F352124

General Info

Members Datasets Scaffolds Average Seq Length
239 116 238 564

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0031281|Ga0395900_0031281_2509_4512
Length 667
Sequence MAENGRARAACRLVNAGEIVAIVPPPPGSLGAGEADDGSKLAAQRRQPRPVQPSGRARSWFRVGGVGRRSVADCNHLEPRRHLLQTLASTVHGERKVNKFRWLTASALALATVPALAQNMGQFSTERLSQVDKVLSSDAFQGRGTASAIEPTVINYIAGQFKAAGVQPGGDIVNGKRSWFQNVPLLESQIVGTPQVSLNENGTVVPLQQGPDIAILAPLNGAKQVDLANAPLVFVGYGVDAPERGWNDFKGQNMHGKILVELINDPDFEASPGEPVAGKFGGKAMTYYGRWTYKYEEAARQGAAGVIIVHETAPASYPWAVVQNSNTNAQFDIVRDNPAAAHSEIESWIQRPLAVQLFQRSGLDFEQEKVAARSPNFQPVPLKATLSAHYAANPQVITSHNVVGLLPGRTHPDETVIYSAHWDHLGIGKPDATGDRIYNGAVDNGSGVSQLVEQARLFAHGPRPDRSIVFLAVTAEEKGLLGSAYYAAHPLYPAAKTVADLNVDAWLPAGPVKNFSMSGNAKLGLLDDLVAEGKREGLYFSPDPDPAAGHFYRSDHFSFAKIGVPAISVDEGRDLVNGGTARGDALAADYTAHHYHQPSDEWHSDWDWHGVAQIAYLVHQVGLQLANSREWPDWSADSEFRAARDRTAAERQGGTAPAVPPRKGERG

Samples

Sample ID Description Type Environment
1 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.09
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000552 3300001904 Bacteria 6943
2 JGI24741J21665_1005769 3300001915 Bacteria 2545
3 JGI24740J21852_10002043 3300001979 Bacteria 9231
4 JGI24740J21852_10004122 3300001979 Bacteria 6280
5 JGI24739J22299_10001216 3300001989 Bacteria 9652
6 JGI24738J21930_10005448 3300002075 Bacteria 3048
7 rootH2_10011295 3300003320 Bacteria 6368
8 Ga0070658_10000154 3300005327 Bacteria 60560
9 Ga0070658_10025330 3300005327 Bacteria 4757
10 Ga0070683_100001178 3300005329 Bacteria 19829
11 Ga0070683_100002352 3300005329 Bacteria 15007
12 Ga0070670_100002616 3300005331 Bacteria 14878
13 Ga0070670_100004587 3300005331 Bacteria 11596
14 Ga0070666_10000861 3300005335 Bacteria 18397
15 Ga0070666_10007771 3300005335 Bacteria 6623
16 Ga0070680_100003396 3300005336 Bacteria 11885
17 Ga0070680_100007505 3300005336 Bacteria 8317
18 Ga0070680_100022865 3300005336 Bacteria 4981
19 Ga0070682_100044392 3300005337 Bacteria 2752
20 Ga0070682_100067263 3300005337 Bacteria 2281
21 Ga0070660_100000284 3300005339 Bacteria 33712
22 Ga0070660_100091690 3300005339 Bacteria 2397
23 Ga0070661_100000195 3300005344 Bacteria 50203
24 Ga0070661_100017901 3300005344 Bacteria 5031
25 Ga0070669_100061160 3300005353 Bacteria 2767
26 Ga0070671_100030161 3300005355 Bacteria 4475
27 Ga0070673_100046173 3300005364 Bacteria 3382
28 Ga0070659_100001185 3300005366 Bacteria 19009
29 Ga0070667_100006230 3300005367 Bacteria 9926
30 Ga0070667_100009323 3300005367 Bacteria 8136
31 Ga0070713_100005382 3300005436 Bacteria 8743
32 Ga0070663_100006364 3300005455 Bacteria 7095
33 Ga0070663_100006885 3300005455 Bacteria 6881
34 Ga0070663_100032711 3300005455 Bacteria 3587
35 Ga0070662_100000049 3300005457 Bacteria 64630
36 Ga0070662_100003406 3300005457 Bacteria 9913
37 Ga0070662_100034238 3300005457 Bacteria 3581
38 Ga0070685_10000461 3300005466 Bacteria 23671
39 Ga0070684_100037825 3300005535 Bacteria 4142
40 Ga0070684_100047720 3300005535 Bacteria 3712
41 Ga0068853_100000098 3300005539 Bacteria 59230
42 Ga0068853_100066755 3300005539 Bacteria 3124
43 Ga0068853_100077635 3300005539 Bacteria 2901
44 Ga0070693_100000915 3300005547 Bacteria 13124
45 Ga0070665_100000051 3300005548 Bacteria 249317
46 Ga0070665_100001431 3300005548 Bacteria 27984
47 Ga0070665_100007827 3300005548 Bacteria 10840
48 Ga0070665_100015651 3300005548 Bacteria 7620
49 Ga0068855_100107317 3300005563 Bacteria 3208
50 Ga0070664_100000162 3300005564 Bacteria 46036
51 Ga0070664_100004692 3300005564 Bacteria 10962
52 Ga0068857_100020043 3300005577 Bacteria 5879
53 Ga0068857_100027835 3300005577 Bacteria 4984
54 Ga0068854_100003269 3300005578 Bacteria 10091
55 Ga0068854_100006393 3300005578 Bacteria 7494
56 Ga0068856_100000788 3300005614 Bacteria 34349
57 Ga0068856_100065800 3300005614 Bacteria 3582
58 Ga0068852_100004326 3300005616 Bacteria 10023
59 Ga0068852_100070388 3300005616 Bacteria 3069
60 Ga0068859_100079627 3300005617 Bacteria 3317
61 Ga0068864_100006671 3300005618 Bacteria 9450
62 Ga0068864_100006927 3300005618 Bacteria 9298
63 Ga0068851_10000626 3300005834 Bacteria 15011
64 Ga0068858_100019797 3300005842 Bacteria 6291
65 Ga0068858_100043384 3300005842 Bacteria 4170
66 Ga0068862_100002973 3300005844 Bacteria 14803
67 Ga0070717_10003063 3300006028 Bacteria 11920
68 Ga0097620_100079625 3300006931 Bacteria 3317
69 Ga0105240_10001066 3300009093 Bacteria 48453
70 Ga0105240_10011074 3300009093 Bacteria 12609
71 Ga0105240_10071445 3300009093 Bacteria 4292
72 Ga0105248_10000544 3300009177 Bacteria 43036
73 Ga0105248_10007594 3300009177 Bacteria 11910
74 Ga0105237_10041575 3300009545 Bacteria 4636
75 Ga0105238_10005470 3300009551 Bacteria 12559
76 Ga0105238_10009941 3300009551 Bacteria 9540
77 Ga0105238_10031323 3300009551 Bacteria 5413
78 Ga0105238_10056274 3300009551 Bacteria 3947
79 Ga0105238_10088089 3300009551 Bacteria 3091
80 Ga0105239_10269485 3300010375 Bacteria 1915
81 Ga0157373_10004808 3300013100 Bacteria 10162
82 Ga0157371_10002518 3300013102 Bacteria 17416
83 Ga0157371_10011021 3300013102 Bacteria 7003
84 Ga0157370_10001982 3300013104 Bacteria 25168
85 Ga0157370_10191944 3300013104 Bacteria 1896
86 Ga0157370_10203824 3300013104 Bacteria 1834
87 Ga0157369_10001843 3300013105 Bacteria 25619
88 Ga0157369_10074238 3300013105 Bacteria 3647
89 Ga0157372_10007229 3300013307 Bacteria 11822
90 Ga0157372_10177073 3300013307 Bacteria 2469
91 Ga0163163_10000258 3300014325 Bacteria 53627
92 Ga0206353_10756301 3300020082 Bacteria 2204
93 Ga0209233_1004747 3300025261 Bacteria 4585
94 Ga0207656_10001414 3300025321 Bacteria 7932
95 Ga0207680_10004358 3300025903 Bacteria 6706
96 Ga0207647_10000700 3300025904 Bacteria 26295
97 Ga0207647_10001961 3300025904 Bacteria 15715
98 Ga0207705_10000003 3300025909 Bacteria 709270
99 Ga0207705_10000285 3300025909 Bacteria 47658
100 Ga0207705_10029103 3300025909 Bacteria 3938
101 Ga0207705_10043587 3300025909 Bacteria 3224
102 Ga0207705_10064775 3300025909 Bacteria 2641
103 Ga0207654_10028652 3300025911 Bacteria 3038
104 Ga0207707_10019460 3300025912 Bacteria 5927
105 Ga0207695_10000007 3300025913 Bacteria 1092551
106 Ga0207695_10003916 3300025913 Bacteria 20603
107 Ga0207695_10014239 3300025913 Bacteria 9434
108 Ga0207695_10031816 3300025913 Bacteria 5781
109 Ga0207671_10023439 3300025914 Bacteria 4655
110 Ga0207660_10004794 3300025917 Bacteria 8799
111 Ga0207660_10010077 3300025917 Bacteria 6122
112 Ga0207660_10010874 3300025917 Bacteria 5917
113 Ga0207657_10001793 3300025919 Bacteria 23164
114 Ga0207657_10003186 3300025919 Bacteria 17549
115 Ga0207657_10005774 3300025919 Bacteria 12905
116 Ga0207657_10030668 3300025919 Bacteria 4878
117 Ga0207657_10038178 3300025919 Bacteria 4279
118 Ga0207649_10000128 3300025920 Bacteria 64425
119 Ga0207649_10000772 3300025920 Bacteria 20748
120 Ga0207649_10005940 3300025920 Bacteria 6618
121 Ga0207652_10042164 3300025921 Bacteria 3882
122 Ga0207652_10050644 3300025921 Bacteria 3558
123 Ga0207694_10007272 3300025924 Bacteria 8402
124 Ga0207694_10150043 3300025924 Bacteria 1877
125 Ga0207650_10004574 3300025925 Bacteria 9463
126 Ga0207690_10000045 3300025932 Bacteria 116965
127 Ga0207690_10005507 3300025932 Bacteria 7471
128 Ga0207690_10006187 3300025932 Bacteria 7088
129 Ga0207690_10022115 3300025932 Bacteria 3951
130 Ga0207690_10023262 3300025932 Bacteria 3866
131 Ga0207706_10001806 3300025933 Bacteria 21008
132 Ga0207706_10004507 3300025933 Bacteria 13081
133 Ga0207706_10006297 3300025933 Bacteria 11027
134 Ga0207711_10001709 3300025941 Bacteria 20197
135 Ga0207711_10009979 3300025941 Bacteria 7891
136 Ga0207661_10000187 3300025944 Bacteria 40098
137 Ga0207661_10036044 3300025944 Bacteria 3859
138 Ga0207679_10000823 3300025945 Bacteria 19975
139 Ga0207679_10014328 3300025945 Bacteria 5210
140 Ga0207667_10002911 3300025949 Bacteria 21255
141 Ga0207667_10006957 3300025949 Bacteria 13671
142 Ga0207667_10009104 3300025949 Bacteria 11736
143 Ga0207667_10020737 3300025949 Bacteria 7301
144 Ga0207712_10000197 3300025961 Bacteria 61066
145 Ga0207712_10056320 3300025961 Bacteria 2769
146 Ga0207640_10005300 3300025981 Bacteria 7025
147 Ga0207640_10005738 3300025981 Bacteria 6763
148 Ga0207658_10008229 3300025986 Bacteria 7105
149 Ga0207658_10020993 3300025986 Bacteria 4528
150 Ga0207703_10004129 3300026035 Bacteria 11982
151 Ga0207703_10030396 3300026035 Bacteria 4269
152 Ga0207639_10000446 3300026041 Bacteria 28443
153 Ga0207639_10033343 3300026041 Bacteria 3798
154 Ga0207678_10001892 3300026067 Bacteria 19098
155 Ga0207678_10005957 3300026067 Bacteria 10856
156 Ga0207678_10006499 3300026067 Bacteria 10375
157 Ga0207678_10053894 3300026067 Bacteria 3464
158 Ga0207702_10001605 3300026078 Bacteria 22360
159 Ga0207702_10004836 3300026078 Bacteria 11862
160 Ga0207702_10029074 3300026078 Bacteria 4597
161 Ga0207676_10012359 3300026095 Bacteria 6115
162 Ga0207674_10003312 3300026116 Bacteria 19806
163 Ga0207674_10007185 3300026116 Bacteria 13000
164 Ga0207674_10012225 3300026116 Bacteria 9602
165 Ga0207698_10000780 3300026142 Bacteria 18515
166 Ga0207698_10001792 3300026142 Bacteria 12531
167 Ga0207698_10004053 3300026142 Bacteria 8897
168 Ga0207698_10012203 3300026142 Bacteria 5612
169 Ga0207698_10018898 3300026142 Bacteria 4706
170 Ga0207698_10052411 3300026142 Bacteria 3126
171 Ga0268266_10000002 3300028379 Bacteria 3059047
172 Ga0268266_10000006 3300028379 Bacteria 1410021
173 Ga0268265_10143151 3300028380 Bacteria 2004
174 Ga0265327_10000280 3300031251 Bacteria 100757
175 Ga0307408_100136770 3300031548 Bacteria 1918
176 Ga0307410_10002704 3300031852 Bacteria 8656
177 Ga0307410_10019284 3300031852 Bacteria 4144
178 Ga0307411_10077800 3300032005 Bacteria 2272
179 Ga0395899_0022637 3300037312 Bacteria 4760
180 Ga0395899_0060198 3300037312 Bacteria 2797
181 Ga0395899_0117424 3300037312 Bacteria 1908
182 Ga0395900_0003200 3300037418 Bacteria 17732
183 Ga0395900_0003660 3300037418 Bacteria 16531
184 Ga0395900_0003797 3300037418 Bacteria 16176
185 Ga0395900_0005341 3300037418 Bacteria 13461
186 Ga0395900_0006793 3300037418 Bacteria 11873
187 Ga0395900_0030591 3300037418 Bacteria 5528
188 Ga0395900_0031281 3300037418 Bacteria 5467
189 Ga0395900_0068721 3300037418 Bacteria 3641
190 Ga0395900_0098200 3300037418 Bacteria 3009
191 Ga0395898_0006157 3300037466 Bacteria 12848
192 Ga0395898_0007616 3300037466 Bacteria 11494
193 Ga0395898_0138460 3300037466 Bacteria 2330
194 Ga0395905_0006189 3300037471 Bacteria 12079
195 Ga0395905_0010769 3300037471 Bacteria 8862
196 Ga0395901_0000295 3300038443 Bacteria 61830
197 Ga0395901_0001874 3300038443 Bacteria 21681
198 Ga0395901_0044555 3300038443 Bacteria 4601
199 Ga0395901_0057299 3300038443 Bacteria 4053
200 Ga0395901_0078939 3300038443 Bacteria 3436
201 Ga0395901_0102947 3300038443 Bacteria 2996
202 Ga0395901_0121272 3300038443 Bacteria 2748
203 Ga0395901_0165445 3300038443 Bacteria 2322
204 Ga0451793_0319047 3300041452 Bacteria 8683
205 Ga0451807_1134556 3300041486 Bacteria 5624
206 Ga0466969_0005911 3300044656 Bacteria 6509
207 Ga0466966_0000010 3300044684 Bacteria 150868
208 Ga0466966_0043849 3300044684 Bacteria 2865
209 Ga0466961_0002980 3300044693 Bacteria 10518
210 Ga0466961_0022315 3300044693 Bacteria 4072
211 Ga0466961_0031826 3300044693 Bacteria 3390
212 Ga0466963_0002390 3300044694 Bacteria 10497
213 Ga0466963_0006016 3300044694 Bacteria 7148
214 Ga0466963_0014279 3300044694 Bacteria 4894
215 Ga0466963_0018232 3300044694 Bacteria 4384
216 Ga0466963_0025974 3300044694 Bacteria 3741
217 Ga0466964_0008025 3300044706 Bacteria 3956
218 Ga0466957_0001324 3300044842 Bacteria 12933
219 Ga0466957_0004683 3300044842 Bacteria 7651
220 Ga0466957_0026891 3300044842 Bacteria 3415
221 Ga0466959_0003693 3300045049 Bacteria 10097
222 Ga0466959_0047987 3300045049 Bacteria 3139
223 Ga0466959_0080100 3300045049 Bacteria 2354
224 Ga0466958_0002969 3300045836 Bacteria 8688
225 Ga0466958_0005393 3300045836 Bacteria 6874
226 Ga0466958_0036243 3300045836 Bacteria 2952
227 Ga0466967_0000381 3300045976 Bacteria 20628
228 Ga0466967_0021880 3300045976 Bacteria 5204
229 Ga0495663_0008230 3300046525 Bacteria 2886
230 Ga0495598_0004936 3300046537 Bacteria 2924
231 Ga0496107_0005474 3300048910 Bacteria 8686
232 Ga0496108_0016972 3300048911 Bacteria 5951
233 Ga0496112_0015587 3300048915 Bacteria 7099
234 Ga0496116_0061523 3300048919 Bacteria 2430
235 Ga0496125_0000334 3300048928 Bacteria 90058
236 Ga0501074_0053819 3300049590 Bacteria 2903
237 Ga0501235_007026 3300049669 Bacteria 2451
238 nmdc:mga0n895_52573_c1 3300050512 Bacteria 3999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10056320 Ga0207712_100563202 536
2 3300001915 JGI24741J21665_1005769 JGI24741J21665_10057693 537
3 3300001979 JGI24740J21852_10004122 JGI24740J21852_100041222 537
4 3300025909 Ga0207705_10064775 Ga0207705_100647752 537
5 3300025912 Ga0207707_10019460 Ga0207707_100194602 537
6 3300025919 Ga0207657_10030668 Ga0207657_100306682 537
7 3300025921 Ga0207652_10042164 Ga0207652_100421642 537
8 3300025932 Ga0207690_10006187 Ga0207690_100061874 537
9 3300025933 Ga0207706_10006297 Ga0207706_1000629713 537
10 3300025945 Ga0207679_10014328 Ga0207679_100143282 537
11 3300026067 Ga0207678_10005957 Ga0207678_1000595713 537
12 3300026116 Ga0207674_10007185 Ga0207674_1000718513 537
13 3300037312 Ga0395899_0117424 Ga0395899_0117424_54_1796 539
14 3300037471 Ga0395905_0006189 Ga0395905_0006189_10218_11960 539
15 iso_pu_bacteria 2941485952 2941487999 539
16 3300037418 Ga0395900_0003797 Ga0395900_0003797_2120_3862 540
17 3300038443 Ga0395901_0078939 Ga0395901_0078939_993_2735 540
18 3300003320 rootH2_10011295 rootH2_100112955 541
19 3300048919 Ga0496116_0061523 Ga0496116_0061523_259_1914 541
20 3300048928 Ga0496125_0000334 Ga0496125_0000334_67410_69065 541
21 3300005548 Ga0070665_100000051 Ga0070665_10000005133 543
22 3300028379 Ga0268266_10000002 Ga0268266_100000022749 543
23 3300005367 Ga0070667_100006230 Ga0070667_1000062306 544
24 3300025986 Ga0207658_10008229 Ga0207658_100082297 544
25 3300038443 Ga0395901_0057299 Ga0395901_0057299_506_2149 544
26 3300038443 Ga0395901_0102947 Ga0395901_0102947_175_1818 544
27 3300005455 Ga0070663_100032711 Ga0070663_1000327111 546
28 3300005466 Ga0070685_10000461 Ga0070685_100004611 546
29 3300009545 Ga0105237_10041575 Ga0105237_100415753 546
30 3300009551 Ga0105238_10009941 Ga0105238_100099413 546
31 3300010375 Ga0105239_10269485 Ga0105239_102694851 546
32 3300025261 Ga0209233_1004747 Ga0209233_10047473 546
33 3300025913 Ga0207695_10000007 Ga0207695_10000007666 546
34 3300025924 Ga0207694_10007272 Ga0207694_100072723 546
35 3300046537 Ga0495598_0004936 Ga0495598_0004936_1024_2667 546
36 3300031251 Ga0265327_10000280 Ga0265327_1000028054 547
37 3300037418 Ga0395900_0003660 Ga0395900_0003660_3466_5163 547
38 3300038443 Ga0395901_0000295 Ga0395901_0000295_49108_50805 547
39 3300005335 Ga0070666_10007771 Ga0070666_100077715 548
40 3300005344 Ga0070661_100017901 Ga0070661_1000179015 548
41 3300005455 Ga0070663_100006885 Ga0070663_1000068855 548
42 3300005457 Ga0070662_100003406 Ga0070662_1000034063 548
43 3300005548 Ga0070665_100001431 Ga0070665_10000143124 548
44 3300009551 Ga0105238_10056274 Ga0105238_100562741 548
45 3300013105 Ga0157369_10001843 Ga0157369_100018433 548
46 3300025904 Ga0207647_10000700 Ga0207647_1000070024 548
47 3300025911 Ga0207654_10028652 Ga0207654_100286522 548
48 3300025913 Ga0207695_10031816 Ga0207695_100318164 548
49 3300026035 Ga0207703_10004129 Ga0207703_1000412913 548
50 3300028379 Ga0268266_10000006 Ga0268266_1000000665 548
51 3300009093 Ga0105240_10001066 Ga0105240_100010667 549
52 3300037312 Ga0395899_0022637 Ga0395899_0022637_2679_4409 549
53 3300037418 Ga0395900_0003200 Ga0395900_0003200_12815_14545 549
54 3300037466 Ga0395898_0006157 Ga0395898_0006157_6247_7977 549
55 3300038443 Ga0395901_0001874 Ga0395901_0001874_12842_14572 549
56 3300041452 Ga0451793_0319047 Ga0451793_0319047_6685_8340 549
57 3300041486 Ga0451807_1134556 Ga0451807_1134556_660_2315 549
58 3300005834 Ga0068851_10000626 Ga0068851_1000062610 551
59 3300025321 Ga0207656_10001414 Ga0207656_100014143 551
60 3300025903 Ga0207680_10004358 Ga0207680_100043583 551
61 3300025933 Ga0207706_10004507 Ga0207706_1000450710 551
62 3300025961 Ga0207712_10000197 Ga0207712_1000019734 551
63 3300026041 Ga0207639_10000446 Ga0207639_100004464 551
64 3300026067 Ga0207678_10001892 Ga0207678_1000189214 551
65 3300005577 Ga0068857_100020043 Ga0068857_1000200434 552
66 3300009177 Ga0105248_10000544 Ga0105248_1000054413 555
67 3300009551 Ga0105238_10031323 Ga0105238_100313234 555
68 3300013102 Ga0157371_10002518 Ga0157371_100025187 555
69 3300014325 Ga0163163_10000258 Ga0163163_100002584 555
70 3300037418 Ga0395900_0005341 Ga0395900_0005341_2861_4555 555
71 3300037466 Ga0395898_0007616 Ga0395898_0007616_8779_10473 555
72 3300037471 Ga0395905_0010769 Ga0395905_0010769_3686_5380 555
73 3300038443 Ga0395901_0044555 Ga0395901_0044555_2125_3819 555
74 3300044694 Ga0466963_0014279 Ga0466963_0014279_3003_4721 555
75 3300044842 Ga0466957_0004683 Ga0466957_0004683_1267_2985 555
76 3300045049 Ga0466959_0080100 Ga0466959_0080100_638_2341 555
77 3300045836 Ga0466958_0002969 Ga0466958_0002969_6564_8282 555
78 3300044694 Ga0466963_0025974 Ga0466963_0025974_1829_3532 556
79 3300045836 Ga0466958_0036243 Ga0466958_0036243_147_1850 556
80 3300005331 Ga0070670_100004587 Ga0070670_1000045877 557
81 3300005353 Ga0070669_100061160 Ga0070669_1000611603 558
82 3300026116 Ga0207674_10012225 Ga0207674_100122259 558
83 3300031548 Ga0307408_100136770 Ga0307408_1001367701 558
84 3300032005 Ga0307411_10077800 Ga0307411_100778002 558
85 3300046525 Ga0495663_0008230 Ga0495663_0008230_308_1987 558
86 3300001989 JGI24739J22299_10001216 JGI24739J22299_1000121610 560
87 3300002075 JGI24738J21930_10005448 JGI24738J21930_100054481 560
88 3300005327 Ga0070658_10000154 Ga0070658_1000015449 560
89 3300005329 Ga0070683_100001178 Ga0070683_1000011789 560
90 3300005331 Ga0070670_100002616 Ga0070670_10000261610 560
91 3300005335 Ga0070666_10000861 Ga0070666_1000086111 560
92 3300005337 Ga0070682_100044392 Ga0070682_1000443922 560
93 3300005339 Ga0070660_100000284 Ga0070660_10000028413 560
94 3300005344 Ga0070661_100000195 Ga0070661_10000019548 560
95 3300005355 Ga0070671_100030161 Ga0070671_1000301614 560
96 3300005366 Ga0070659_100001185 Ga0070659_10000118513 560
97 3300005367 Ga0070667_100009323 Ga0070667_1000093238 560
98 3300005455 Ga0070663_100006364 Ga0070663_1000063646 560
99 3300005457 Ga0070662_100000049 Ga0070662_10000004913 560
100 3300005535 Ga0070684_100047720 Ga0070684_1000477204 560
101 3300005539 Ga0068853_100000098 Ga0068853_10000009848 560
102 3300005547 Ga0070693_100000915 Ga0070693_1000009158 560
103 3300005548 Ga0070665_100015651 Ga0070665_1000156515 560
104 3300005564 Ga0070664_100000162 Ga0070664_10000016213 560
105 3300005614 Ga0068856_100000788 Ga0068856_10000078813 560
106 3300005617 Ga0068859_100079627 Ga0068859_1000796273 560
107 3300005618 Ga0068864_100006671 Ga0068864_1000066717 560
108 3300005842 Ga0068858_100043384 Ga0068858_1000433843 560
109 3300006931 Ga0097620_100079625 Ga0097620_1000796253 560
110 3300025909 Ga0207705_10000285 Ga0207705_1000028549 560
111 3300025919 Ga0207657_10001793 Ga0207657_1000179313 560
112 3300025920 Ga0207649_10000128 Ga0207649_1000012851 560
113 3300025925 Ga0207650_10004574 Ga0207650_100045742 560
114 3300025932 Ga0207690_10000045 Ga0207690_10000045103 560
115 3300025933 Ga0207706_10001806 Ga0207706_1000180613 560
116 3300025941 Ga0207711_10001709 Ga0207711_1000170913 560
117 3300025944 Ga0207661_10000187 Ga0207661_1000018713 560
118 3300025945 Ga0207679_10000823 Ga0207679_100008238 560
119 3300025949 Ga0207667_10002911 Ga0207667_1000291113 560
120 3300025986 Ga0207658_10020993 Ga0207658_100209932 560
121 3300026035 Ga0207703_10030396 Ga0207703_100303964 560
122 3300026067 Ga0207678_10006499 Ga0207678_100064997 560
123 3300026078 Ga0207702_10001605 Ga0207702_1000160513 560
124 3300026142 Ga0207698_10000780 Ga0207698_100007804 560
125 3300045976 Ga0466967_0021880 Ga0466967_0021880_122_1855 560
126 3300049590 Ga0501074_0053819 Ga0501074_0053819_80_1816 560
127 3300005844 Ga0068862_100002973 Ga0068862_1000029739 561
128 3300013102 Ga0157371_10011021 Ga0157371_100110214 561
129 3300025921 Ga0207652_10050644 Ga0207652_100506442 561
130 3300038443 Ga0395901_0121272 Ga0395901_0121272_537_2222 561
131 3300049669 Ga0501235_007026 Ga0501235_007026_703_2403 561
132 3300005329 Ga0070683_100002352 Ga0070683_10000235210 562
133 3300005535 Ga0070684_100037825 Ga0070684_1000378252 562
134 3300005539 Ga0068853_100077635 Ga0068853_1000776352 562
135 3300025919 Ga0207657_10038178 Ga0207657_100381782 562
136 3300025932 Ga0207690_10022115 Ga0207690_100221152 562
137 3300026067 Ga0207678_10053894 Ga0207678_100538942 562
138 3300026078 Ga0207702_10004836 Ga0207702_100048362 562
139 3300031852 Ga0307410_10019284 Ga0307410_100192843 562
140 3300044684 Ga0466966_0043849 Ga0466966_0043849_779_2518 563
141 3300044693 Ga0466961_0031826 Ga0466961_0031826_348_2087 563
142 3300044706 Ga0466964_0008025 Ga0466964_0008025_428_2137 563
143 3300045049 Ga0466959_0047987 Ga0466959_0047987_925_2664 563
144 3300005337 Ga0070682_100067263 Ga0070682_1000672632 564
145 3300031852 Ga0307410_10002704 Ga0307410_1000270411 565
146 3300037418 Ga0395900_0006793 Ga0395900_0006793_7268_9001 565
147 3300025909 Ga0207705_10029103 Ga0207705_100291032 566
148 3300028380 Ga0268265_10143151 Ga0268265_101431511 566
149 3300050512 nmdc:mga0n895_52573_c1 nmdc:mga0n895_52573_c1_1369_3069 566
150 3300013104 Ga0157370_10203824 Ga0157370_102038241 567
151 3300005336 Ga0070680_100003396 Ga0070680_1000033963 568
152 3300005539 Ga0068853_100066755 Ga0068853_1000667551 568
153 3300005563 Ga0068855_100107317 Ga0068855_1001073172 568
154 3300005578 Ga0068854_100006393 Ga0068854_1000063934 568
155 3300005616 Ga0068852_100004326 Ga0068852_1000043269 568
156 3300005616 Ga0068852_100070388 Ga0068852_1000703881 568
157 3300013104 Ga0157370_10001982 Ga0157370_100019827 568
158 3300020082 Ga0206353_10756301 Ga0206353_107563011 568
159 3300025917 Ga0207660_10004794 Ga0207660_100047944 568
160 3300025917 Ga0207660_10010077 Ga0207660_100100774 568
161 3300025949 Ga0207667_10006957 Ga0207667_100069579 568
162 3300025981 Ga0207640_10005738 Ga0207640_100057385 568
163 3300026142 Ga0207698_10004053 Ga0207698_100040537 568
164 3300026142 Ga0207698_10052411 Ga0207698_100524111 568
165 3300037418 Ga0395900_0068721 Ga0395900_0068721_195_1904 568
166 3300037418 Ga0395900_0098200 Ga0395900_0098200_332_2041 568
167 3300044694 Ga0466963_0002390 Ga0466963_0002390_4518_6236 568
168 3300044694 Ga0466963_0018232 Ga0466963_0018232_1507_3231 568
169 3300044842 Ga0466957_0001324 Ga0466957_0001324_4058_5776 568
170 3300045976 Ga0466967_0000381 Ga0466967_0000381_13324_15042 568
171 3300005327 Ga0070658_10025330 Ga0070658_100253302 569
172 3300005364 Ga0070673_100046173 Ga0070673_1000461732 569
173 3300005548 Ga0070665_100007827 Ga0070665_1000078274 569
174 3300005618 Ga0068864_100006927 Ga0068864_1000069277 569
175 3300009177 Ga0105248_10007594 Ga0105248_100075949 569
176 3300025909 Ga0207705_10043587 Ga0207705_100435872 569
177 3300025941 Ga0207711_10009979 Ga0207711_100099796 569
178 3300026095 Ga0207676_10012359 Ga0207676_100123591 569
179 3300037466 Ga0395898_0138460 Ga0395898_0138460_222_1943 569
180 3300038443 Ga0395901_0165445 Ga0395901_0165445_177_1898 569
181 3300048910 Ga0496107_0005474 Ga0496107_0005474_6800_8515 569
182 3300048911 Ga0496108_0016972 Ga0496108_0016972_2375_4090 569
183 3300048915 Ga0496112_0015587 Ga0496112_0015587_5082_6797 569
184 3300001979 JGI24740J21852_10002043 JGI24740J21852_100020438 570
185 3300005336 Ga0070680_100007505 Ga0070680_1000075057 570
186 3300005336 Ga0070680_100022865 Ga0070680_1000228651 570
187 3300005339 Ga0070660_100091690 Ga0070660_1000916902 570
188 3300005436 Ga0070713_100005382 Ga0070713_1000053826 570
189 3300005457 Ga0070662_100034238 Ga0070662_1000342382 570
190 3300005564 Ga0070664_100004692 Ga0070664_10000469210 570
191 3300005577 Ga0068857_100027835 Ga0068857_1000278352 570
192 3300005842 Ga0068858_100019797 Ga0068858_1000197971 570
193 3300006028 Ga0070717_10003063 Ga0070717_100030633 570
194 3300009093 Ga0105240_10011074 Ga0105240_100110742 570
195 3300009551 Ga0105238_10005470 Ga0105238_1000547012 570
196 3300009551 Ga0105238_10088089 Ga0105238_100880892 570
197 3300013100 Ga0157373_10004808 Ga0157373_100048089 570
198 3300013104 Ga0157370_10191944 Ga0157370_101919442 570
199 3300013105 Ga0157369_10074238 Ga0157369_100742382 570
200 3300013307 Ga0157372_10007229 Ga0157372_1000722911 570
201 3300025904 Ga0207647_10001961 Ga0207647_100019612 570
202 3300025914 Ga0207671_10023439 Ga0207671_100234391 570
203 3300025917 Ga0207660_10010874 Ga0207660_100108743 570
204 3300025919 Ga0207657_10003186 Ga0207657_100031862 570
205 3300025920 Ga0207649_10005940 Ga0207649_100059402 570
206 3300025924 Ga0207694_10150043 Ga0207694_101500431 570
207 3300025932 Ga0207690_10005507 Ga0207690_100055072 570
208 3300025944 Ga0207661_10036044 Ga0207661_100360442 570
209 3300025981 Ga0207640_10005300 Ga0207640_100053004 570
210 3300026041 Ga0207639_10033343 Ga0207639_100333431 570
211 3300026116 Ga0207674_10003312 Ga0207674_100033126 570
212 3300026142 Ga0207698_10001792 Ga0207698_1000179212 570
213 3300026142 Ga0207698_10012203 Ga0207698_100122035 570
214 3300026142 Ga0207698_10018898 Ga0207698_100188984 570
215 3300037418 Ga0395900_0030591 Ga0395900_0030591_2817_4538 570
216 3300044693 Ga0466961_0022315 Ga0466961_0022315_592_2328 570
217 3300001904 JGI24736J21556_1000552 JGI24736J21556_10005525 571
218 3300005578 Ga0068854_100003269 Ga0068854_1000032695 571
219 3300005614 Ga0068856_100065800 Ga0068856_1000658003 571
220 3300009093 Ga0105240_10071445 Ga0105240_100714452 571
221 3300013307 Ga0157372_10177073 Ga0157372_101770732 571
222 3300025909 Ga0207705_10000003 Ga0207705_10000003389 571
223 3300025913 Ga0207695_10003916 Ga0207695_1000391613 571
224 3300025913 Ga0207695_10014239 Ga0207695_100142395 571
225 3300025919 Ga0207657_10005774 Ga0207657_100057742 571
226 3300025920 Ga0207649_10000772 Ga0207649_1000077219 571
227 3300025932 Ga0207690_10023262 Ga0207690_100232623 571
228 3300025949 Ga0207667_10009104 Ga0207667_100091045 571
229 3300025949 Ga0207667_10020737 Ga0207667_100207376 571
230 3300026078 Ga0207702_10029074 Ga0207702_100290742 571
231 3300037312 Ga0395899_0060198 Ga0395899_0060198_909_2624 571
232 3300037418 Ga0395900_0031281 Ga0395900_0031281_2509_4512 571
233 3300044656 Ga0466969_0005911 Ga0466969_0005911_2909_4624 571
234 3300044684 Ga0466966_0000010 Ga0466966_0000010_122149_123879 571
235 3300044693 Ga0466961_0002980 Ga0466961_0002980_5872_7587 571
236 3300044694 Ga0466963_0006016 Ga0466963_0006016_2865_4580 571
237 3300044842 Ga0466957_0026891 Ga0466957_0026891_953_2668 571
238 3300045049 Ga0466959_0003693 Ga0466959_0003693_194_1909 571
239 3300045836 Ga0466958_0005393 Ga0466958_0005393_4207_5922 571

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

401

622

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ica-assembly3.cif.gz_C the crystal structure of legionella pneumophila lapa aminopeptidase 0.7928 303 534
6ica-assembly2.cif.gz_B the crystal structure of legionella pneumophila lapa aminopeptidase 0.7902 303 534
6esl-assembly1.cif.gz_A crystal structure of the legionella pneumoppila lapa 0.7856 303 532
6ica-assembly1.cif.gz_A the crystal structure of legionella pneumophila lapa aminopeptidase 0.7844 303 532
6esl-assembly1.cif.gz_B crystal structure of the legionella pneumoppila lapa 0.7797 303 532
ID Description Score Start End Superfamily
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7762 19 535 3.40.630.10
af_P37302_266_505_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7702 299 534 3.40.630.10
1xjoA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.751 301 531 3.40.630.10
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.746 19 535 3.40.630.10
af_Q5AA00_122_414_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7348 303 532 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A525J9E3-F1-model_v4 M28 family peptidase 0.9695 303 558 GO:0006508
GO:0008235
AF-A0A259JBB5-F1-model_v4 deleted 0.9692 322 556
AF-A0A4Q3SHX5-F1-model_v4 M28 family peptidase 0.9663 211 556 GO:0006508
GO:0008235
AF-L8FUV1-F1-model_v4 PA domain-containing protein 0.9635 150 284
AF-A0A7X5SBD9-F1-model_v4 Peptidase M20 0.9624 111 312

Feature Viewer

pLDDT pTM Quality
88.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map