300041405 Bacteria 908
143 Ga0439431_0054997 3300041997 Bacteria 1039
144 Ga0450907_005941 3300042146 Bacteria 2049
145 Ga0439446_0016934 3300042156 Bacteria 2033
146 Ga0439434_0026709 3300042435 Unclassified 1744
147 Ga0439434_0118912 3300042435 Bacteria 860
148 Ga0450918_009019 3300042531 Bacteria 1750
149 Ga0466963_0005696 3300044694 Bacteria 7321
150 Ga0466963_0120601 3300044694 Bacteria 1804
151 Ga0466964_0188501 3300044706 Bacteria 982
152 Ga0466957_0042827 3300044842 Bacteria 2740
153 Ga0466958_0012058 3300045836 Bacteria 4885
154 Ga0466967_0172073 3300045976 Bacteria 2038
155 Ga0466967_0212911 3300045976 Bacteria 1833
156 Ga0466967_0441182 3300045976 Bacteria 1271
157 Ga0466967_0576830 3300045976 Bacteria 1109
158 Ga0495629_0010938 3300046459 Bacteria 6599
159 Ga0495653_0051289 3300046463 Bacteria 3168
160 Ga0495630_0052439 3300046517 Bacteria 3054
161 Ga0495630_0226607 3300046517 Bacteria 1427
162 Ga0495587_0089926 3300046536 Bacteria 1774
163 Ga0495668_0188362 3300046616 Bacteria 1130
164 Ga0495634_0141018 3300046642 Bacteria 1530
165 Ga0495680_0047346 3300047322 Bacteria 3383
166 Ga0496101_0250822 3300048904 Bacteria 1379
167 Ga0496102_0031090 3300048905 Bacteria 4785
168 Ga0496102_0031701 3300048905 Bacteria 4744
169 Ga0496102_0800764 3300048905 Bacteria 865
170 Ga0496103_0007091 3300048906 Bacteria 6691
171 Ga0496104_0012670 3300048907 Bacteria 7593
172 Ga0496105_0136561 3300048908 Bacteria 2020
173 Ga0496110_0410081 3300048913 Bacteria 1235
174 Ga0496111_0049657 3300048914 Bacteria 3025
175 Ga0496111_0059509 3300048914 Bacteria 2768
176 Ga0496112_0683285 3300048915 Unclassified 955
177 Ga0496114_0000442 3300048917 Bacteria 30535
178 Ga0496114_0215069 3300048917 Bacteria 1686
179 Ga0501031_0010987 3300049568 Bacteria 5900
180 Ga0501033_0066278 3300049570 Unclassified 2655
181 Ga0501034_0734910 3300049571 Unclassified 883
182 Ga0501037_0265984 3300049573 Bacteria 1198
183 Ga0501038_0258729 3300049574 Unclassified 1376
184 Ga0501039_0011636 3300049575 Bacteria 6700
185 Ga0501039_0327350 3300049575 Bacteria 1204
186 Ga0501040_0335680 3300049576 Bacteria 1082
187 Ga0501041_0011657 3300049577 Bacteria 5201
188 Ga0501041_0195894 3300049577 Bacteria 1266
189 Ga0501042_0007018 3300049578 Bacteria 7354
190 Ga0501042_0240505 3300049578 Bacteria 1306
191 Ga0501043_0260959 3300049579 Unclassified 1332
192 Ga0501046_0024951 3300049580 Bacteria 4898
193 Ga0501046_0260240 3300049580 Bacteria 1275
194 Ga0501046_0520121 3300049580 Bacteria 851
195 Ga0501048_0012448 3300049582 Bacteria 6328
196 Ga0501067_0019282 3300049583 Bacteria 3774
197 Ga0501067_0450138 3300049583 Bacteria 719
198 Ga0501068_0204245 3300049584 Unclassified 1253
199 Ga0501070_0042381 3300049586 Bacteria 3791
200 Ga0501070_0056977 3300049586 Bacteria 3239
201 Ga0501071_0016948 3300049587 Bacteria 5014
202 Ga0501071_0109591 3300049587 Bacteria 2040
203 Ga0501072_0009619 3300049588 Bacteria 7352
204 Ga0501074_0017499 3300049590 Bacteria 5202
205 Ga0501074_0162541 3300049590 Bacteria 1595
206 Ga0501075_0048433 3300049591 Bacteria 3194
207 Ga0501076_0175362 3300049592 Bacteria 1747
208 Ga0501076_0241625 3300049592 Unclassified 1477
209 Ga0501077_0047941 3300049593 Bacteria 2714
210 Ga0501077_0139190 3300049593 Bacteria 1539
211 Ga0501079_0005337 3300049741 Bacteria 9566
212 Ga0501079_0145090 3300049741 Unclassified 1850
213 Ga0501079_0277555 3300049741 Bacteria 1310
214 Ga0501079_0509679 3300049741 Bacteria 946
215 Ga0501079_0536908 3300049741 Bacteria 919
216 Ga0501080_0027125 3300049742 Bacteria 5326
217 Ga0501083_0142078 3300049744 Unclassified 1572
218 Ga0501045_0034329 3300049824 Bacteria 3682
219 Ga0501045_0168697 3300049824 Bacteria 1630
220 Ga0501045_0350777 3300049824 Bacteria 1098
221 Ga0501045_0418366 3300049824 Bacteria 997
222 Ga0501045_0579652 3300049824 Unclassified 831
223 nmdc:mga06z11_196941_c1 3300050494 Bacteria 1168
224 nmdc:mga05p37_106964_c1 3300050507 Bacteria 3441
225 nmdc:mga05p37_331655_c1 3300050507 Bacteria 1797
226 nmdc:mga08y16_33642_c1 3300050511 Bacteria 5382
227 nmdc:mga0n895_226089_c1 3300050512 Bacteria 1899
228 nmdc:mga0n895_272711_c1 3300050512 Bacteria 1716
229 Ga0495601_0634788 3300053077 Bacteria 684
230 Ga0495595_0186503 3300053084 Bacteria 1030
231 Ga0495619_0048830 3300053085 Bacteria 2789
232 Ga0495619_0073266 3300053085 Bacteria 2295
233 Ga0501084_0411854 3300054114 Bacteria 1142
234 Ga0501082_0025101 3300060353 Bacteria 5135
235 Ga0501082_0033004 3300060353 Bacteria 4464
236 Ga0501082_0192032 3300060353 Bacteria 1776
237 Ga0530510_0009903 3300061734 Bacteria 6689
238 Ga0530510_0010034 3300061734 Bacteria 6642
239 Ga0530510_0158302 3300061734 Bacteria 1675
240 Ga0530510_0278787 3300061734 Bacteria 1248
241 Ga0068852_100033490
242 Ga0070676_10193323
243 Ga0070683_100002922
244 Ga0070680_100136905
245 Ga0068868_100008137
246 Ga0070691_10421943
247 Ga0070692_10103364
248 Ga0070668_100202202
249 Ga0070675_100394605
250 Ga0070674_100200799
251 Ga0070714_100583826
252 Ga0070713_100130497
253 Ga0070711_100097642
254 Ga0070700_100335618
255 Ga0070694_100069807
256 Ga0070708_100010667
257 Ga0070663_100099970
258 Ga0070678_100011103
259 Ga0070681_10006371
260 Ga0070681_10058451
261 Ga0068867_100725884
262 Ga0070685_10156336
263 Ga0070706_100037349
264 Ga0070707_100023151
265 Ga0070707_100377707
266 Ga0070698_100070889
267 Ga0070699_100029327
268 Ga0070679_100172137
269 Ga0070684_100000721
270 Ga0070696_100230053
271 Ga0070693_100004452
272 Ga0070665_100334223
273 Ga0068854_100311552
274 Ga0068856_100039848
275 Ga0070702_100205567
276 Ga0068864_100012754
277 Ga0068861_100215960
278 Ga0081455_10332189
279 Ga0081538_10001820
280 Ga0081538_10009165
281 Ga0081538_10063697
282 Ga0081538_10106037
283 Ga0081539_10008215
284 Ga0070717_10254571
285 Ga0070712_100053646
286 Ga0070712_100115495
287 Ga0075367_10227435
288 Ga0097621_100207822
289 Ga0075428_100180049
290 Ga0075428_100602152
291 Ga0075434_100498217
292 Ga0075429_100762040
293 Ga0068865_100114158
294 Ga0068865_100231180
295 Ga0111539_10016075
296 Ga0105245_10000886
297 Ga0105245_10029037
298 Ga0105245_10305622
299 Ga0114129_10058683
300 Ga0114129_10157782
301 Ga0105243_10235009
302 Ga0105243_10347639
303 Ga0105242_10489727
304 Ga0105238_10082931
305 Ga0105249_10059712
306 Ga0105239_10786550
307 Ga0157369_10449880
308 Ga0157374_10032162
309 Ga0163162_10503991
310 Ga0157375_10086746
311 Ga0157375_11303557
312 Ga0163163_10013246
313 Ga0163163_10427516
314 Ga0157380_10842191
315 Ga0157376_10190361
316 Ga0157376_10311233
317 Ga0206356_10997765
318 Ga0206354_10073080
319 Ga0206353_10581558
320 Ga0207642_10248526
321 Ga0207688_10008356
322 Ga0207699_10050165
323 Ga0207645_10046346
324 Ga0207643_10023866
325 Ga0207684_10153369
326 Ga0207684_10216272
327 Ga0207707_10020785
328 Ga0207707_10474969
329 Ga0207693_10025613
330 Ga0207693_10727127
331 Ga0207660_10099336
332 Ga0207660_10155654
333 Ga0207646_10011178
334 Ga0207646_10212405
335 Ga0207687_10013050
336 Ga0207700_10000001
337 Ga0207664_10526968
338 Ga0207704_10083328
339 Ga0207665_10004897
340 Ga0207689_10075820
341 Ga0207661_10051729
342 Ga0207667_10586537
343 Ga0207640_10371202
344 Ga0207678_10172781
345 Ga0207708_10073076
346 Ga0207702_10004098
347 Ga0207648_10791775
348 Ga0207675_100149949
349 Ga0207683_10010822
350 Ga0268266_10036563
351 Ga0268265_10367224
352 Ga0307408_100449090
353 Ga0307406_10464482
354 Ga0373936_0214079
355 Ga0395899_0007828
356 Ga0395899_0028486
357 Ga0395899_0066507
358 Ga0395900_0022614
359 Ga0395900_0022679
360 Ga0395900_0023996
361 Ga0395900_0055656
362 Ga0395900_0170930
363 Ga0395900_0378820
364 Ga0395900_1016554
365 Ga0395898_0002858
366 Ga0395898_0093507
367 Ga0395898_0106985
368 Ga0395898_0546223
369 Ga0395898_0771672
370 Ga0395898_0850276
371 Ga0395905_0002826
372 Ga0395905_0029705
373 Ga0395905_0064347
374 Ga0395905_0150369
375 Ga0395901_0007417
376 Ga0395901_0010617
377 Ga0395901_0078559
378 Ga0395901_0114450
379 Ga0395901_0367390
380 Ga0395901_0603207
381 Ga0395901_0606655
382 Ga0439438_065092
383 Ga0439431_0054997
384 Ga0450907_005941
385 Ga0439446_0016934
386 Ga0439434_0026709
387 Ga0439434_0118912
388 Ga0450918_009019
389 Ga0466963_0005696
390 Ga0466963_0120601
391 Ga0466964_0188501
392 Ga0466957_0042827
393 Ga0466958_0012058
394 Ga0466967_0172073
395 Ga0466967_0212911
396 Ga0466967_0441182
397 Ga0466967_0576830
398 Ga0495629_0010938
399 Ga0495653_0051289
400 Ga0495630_0052439
401 Ga0495630_0226607
402 Ga0495587_0089926
403 Ga0495668_0188362
404 Ga0495634_0141018
405 Ga0495680_0047346
406 Ga0496101_0250822
407 Ga0496102_0031090
408 Ga0496102_0031701
409 Ga0496102_0800764
410 Ga0496103_0007091
411 Ga0496104_0012670
412 Ga0496105_0136561
413 Ga0496110_0410081
414 Ga0496111_0049657
415 Ga0496111_0059509
416 Ga0496112_0683285
417 Ga0496114_0000442
418 Ga0496114_0215069
419 Ga0501031_0010987
420 Ga0501033_0066278
421 Ga0501034_0734910
422 Ga0501037_0265984
423 Ga0501038_0258729
424 Ga0501039_0011636
425 Ga0501039_0327350
426 Ga0501040_0335680
427 Ga0501041_0011657
428 Ga0501041_0195894
429 Ga0501042_0007018
430 Ga0501042_0240505
431 Ga0501043_0260959
432 Ga0501046_0024951
433 Ga0501046_0260240
434 Ga0501046_0520121
435 Ga0501048_0012448
436 Ga0501067_0019282
437 Ga0501067_0450138
438 Ga0501068_0204245
439 Ga0501070_0042381
440 Ga0501070_0056977
441 Ga0501071_0016948
442 Ga0501071_0109591
443 Ga0501072_0009619
444 Ga0501074_0017499
445 Ga0501074_0162541
446 Ga0501075_0048433
447 Ga0501076_0175362
448 Ga0501076_0241625
449 Ga0501077_0047941
450 Ga0501077_0139190
451 Ga0501079_0005337
452 Ga0501079_0145090
453 Ga0501079_0277555
454 Ga0501079_0509679
455 Ga0501079_0536908
456 Ga0501080_0027125
457 Ga0501083_0142078
458 Ga0501045_0034329
459 Ga0501045_0168697
460 Ga0501045_0350777
461 Ga0501045_0418366
462 Ga0501045_0579652
463 nmdc:mga06z11_196941_c1
464 nmdc:mga05p37_106964_c1
465 nmdc:mga05p37_331655_c1
466 nmdc:mga08y16_33642_c1
467 nmdc:mga0n895_226089_c1
468 nmdc:mga0n895_272711_c1
469 Ga0495601_0634788
470 Ga0495595_0186503
471 Ga0495619_0048830
472 Ga0495619_0073266
473 Ga0501084_0411854
474 Ga0501082_0025101
475 Ga0501082_0033004
476 Ga0501082_0192032
477 Ga0530510_0009903
478 Ga0530510_0010034
479 Ga0530510_0158302
480 Ga0530510_0278787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

180

233

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9245 153 200
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.918 142 204
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9037 140 196
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9 140 196
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8962 141 200
ID Description Score Start End Superfamily
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9127 140 198 1.10.10.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9056 140 203 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9038 143 204 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9037 140 196 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.903 140 196 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1RT21-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9584 18 203 GO:0003677
GO:0006352
GO:0016987
AF-A0A850CK01-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9202 22 203 GO:0006352
GO:0016987
AF-A0A3M1EEW3-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9104 16 117 GO:0003700
GO:0006352
AF-A0A0Q9KI24-F1-model_v4 RNA polymerase subunit sigma-24 0.8999 17 203 GO:0006352
GO:0016987
AF-A0A535HMV5-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8983 1 203 GO:0006352
GO:0016987

Map