F351806

General Info

Members Datasets Scaffolds Average Seq Length
239 144 478 125

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1152510|Ga0081540_11525101
Length 132
Sequence LRGSSKQVTVLIDSDILIEVSRGRNTAVVSKWIELSTSDALVLFSPVTAAELWAGARPAEYKALEALFEALVCVPADAAVGRQAGEYLRRYRKSHAVELGDALIAASTVVSGALLWTRNRKHYPMSDLTFFD

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.09
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 28.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1152510 3300005983 Bacteria 909
2 Ga0065707_10120561 3300005295 Bacteria 2099
3 Ga0070683_100000049 3300005329 Bacteria 93310
4 Ga0070683_100279618 3300005329 Bacteria 1588
5 Ga0070690_100143702 3300005330 Bacteria 1621
6 Ga0068869_100306433 3300005334 Bacteria 1284
7 Ga0068869_100528372 3300005334 Unclassified 988
8 Ga0068869_100821992 3300005334 Bacteria 800
9 Ga0070666_10033902 3300005335 Bacteria 3382
10 Ga0068868_100070083 3300005338 Bacteria 2795
11 Ga0070660_100815661 3300005339 Unclassified 785
12 Ga0070669_101415141 3300005353 Unclassified 603
13 Ga0070659_100451617 3300005366 Bacteria 1090
14 Ga0070667_100052210 3300005367 Bacteria 3449
15 Ga0070667_101245044 3300005367 Unclassified 697
16 Ga0070714_100110579 3300005435 Unclassified 2432
17 Ga0070710_10306664 3300005437 Unclassified 1038
18 Ga0070705_100813330 3300005440 Bacteria 744
19 Ga0070700_100342518 3300005441 Bacteria 1105
20 Ga0070694_100597605 3300005444 Unclassified 888
21 Ga0070708_100030673 3300005445 Bacteria 4648
22 Ga0070708_100039108 3300005445 Bacteria 4148
23 Ga0070681_10073431 3300005458 Bacteria 3382
24 Ga0068867_100066821 3300005459 Bacteria 2679
25 Ga0068867_100262756 3300005459 Unclassified 1408
26 Ga0068867_100332458 3300005459 Bacteria 1262
27 Ga0070706_100023366 3300005467 Bacteria 5693
28 Ga0070706_100139265 3300005467 Unclassified 2265
29 Ga0070707_100007037 3300005468 Bacteria 10436
30 Ga0070707_100223045 3300005468 Bacteria 1836
31 Ga0070679_100576431 3300005530 Unclassified 1069
32 Ga0070679_100885942 3300005530 Unclassified 836
33 Ga0070684_100000040 3300005535 Bacteria 93306
34 Ga0070684_100029124 3300005535 Bacteria 4677
35 Ga0070697_101621771 3300005536 Unclassified 578
36 Ga0068853_100170276 3300005539 Bacteria 1970
37 Ga0068853_100237205 3300005539 Unclassified 1670
38 Ga0068853_100584222 3300005539 Bacteria 1060
39 Ga0070686_100059805 3300005544 Bacteria 2456
40 Ga0070686_100909574 3300005544 Bacteria 716
41 Ga0070696_100330778 3300005546 Bacteria 1175
42 Ga0070704_100061827 3300005549 Bacteria 2682
43 Ga0068855_100051195 3300005563 Bacteria 4865
44 Ga0068855_100101531 3300005563 Unclassified 3311
45 Ga0068855_100119428 3300005563 Bacteria 3018
46 Ga0068855_100353087 3300005563 Unclassified 1619
47 Ga0070664_100368652 3300005564 Bacteria 1309
48 Ga0070664_101246516 3300005564 Bacteria 702
49 Ga0068857_100061688 3300005577 Bacteria 3331
50 Ga0068857_100285980 3300005577 Bacteria 1517
51 Ga0068856_100255839 3300005614 Unclassified 1766
52 Ga0068856_100798723 3300005614 Unclassified 963
53 Ga0068852_100017918 3300005616 Bacteria 5569
54 Ga0068859_100139180 3300005617 Bacteria 2501
55 Ga0068864_100370630 3300005618 Bacteria 1355
56 Ga0068866_10448062 3300005718 Unclassified 843
57 Ga0068866_10520639 3300005718 Unclassified 790
58 Ga0068863_100088560 3300005841 Bacteria 2934
59 Ga0068863_100160195 3300005841 Bacteria 2156
60 Ga0068863_102198231 3300005841 Unclassified 562
61 Ga0068858_100031642 3300005842 Bacteria 4915
62 Ga0068858_102436086 3300005842 Unclassified 517
63 Ga0068860_100017992 3300005843 Bacteria 6883
64 Ga0068860_100048152 3300005843 Bacteria 4063
65 Ga0070717_10012713 3300006028 Bacteria 6425
66 Ga0070715_10195009 3300006163 Bacteria 1025
67 Ga0070716_100052951 3300006173 Bacteria 2312
68 Ga0070716_100128869 3300006173 Bacteria 1596
69 Ga0097621_100016251 3300006237 Bacteria 5620
70 Ga0097621_100266894 3300006237 Bacteria 1503
71 Ga0097621_100589462 3300006237 Unclassified 1015
72 Ga0068871_100173443 3300006358 Unclassified 1850
73 Ga0075430_100551862 3300006846 Bacteria 950
74 Ga0068865_100056758 3300006881 Bacteria 2729
75 Ga0075436_100010378 3300006914 Bacteria 6382
76 Ga0097620_100139180 3300006931 Bacteria 2501
77 Ga0075435_100123490 3300007076 Bacteria 2162
78 Ga0075435_100282452 3300007076 Unclassified 1417
79 Ga0099794_10034127 3300007265 Bacteria 2395
80 Ga0105240_10059309 3300009093 Bacteria 4776
81 Ga0105240_10106984 3300009093 Bacteria 3392
82 Ga0105240_10144840 3300009093 Bacteria 2836
83 Ga0105245_10010745 3300009098 Bacteria 7965
84 Ga0105245_10018954 3300009098 Bacteria 6023
85 Ga0105247_10143067 3300009101 Bacteria 1569
86 Ga0105247_10179258 3300009101 Unclassified 1413
87 Ga0105247_11223452 3300009101 Bacteria 599
88 Ga0105241_10129032 3300009174 Unclassified 2045
89 Ga0105241_10366895 3300009174 Unclassified 1254
90 Ga0105242_10056202 3300009176 Bacteria 3220
91 Ga0105242_10074507 3300009176 Bacteria 2824
92 Ga0105242_10210484 3300009176 Bacteria 1733
93 Ga0105248_10009850 3300009177 Bacteria 10527
94 Ga0105248_10017165 3300009177 Bacteria 7974
95 Ga0105248_10023511 3300009177 Bacteria 6845
96 Ga0105248_10219713 3300009177 Bacteria 2139
97 Ga0105248_10892749 3300009177 Unclassified 1003
98 Ga0105248_11261894 3300009177 Unclassified 835
99 Ga0105237_10078870 3300009545 Bacteria 3283
100 Ga0105237_10358542 3300009545 Bacteria 1462
101 Ga0105238_10045884 3300009551 Bacteria 4413
102 Ga0105249_10106940 3300009553 Bacteria 2640
103 Ga0105239_10133525 3300010375 Bacteria 2762
104 Ga0105239_10531455 3300010375 Bacteria 1338
105 Ga0105239_10569207 3300010375 Bacteria 1291
106 Ga0105239_11270428 3300010375 Bacteria 849
107 Ga0105246_10060253 3300011119 Bacteria 2636
108 Ga0157370_10001165 3300013104 Bacteria 32739
109 Ga0157370_10170692 3300013104 Unclassified 2022
110 Ga0157370_10182139 3300013104 Bacteria 1952
111 Ga0157369_10034038 3300013105 Bacteria 5595
112 Ga0157369_10053425 3300013105 Bacteria 4367
113 Ga0157369_11196673 3300013105 Bacteria 776
114 Ga0157374_10066004 3300013296 Bacteria 3400
115 Ga0157374_10507251 3300013296 Bacteria 1211
116 Ga0157378_10000081 3300013297 Bacteria 88506
117 Ga0157378_10059197 3300013297 Bacteria 3417
118 Ga0157378_10580266 3300013297 Bacteria 1130
119 Ga0163162_10036632 3300013306 Bacteria 4892
120 Ga0163162_10344861 3300013306 Bacteria 1622
121 Ga0157372_10161665 3300013307 Unclassified 2588
122 Ga0157372_10673190 3300013307 Unclassified 1205
123 Ga0157372_12631287 3300013307 Unclassified 577
124 Ga0157375_10201079 3300013308 Bacteria 2148
125 Ga0157375_10344689 3300013308 Bacteria 1655
126 Ga0163163_10019887 3300014325 Bacteria 6314
127 Ga0163163_10029485 3300014325 Bacteria 5278
128 Ga0163163_10898538 3300014325 Unclassified 949
129 Ga0157379_10083515 3300014968 Bacteria 2863
130 Ga0157376_10000050 3300014969 Bacteria 104192
131 Ga0157376_10078600 3300014969 Bacteria 2825
132 Ga0157376_10463252 3300014969 Bacteria 1239
133 Ga0213876_10057256 3300021384 Bacteria 2058
134 Ga0213875_10000006 3300021388 Bacteria 579005
135 Ga0213875_10021755 3300021388 Bacteria 3069
136 Ga0213875_10070182 3300021388 Bacteria 1635
137 Ga0228598_1000054 3300024227 Bacteria 16523
138 Ga0207642_10315018 3300025899 Unclassified 912
139 Ga0207642_10505473 3300025899 Unclassified 740
140 Ga0207710_10131095 3300025900 Bacteria 1204
141 Ga0207680_10005190 3300025903 Bacteria 6211
142 Ga0207705_10862458 3300025909 Unclassified 702
143 Ga0207684_10020022 3300025910 Bacteria 5717
144 Ga0207684_10446005 3300025910 Unclassified 1111
145 Ga0207654_10035326 3300025911 Bacteria 2784
146 Ga0207707_10369369 3300025912 Bacteria 1234
147 Ga0207707_10460261 3300025912 Unclassified 1088
148 Ga0207695_10110064 3300025913 Bacteria 2735
149 Ga0207695_10112330 3300025913 Bacteria 2703
150 Ga0207695_10949669 3300025913 Bacteria 739
151 Ga0207671_10020860 3300025914 Bacteria 4982
152 Ga0207693_10130085 3300025915 Bacteria 1979
153 Ga0207660_10545093 3300025917 Unclassified 943
154 Ga0207657_10131016 3300025919 Bacteria 2055
155 Ga0207657_10217600 3300025919 Bacteria 1531
156 Ga0207646_10061315 3300025922 Bacteria 3357
157 Ga0207694_10076088 3300025924 Bacteria 2628
158 Ga0207694_10555107 3300025924 Bacteria 964
159 Ga0207687_10006980 3300025927 Bacteria 7440
160 Ga0207687_10063625 3300025927 Bacteria 2612
161 Ga0207687_10788710 3300025927 Bacteria 810
162 Ga0207690_10824347 3300025932 Bacteria 767
163 Ga0207686_10118938 3300025934 Unclassified 1795
164 Ga0207686_10134698 3300025934 Bacteria 1699
165 Ga0207686_10138141 3300025934 Bacteria 1681
166 Ga0207704_10056402 3300025938 Bacteria 2406
167 Ga0207665_10012926 3300025939 Bacteria 5491
168 Ga0207711_10005672 3300025941 Bacteria 10545
169 Ga0207711_10022577 3300025941 Bacteria 5264
170 Ga0207711_10200300 3300025941 Bacteria 1822
171 Ga0207711_11410396 3300025941 Unclassified 639
172 Ga0207689_10540869 3300025942 Bacteria 978
173 Ga0207689_11472743 3300025942 Unclassified 569
174 Ga0207661_10000050 3300025944 Bacteria 93646
175 Ga0207679_11116651 3300025945 Bacteria 723
176 Ga0207667_10114582 3300025949 Bacteria 2778
177 Ga0207667_10311585 3300025949 Bacteria 1608
178 Ga0207667_10542191 3300025949 Unclassified 1177
179 Ga0207667_11083562 3300025949 Bacteria 785
180 Ga0207712_10985284 3300025961 Unclassified 747
181 Ga0207658_10377690 3300025986 Bacteria 1240
182 Ga0207677_10066409 3300026023 Bacteria 2522
183 Ga0207703_10032594 3300026035 Bacteria 4124
184 Ga0207639_10607318 3300026041 Unclassified 1009
185 Ga0207639_10610661 3300026041 Bacteria 1006
186 Ga0207708_10410990 3300026075 Bacteria 1121
187 Ga0207702_10203597 3300026078 Unclassified 1836
188 Ga0207702_10236120 3300026078 Unclassified 1711
189 Ga0207702_10743618 3300026078 Unclassified 968
190 Ga0207641_10026712 3300026088 Bacteria 4766
191 Ga0207641_10104101 3300026088 Bacteria 2505
192 Ga0207641_10761108 3300026088 Bacteria 956
193 Ga0207648_10007528 3300026089 Bacteria 10690
194 Ga0207676_10281920 3300026095 Bacteria 1509
195 Ga0207674_10013533 3300026116 Bacteria 9045
196 Ga0207674_10059137 3300026116 Bacteria 3880
197 Ga0207675_100376881 3300026118 Bacteria 1395
198 Ga0268266_10579229 3300028379 Unclassified 1077
199 Ga0268264_10017712 3300028381 Bacteria 5832
200 Ga0268264_10022451 3300028381 Bacteria 5153
201 Ga0265323_10003557 3300028653 Bacteria 6856
202 Ga0265338_10130478 3300028800 Bacteria 1986
203 Ga0265770_1046812 3300030878 Bacteria 772
204 Ga0265330_10395784 3300031235 Unclassified 584
205 Ga0265325_10107845 3300031241 Unclassified 1357
206 Ga0265325_10129718 3300031241 Unclassified 1208
207 Ga0265339_10156392 3300031249 Bacteria 1150
208 Ga0265316_10008184 3300031344 Bacteria 9729
209 Ga0265316_10347833 3300031344 Bacteria 1073
210 Ga0265314_10000723 3300031711 Bacteria 39953
211 Ga0265342_10081506 3300031712 Bacteria 1868
212 Ga0373955_0053591 3300035172 Bacteria 2203
213 Ga0395900_0108479 3300037418 Unclassified 2852
214 Ga0436364_0478514 3300037853 Bacteria 578677
215 Ga0436364_0631627 3300037853 Bacteria 4357
216 Ga0436364_0841135 3300037853 Bacteria 3069
217 Ga0436364_0956168 3300037853 Bacteria 1778
218 Ga0436364_1523115 3300037853 Unclassified 692
219 Ga0436365_0031945 3300039437 Bacteria 1880
220 Ga0436365_0051887 3300039437 Unclassified 1552
221 Ga0436360_1276510 3300039438 Unclassified 503
222 Ga0436363_1247706 3300039450 Unclassified 920
223 Ga0436362_1254778 3300039453 Bacteria 2003
224 Ga0495580_0873770 3300046472 Unclassified 579
225 Ga0495628_0564694 3300046516 Unclassified 816
226 Ga0495587_0615127 3300046536 Unclassified 598
227 Ga0495645_0303605 3300046543 Unclassified 1042
228 Ga0495649_0352741 3300046694 Unclassified 743
229 Ga0495674_0295084 3300047319 Unclassified 1325
230 Ga0495684_0340752 3300047471 Bacteria 1067
231 Ga0496102_0112612 3300048905 Bacteria 2538
232 Ga0496103_0774508 3300048906 Unclassified 606
233 Ga0496106_0043465 3300048909 Bacteria 3371
234 Ga0496114_0035933 3300048917 Bacteria 4094
235 Ga0496115_0199201 3300048918 Bacteria 1654
236 nmdc:mga0qj67_1303101_c1 3300050509 Unclassified 563
237 nmdc:mga0rr50_190070_c1 3300050513 Bacteria 1682
238 nmdc:mga08x19_464_c1 3300050514 Bacteria 27378
239 Ga0500552_032238 3300053733 Unclassified 813
240 Ga0081540_1152510
241 Ga0065707_10120561
242 Ga0070683_100000049
243 Ga0070683_100279618
244 Ga0070690_100143702
245 Ga0068869_100306433
246 Ga0068869_100528372
247 Ga0068869_100821992
248 Ga0070666_10033902
249 Ga0068868_100070083
250 Ga0070660_100815661
251 Ga0070669_101415141
252 Ga0070659_100451617
253 Ga0070667_100052210
254 Ga0070667_101245044
255 Ga0070714_100110579
256 Ga0070710_10306664
257 Ga0070705_100813330
258 Ga0070700_100342518
259 Ga0070694_100597605
260 Ga0070708_100030673
261 Ga0070708_100039108
262 Ga0070681_10073431
263 Ga0068867_100066821
264 Ga0068867_100262756
265 Ga0068867_100332458
266 Ga0070706_100023366
267 Ga0070706_100139265
268 Ga0070707_100007037
269 Ga0070707_100223045
270 Ga0070679_100576431
271 Ga0070679_100885942
272 Ga0070684_100000040
273 Ga0070684_100029124
274 Ga0070697_101621771
275 Ga0068853_100170276
276 Ga0068853_100237205
277 Ga0068853_100584222
278 Ga0070686_100059805
279 Ga0070686_100909574
280 Ga0070696_100330778
281 Ga0070704_100061827
282 Ga0068855_100051195
283 Ga0068855_100101531
284 Ga0068855_100119428
285 Ga0068855_100353087
286 Ga0070664_100368652
287 Ga0070664_101246516
288 Ga0068857_100061688
289 Ga0068857_100285980
290 Ga0068856_100255839
291 Ga0068856_100798723
292 Ga0068852_100017918
293 Ga0068859_100139180
294 Ga0068864_100370630
295 Ga0068866_10448062
296 Ga0068866_10520639
297 Ga0068863_100088560
298 Ga0068863_100160195
299 Ga0068863_102198231
300 Ga0068858_100031642
301 Ga0068858_102436086
302 Ga0068860_100017992
303 Ga0068860_100048152
304 Ga0070717_10012713
305 Ga0070715_10195009
306 Ga0070716_100052951
307 Ga0070716_100128869
308 Ga0097621_100016251
309 Ga0097621_100266894
310 Ga0097621_100589462
311 Ga0068871_100173443
312 Ga0075430_100551862
313 Ga0068865_100056758
314 Ga0075436_100010378
315 Ga0097620_100139180
316 Ga0075435_100123490
317 Ga0075435_100282452
318 Ga0099794_10034127
319 Ga0105240_10059309
320 Ga0105240_10106984
321 Ga0105240_10144840
322 Ga0105245_10010745
323 Ga0105245_10018954
324 Ga0105247_10143067
325 Ga0105247_10179258
326 Ga0105247_11223452
327 Ga0105241_10129032
328 Ga0105241_10366895
329 Ga0105242_10056202
330 Ga0105242_10074507
331 Ga0105242_10210484
332 Ga0105248_10009850
333 Ga0105248_10017165
334 Ga0105248_10023511
335 Ga0105248_10219713
336 Ga0105248_10892749
337 Ga0105248_11261894
338 Ga0105237_10078870
339 Ga0105237_10358542
340 Ga0105238_10045884
341 Ga0105249_10106940
342 Ga0105239_10133525
343 Ga0105239_10531455
344 Ga0105239_10569207
345 Ga0105239_11270428
346 Ga0105246_10060253
347 Ga0157370_10001165
348 Ga0157370_10170692
349 Ga0157370_10182139
350 Ga0157369_10034038
351 Ga0157369_10053425
352 Ga0157369_11196673
353 Ga0157374_10066004
354 Ga0157374_10507251
355 Ga0157378_10000081
356 Ga0157378_10059197
357 Ga0157378_10580266
358 Ga0163162_10036632
359 Ga0163162_10344861
360 Ga0157372_10161665
361 Ga0157372_10673190
362 Ga0157372_12631287
363 Ga0157375_10201079
364 Ga0157375_10344689
365 Ga0163163_10019887
366 Ga0163163_10029485
367 Ga0163163_10898538
368 Ga0157379_10083515
369 Ga0157376_10000050
370 Ga0157376_10078600
371 Ga0157376_10463252
372 Ga0213876_10057256
373 Ga0213875_10000006
374 Ga0213875_10021755
375 Ga0213875_10070182
376 Ga0228598_1000054
377 Ga0207642_10315018
378 Ga0207642_10505473
379 Ga0207710_10131095
380 Ga0207680_10005190
381 Ga0207705_10862458
382 Ga0207684_10020022
383 Ga0207684_10446005
384 Ga0207654_10035326
385 Ga0207707_10369369
386 Ga0207707_10460261
387 Ga0207695_10110064
388 Ga0207695_10112330
389 Ga0207695_10949669
390 Ga0207671_10020860
391 Ga0207693_10130085
392 Ga0207660_10545093
393 Ga0207657_10131016
394 Ga0207657_10217600
395 Ga0207646_10061315
396 Ga0207694_10076088
397 Ga0207694_10555107
398 Ga0207687_10006980
399 Ga0207687_10063625
400 Ga0207687_10788710
401 Ga0207690_10824347
402 Ga0207686_10118938
403 Ga0207686_10134698
404 Ga0207686_10138141
405 Ga0207704_10056402
406 Ga0207665_10012926
407 Ga0207711_10005672
408 Ga0207711_10022577
409 Ga0207711_10200300
410 Ga0207711_11410396
411 Ga0207689_10540869
412 Ga0207689_11472743
413 Ga0207661_10000050
414 Ga0207679_11116651
415 Ga0207667_10114582
416 Ga0207667_10311585
417 Ga0207667_10542191
418 Ga0207667_11083562
419 Ga0207712_10985284
420 Ga0207658_10377690
421 Ga0207677_10066409
422 Ga0207703_10032594
423 Ga0207639_10607318
424 Ga0207639_10610661
425 Ga0207708_10410990
426 Ga0207702_10203597
427 Ga0207702_10236120
428 Ga0207702_10743618
429 Ga0207641_10026712
430 Ga0207641_10104101
431 Ga0207641_10761108
432 Ga0207648_10007528
433 Ga0207676_10281920
434 Ga0207674_10013533
435 Ga0207674_10059137
436 Ga0207675_100376881
437 Ga0268266_10579229
438 Ga0268264_10017712
439 Ga0268264_10022451
440 Ga0265323_10003557
441 Ga0265338_10130478
442 Ga0265770_1046812
443 Ga0265330_10395784
444 Ga0265325_10107845
445 Ga0265325_10129718
446 Ga0265339_10156392
447 Ga0265316_10008184
448 Ga0265316_10347833
449 Ga0265314_10000723
450 Ga0265342_10081506
451 Ga0373955_0053591
452 Ga0395900_0108479
453 Ga0436364_0478514
454 Ga0436364_0631627
455 Ga0436364_0841135
456 Ga0436364_0956168
457 Ga0436364_1523115
458 Ga0436365_0031945
459 Ga0436365_0051887
460 Ga0436360_1276510
461 Ga0436363_1247706
462 Ga0436362_1254778
463 Ga0495580_0873770
464 Ga0495628_0564694
465 Ga0495587_0615127
466 Ga0495645_0303605
467 Ga0495649_0352741
468 Ga0495674_0295084
469 Ga0495684_0340752
470 Ga0496102_0112612
471 Ga0496103_0774508
472 Ga0496106_0043465
473 Ga0496114_0035933
474 Ga0496115_0199201
475 nmdc:mga0qj67_1303101_c1
476 nmdc:mga0rr50_190070_c1
477 nmdc:mga08x19_464_c1
478 Ga0500552_032238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

10

128

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.8659 2 121
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8646 2 122
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.8593 2 122
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.859 2 122
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8483 2 113
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9573 2 116 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9015 1 121 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8896 2 116 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.846 1 119 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8459 2 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A522T5Z5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9897 2 124 GO:0000287
GO:0004540
GO:0090729
AF-A0A2H6F1L5-F1-model_v4 Ribonuclease VapC19 0.9879 33 122 GO:0004518
GO:0046872
AF-A0A3B9V8Q6-F1-model_v4 PIN domain nuclease 0.9877 2 123 GO:0004518
GO:0046872
AF-A0A1F8ZK55-F1-model_v4 PIN domain-containing protein 0.9876 2 123 GO:0004518
GO:0046872
AF-A0A2I6QI87-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9865 1 123 GO:0000287
GO:0004540
GO:0090729

Map