F351765

General Info

Members Datasets Scaffolds Average Seq Length
239 164 239 312

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100058638|Ga0070665_1000586384
Length 334
Sequence MFVCFERAAYLIVCSLKMPMNIEENIHKSVLPAETVELLKPQADEIFVDATLGLGGHAEKILSINEKIRLIGIDQDTEAIKLATHRLEKFGSRIEIFHSNFSEIKQVLKQAGIEKVDGILADLGVSSLQFDSAERGFSFRFDAPLDMRMNADDETETAADLLATLSEFEIARIIYEYGEERLSRKIARRIVWKRELGEPIETTKHLAETVEKAVGRGKKDKIHPATKTFQALRIAVNGELEILERFLRDSVEVLKKDGRLAVITFHSLEDRIVKQTFQKLAGKCDCPPRLPKCVCGAKREVEILTRKPIVPNEIELQENPRARSAKLRACLKLN

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.93
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000322 3300000549 Bacteria 8400
2 JGI24741J21665_1010195 3300001915 Bacteria 1693
3 JGI24747J21853_1000864 3300001978 Bacteria 2084
4 JGI24743J22301_10003006 3300001991 Bacteria 2622
5 JGI24748J21848_1006080 3300002074 Bacteria 1405
6 JGI24034J26672_10005835 3300002239 Bacteria 1771
7 JGI24751J29686_10001566 3300002459 Bacteria 4725
8 Ga0058860_10071926 3300004801 Bacteria 1820
9 Ga0065704_10119091 3300005289 Bacteria 1805
10 Ga0065712_10102582 3300005290 Unclassified 2005
11 Ga0065715_10101245 3300005293 Unclassified 3224
12 Ga0065715_10126817 3300005293 Bacteria 2101
13 Ga0070676_10099034 3300005328 Bacteria 1798
14 Ga0070683_100000496 3300005329 Bacteria 27786
15 Ga0070683_100070864 3300005329 Unclassified 3252
16 Ga0070690_100001738 3300005330 Bacteria 11509
17 Ga0070690_100078067 3300005330 Unclassified 2163
18 Ga0070690_100102875 3300005330 Bacteria 1896
19 Ga0070670_100038657 3300005331 Unclassified 4103
20 Ga0070670_100075467 3300005331 Bacteria 2897
21 Ga0068869_100042225 3300005334 Unclassified 3269
22 Ga0070666_10027779 3300005335 Bacteria 3708
23 Ga0070682_100000056 3300005337 Bacteria 108991
24 Ga0070689_100005423 3300005340 Bacteria 8702
25 Ga0070689_100012741 3300005340 Bacteria 6069
26 Ga0070689_100021865 3300005340 Unclassified 4769
27 Ga0070689_100291600 3300005340 Bacteria 1356
28 Ga0070687_100001786 3300005343 Bacteria 7773
29 Ga0070668_100014828 3300005347 Bacteria 5825
30 Ga0070669_100003198 3300005353 Bacteria 11772
31 Ga0070669_100039166 3300005353 Bacteria 3443
32 Ga0070675_100360583 3300005354 Unclassified 1290
33 Ga0070675_100483925 3300005354 Bacteria 1113
34 Ga0070671_100037610 3300005355 Bacteria 4014
35 Ga0070671_100041339 3300005355 Bacteria 3831
36 Ga0070688_100000531 3300005365 Bacteria 19278
37 Ga0070688_100026923 3300005365 Unclassified 3421
38 Ga0070659_100003187 3300005366 Bacteria 11679
39 Ga0070705_100159638 3300005440 Bacteria 1506
40 Ga0070700_100004830 3300005441 Bacteria 7074
41 Ga0070694_100105407 3300005444 Unclassified 2001
42 Ga0070678_100026786 3300005456 Bacteria 3904
43 Ga0070662_100005457 3300005457 Bacteria 8124
44 Ga0070662_100314996 3300005457 Bacteria 1275
45 Ga0070681_10009576 3300005458 Bacteria 9526
46 Ga0068867_100003018 3300005459 Bacteria 11867
47 Ga0068867_100174980 3300005459 Bacteria 1703
48 Ga0070685_10030844 3300005466 Bacteria 2990
49 Ga0070706_100141706 3300005467 Unclassified 2244
50 Ga0070698_100019778 3300005471 Bacteria 7062
51 Ga0070698_100060104 3300005471 Bacteria 3835
52 Ga0070684_100002473 3300005535 Bacteria 13605
53 Ga0070684_100048617 3300005535 Bacteria 3679
54 Ga0070697_100000147 3300005536 Bacteria 57115
55 Ga0070697_100000204 3300005536 Bacteria 48652
56 Ga0068853_100027278 3300005539 Unclassified 4797
57 Ga0068853_100030479 3300005539 Bacteria 4555
58 Ga0070672_100087600 3300005543 Unclassified 2506
59 Ga0070695_100089849 3300005545 Unclassified 2049
60 Ga0070696_100022826 3300005546 Bacteria 4254
61 Ga0070696_100166319 3300005546 Unclassified 1628
62 Ga0070665_100058638 3300005548 Unclassified 3859
63 Ga0070704_100006970 3300005549 Bacteria 6703
64 Ga0068855_100060543 3300005563 Bacteria 4427
65 Ga0068855_100596805 3300005563 Unclassified 1191
66 Ga0068857_100006445 3300005577 Bacteria 10063
67 Ga0068854_100140180 3300005578 Bacteria 1855
68 Ga0068856_100007717 3300005614 Bacteria 10505
69 Ga0070702_100054150 3300005615 Bacteria 2307
70 Ga0068852_100041663 3300005616 Bacteria 3882
71 Ga0068852_100184194 3300005616 Bacteria 1965
72 Ga0068852_100399841 3300005616 Unclassified 1351
73 Ga0068864_100025446 3300005618 Bacteria 4984
74 Ga0068864_100438801 3300005618 Bacteria 1247
75 Ga0068866_10002657 3300005718 Bacteria 7383
76 Ga0068861_100013353 3300005719 Bacteria 5748
77 Ga0068861_100105465 3300005719 Unclassified 2251
78 Ga0068851_10027603 3300005834 Bacteria 2798
79 Ga0068851_10031674 3300005834 Bacteria 2628
80 Ga0068862_100007585 3300005844 Bacteria 8993
81 Ga0068862_100045601 3300005844 Bacteria 3741
82 Ga0081540_1086211 3300005983 Unclassified 1395
83 Ga0097621_100236034 3300006237 Bacteria 1597
84 Ga0075430_100235374 3300006846 Bacteria 1518
85 Ga0068865_100027513 3300006881 Bacteria 3757
86 Ga0105240_10030848 3300009093 Bacteria 6963
87 Ga0105240_10137501 3300009093 Bacteria 2925
88 Ga0105245_10011067 3300009098 Bacteria 7855
89 Ga0105247_10002106 3300009101 Bacteria 13754
90 Ga0114129_10006374 3300009147 Bacteria 16728
91 Ga0105241_10055484 3300009174 Bacteria 3036
92 Ga0105242_10005259 3300009176 Bacteria 9991
93 Ga0105248_10303171 3300009177 Bacteria 1799
94 Ga0105248_10437432 3300009177 Unclassified 1473
95 Ga0105249_10017124 3300009553 Bacteria 6432
96 Ga0105249_10030080 3300009553 Unclassified 4907
97 Ga0105249_10031624 3300009553 Bacteria 4787
98 Ga0105239_10005619 3300010375 Bacteria 14660
99 Ga0105239_10069432 3300010375 Unclassified 3872
100 Ga0157373_10020271 3300013100 Bacteria 4836
101 Ga0157373_10025622 3300013100 Unclassified 4264
102 Ga0157371_10007887 3300013102 Bacteria 8546
103 Ga0157371_10169428 3300013102 Bacteria 1560
104 Ga0157371_10287390 3300013102 Unclassified 1189
105 Ga0157370_10037911 3300013104 Bacteria 4666
106 Ga0157369_10060836 3300013105 Unclassified 4072
107 Ga0157369_10071098 3300013105 Bacteria 3737
108 Ga0157374_10251187 3300013296 Bacteria 1740
109 Ga0157378_10050433 3300013297 Bacteria 3704
110 Ga0157378_10098721 3300013297 Bacteria 2663
111 Ga0157378_10111434 3300013297 Unclassified 2509
112 Ga0157378_10171493 3300013297 Unclassified 2035
113 Ga0157378_10594954 3300013297 Bacteria 1117
114 Ga0163162_10147104 3300013306 Bacteria 2472
115 Ga0163162_10363499 3300013306 Unclassified 1580
116 Ga0163162_10776476 3300013306 Bacteria 1076
117 Ga0157372_10045141 3300013307 Bacteria 4887
118 Ga0157375_10047954 3300013308 Bacteria 4175
119 Ga0157375_10053572 3300013308 Bacteria 3970
120 Ga0157375_10305933 3300013308 Bacteria 1754
121 Ga0163163_10003303 3300014325 Bacteria 13677
122 Ga0157380_10001541 3300014326 Bacteria 15135
123 Ga0157380_10017455 3300014326 Bacteria 5311
124 Ga0157380_10153358 3300014326 Unclassified 1994
125 Ga0157377_10074673 3300014745 Bacteria 1967
126 Ga0157379_10003176 3300014968 Bacteria 13915
127 Ga0163161_10000899 3300017792 Bacteria 23098
128 Ga0163161_10002477 3300017792 Bacteria 13166
129 Ga0163161_10088916 3300017792 Bacteria 2284
130 Ga0163161_10290593 3300017792 Unclassified 1285
131 Ga0213876_10013417 3300021384 Bacteria 4353
132 Ga0207656_10036815 3300025321 Bacteria 2055
133 Ga0207682_10021823 3300025893 Bacteria 2519
134 Ga0207642_10025327 3300025899 Bacteria 2398
135 Ga0207680_10014112 3300025903 Bacteria 4122
136 Ga0207647_10001115 3300025904 Bacteria 20674
137 Ga0207645_10000471 3300025907 Bacteria 33296
138 Ga0207645_10079458 3300025907 Bacteria 2102
139 Ga0207643_10000375 3300025908 Bacteria 30034
140 Ga0207684_10031409 3300025910 Unclassified 4518
141 Ga0207684_10113187 3300025910 Unclassified 2323
142 Ga0207654_10196401 3300025911 Unclassified 1326
143 Ga0207707_10003276 3300025912 Bacteria 14384
144 Ga0207662_10001466 3300025918 Bacteria 11455
145 Ga0207662_10071856 3300025918 Bacteria 2096
146 Ga0207649_10000233 3300025920 Bacteria 45406
147 Ga0207649_10192815 3300025920 Unclassified 1434
148 Ga0207646_10266752 3300025922 Bacteria 1547
149 Ga0207681_10006122 3300025923 Bacteria 7380
150 Ga0207681_10067794 3300025923 Bacteria 2475
151 Ga0207650_10000107 3300025925 Bacteria 109863
152 Ga0207650_10030760 3300025925 Unclassified 3870
153 Ga0207650_10088920 3300025925 Unclassified 2356
154 Ga0207659_10288790 3300025926 Bacteria 1343
155 Ga0207687_10171907 3300025927 Bacteria 1672
156 Ga0207644_10017005 3300025931 Bacteria 4902
157 Ga0207644_10162585 3300025931 Bacteria 1736
158 Ga0207706_10000238 3300025933 Bacteria 60595
159 Ga0207686_10096372 3300025934 Bacteria 1965
160 Ga0207670_10006347 3300025936 Bacteria 6551
161 Ga0207670_10012368 3300025936 Bacteria 4993
162 Ga0207670_10014685 3300025936 Unclassified 4657
163 Ga0207665_10227901 3300025939 Unclassified 1368
164 Ga0207691_10000751 3300025940 Bacteria 32082
165 Ga0207691_10019573 3300025940 Bacteria 6404
166 Ga0207711_10025175 3300025941 Bacteria 4993
167 Ga0207689_10043513 3300025942 Unclassified 3712
168 Ga0207661_10000138 3300025944 Bacteria 46093
169 Ga0207679_10000058 3300025945 Bacteria 101602
170 Ga0207651_10080573 3300025960 Bacteria 2344
171 Ga0207651_10114213 3300025960 Bacteria 2033
172 Ga0207640_10025058 3300025981 Bacteria 3606
173 Ga0207640_10066157 3300025981 Bacteria 2414
174 Ga0207658_10013127 3300025986 Bacteria 5658
175 Ga0207658_10274434 3300025986 Bacteria 1443
176 Ga0207677_10009444 3300026023 Bacteria 5490
177 Ga0207703_10051881 3300026035 Bacteria 3327
178 Ga0207639_10081350 3300026041 Bacteria 2565
179 Ga0207678_10001492 3300026067 Bacteria 21439
180 Ga0207708_10004179 3300026075 Bacteria 10614
181 Ga0207708_10085578 3300026075 Bacteria 2425
182 Ga0207641_10000163 3300026088 Bacteria 94033
183 Ga0207641_10090596 3300026088 Unclassified 2675
184 Ga0207648_10001068 3300026089 Bacteria 30718
185 Ga0207676_10000142 3300026095 Bacteria 62851
186 Ga0207674_10000336 3300026116 Bacteria 60214
187 Ga0207675_100085000 3300026118 Bacteria 2969
188 Ga0207675_100101913 3300026118 Bacteria 2705
189 Ga0207675_100104644 3300026118 Unclassified 2668
190 Ga0207675_100516564 3300026118 Bacteria 1190
191 Ga0207683_10002065 3300026121 Bacteria 17759
192 Ga0207698_10525767 3300026142 Bacteria 1155
193 Ga0207428_10043604 3300027907 Bacteria 3622
194 Ga0268266_10037800 3300028379 Bacteria 4109
195 Ga0268266_10062005 3300028379 Unclassified 3226
196 Ga0268265_10009646 3300028380 Bacteria 6517
197 Ga0268265_10023740 3300028380 Bacteria 4327
198 Ga0268264_10063158 3300028381 Bacteria 3112
199 Ga0265320_10011200 3300031240 Bacteria 5289
200 Ga0307410_10011433 3300031852 Bacteria 5077
201 Ga0307410_10075044 3300031852 Bacteria 2357
202 Ga0307410_10242227 3300031852 Bacteria 1398
203 Ga0307406_10058796 3300031901 Bacteria 2472
204 Ga0307407_10077552 3300031903 Bacteria 1999
205 Ga0307412_10111003 3300031911 Bacteria 1958
206 Ga0307412_10337653 3300031911 Bacteria 1205
207 Ga0307409_100014968 3300031995 Bacteria 5070
208 Ga0307416_100115615 3300032002 Bacteria 2376
209 Ga0307414_10382550 3300032004 Unclassified 1217
210 Ga0307411_10122462 3300032005 Unclassified 1885
211 Ga0307411_10307465 3300032005 Bacteria 1274
212 Ga0307415_100191301 3300032126 Bacteria 1615
213 Ga0373943_0060213 3300035170 Bacteria 1895
214 Ga0373943_0155328 3300035170 Bacteria 1242
215 Ga0373955_0222176 3300035172 Bacteria 1128
216 Ga0373962_0029248 3300035242 Bacteria 1500
217 Ga0436365_0399460 3300039437 Bacteria 5870
218 Ga0436365_1056637 3300039437 Bacteria 1466
219 Ga0451576_0189648 3300045051 Bacteria 2147
220 Ga0495618_0070806 3300046514 Bacteria 2218
221 Ga0495628_0156675 3300046516 Bacteria 1732
222 Ga0495630_0005124 3300046517 Bacteria 9221
223 Ga0495663_0000912 3300046525 Bacteria 9873
224 Ga0495586_0074791 3300046535 Bacteria 1854
225 Ga0495621_0005762 3300046539 Bacteria 3580
226 Ga0495668_0004924 3300046616 Bacteria 9266
227 Ga0495672_0036943 3300047320 Bacteria 2994
228 Ga0496101_0172288 3300048904 Bacteria 1664
229 Ga0496108_0000082 3300048911 Bacteria 101998
230 Ga0496109_0000148 3300048912 Bacteria 69299
231 Ga0496110_0000377 3300048913 Bacteria 29876
232 Ga0496111_0000789 3300048914 Bacteria 16936
233 Ga0496112_0000151 3300048915 Bacteria 43735
234 Ga0496113_0001130 3300048916 Bacteria 14502
235 Ga0501072_0197665 3300049588 Bacteria 1603
236 nmdc:mga06r32_650247_c1 3300050510 Bacteria 1022
237 Ga0495612_0029713 3300053078 Bacteria 2202
238 Ga0500577_0000864 3300053142 Bacteria 7829
239 Ga0501084_0082431 3300054114 Unclassified 2699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1056637 Ga0436365_1056637_399_1196 261
2 3300021384 Ga0213876_10013417 Ga0213876_100134174 274
3 3300039437 Ga0436365_0399460 Ga0436365_0399460_1937_2773 274
4 3300004801 Ga0058860_10071926 Ga0058860_100719263 276
5 3300053142 Ga0500577_0000864 Ga0500577_0000864_2352_3302 281
6 3300005471 Ga0070698_100060104 Ga0070698_1000601045 283
7 3300006846 Ga0075430_100235374 Ga0075430_1002353743 283
8 3300035170 Ga0373943_0060213 Ga0373943_0060213_506_1369 283
9 3300035172 Ga0373955_0222176 Ga0373955_0222176_225_1088 283
10 3300046514 Ga0495618_0070806 Ga0495618_0070806_67_930 283
11 3300046516 Ga0495628_0156675 Ga0495628_0156675_815_1678 283
12 3300046517 Ga0495630_0005124 Ga0495630_0005124_2859_3722 283
13 3300046535 Ga0495586_0074791 Ga0495586_0074791_971_1834 283
14 3300050510 nmdc:mga06r32_650247_c1 nmdc:mga06r32_650247_c1_48_905 283
15 3300053078 Ga0495612_0029713 Ga0495612_0029713_1202_2065 283
16 3300013102 Ga0157371_10287390 Ga0157371_102873901 284
17 3300035242 Ga0373962_0029248 Ga0373962_0029248_393_1259 284
18 3300013307 Ga0157372_10045141 Ga0157372_100451414 285
19 3300005354 Ga0070675_100360583 Ga0070675_1003605831 286
20 3300031240 Ga0265320_10011200 Ga0265320_100112003 286
21 3300046525 Ga0495663_0000912 Ga0495663_0000912_110_1018 289
22 3300046539 Ga0495621_0005762 Ga0495621_0005762_24_932 289
23 3300054114 Ga0501084_0082431 Ga0501084_0082431_1333_2343 290
24 3300005340 Ga0070689_100291600 Ga0070689_1002916001 291
25 3300005440 Ga0070705_100159638 Ga0070705_1001596381 291
26 3300025918 Ga0207662_10071856 Ga0207662_100718563 291
27 3300025922 Ga0207646_10266752 Ga0207646_102667522 291
28 3300025981 Ga0207640_10066157 Ga0207640_100661572 291
29 3300001915 JGI24741J21665_1010195 JGI24741J21665_10101952 293
30 3300001978 JGI24747J21853_1000864 JGI24747J21853_10008643 293
31 3300001991 JGI24743J22301_10003006 JGI24743J22301_100030064 293
32 3300002074 JGI24748J21848_1006080 JGI24748J21848_10060802 293
33 3300002239 JGI24034J26672_10005835 JGI24034J26672_100058353 293
34 3300002459 JGI24751J29686_10001566 JGI24751J29686_100015666 293
35 3300005329 Ga0070683_100000496 Ga0070683_10000049611 293
36 3300005330 Ga0070690_100001738 Ga0070690_1000017384 293
37 3300005335 Ga0070666_10027779 Ga0070666_100277794 293
38 3300005340 Ga0070689_100005423 Ga0070689_1000054235 293
39 3300005343 Ga0070687_100001786 Ga0070687_1000017866 293
40 3300005347 Ga0070668_100014828 Ga0070668_1000148283 293
41 3300005353 Ga0070669_100039166 Ga0070669_1000391663 293
42 3300005354 Ga0070675_100483925 Ga0070675_1004839251 293
43 3300005355 Ga0070671_100037610 Ga0070671_1000376103 293
44 3300005365 Ga0070688_100000531 Ga0070688_1000005314 293
45 3300005366 Ga0070659_100003187 Ga0070659_1000031877 293
46 3300005456 Ga0070678_100026786 Ga0070678_1000267863 293
47 3300005457 Ga0070662_100005457 Ga0070662_1000054576 293
48 3300005459 Ga0068867_100003018 Ga0068867_1000030184 293
49 3300005535 Ga0070684_100002473 Ga0070684_10000247311 293
50 3300005539 Ga0068853_100030479 Ga0068853_1000304793 293
51 3300005563 Ga0068855_100060543 Ga0068855_1000605434 293
52 3300005577 Ga0068857_100006445 Ga0068857_1000064454 293
53 3300005614 Ga0068856_100007717 Ga0068856_1000077179 293
54 3300005616 Ga0068852_100041663 Ga0068852_1000416634 293
55 3300005718 Ga0068866_10002657 Ga0068866_100026578 293
56 3300005834 Ga0068851_10027603 Ga0068851_100276032 293
57 3300005844 Ga0068862_100007585 Ga0068862_1000075854 293
58 3300006237 Ga0097621_100236034 Ga0097621_1002360341 293
59 3300006881 Ga0068865_100027513 Ga0068865_1000275134 293
60 3300009093 Ga0105240_10137501 Ga0105240_101375012 293
61 3300009098 Ga0105245_10011067 Ga0105245_100110675 293
62 3300009101 Ga0105247_10002106 Ga0105247_1000210612 293
63 3300009174 Ga0105241_10055484 Ga0105241_100554841 293
64 3300009176 Ga0105242_10005259 Ga0105242_100052594 293
65 3300009177 Ga0105248_10303171 Ga0105248_103031712 293
66 3300009553 Ga0105249_10031624 Ga0105249_100316243 293
67 3300010375 Ga0105239_10005619 Ga0105239_100056197 293
68 3300013100 Ga0157373_10020271 Ga0157373_100202712 293
69 3300013102 Ga0157371_10007887 Ga0157371_100078877 293
70 3300013105 Ga0157369_10071098 Ga0157369_100710981 293
71 3300013296 Ga0157374_10251187 Ga0157374_102511872 293
72 3300013297 Ga0157378_10050433 Ga0157378_100504334 293
73 3300013308 Ga0157375_10047954 Ga0157375_100479543 293
74 3300014325 Ga0163163_10003303 Ga0163163_100033035 293
75 3300014326 Ga0157380_10017455 Ga0157380_100174554 293
76 3300014745 Ga0157377_10074673 Ga0157377_100746733 293
77 3300014968 Ga0157379_10003176 Ga0157379_1000317611 293
78 3300017792 Ga0163161_10002477 Ga0163161_1000247716 293
79 3300025321 Ga0207656_10036815 Ga0207656_100368152 293
80 3300025893 Ga0207682_10021823 Ga0207682_100218233 293
81 3300025899 Ga0207642_10025327 Ga0207642_100253272 293
82 3300025903 Ga0207680_10014112 Ga0207680_100141123 293
83 3300025904 Ga0207647_10001115 Ga0207647_100011158 293
84 3300025907 Ga0207645_10000471 Ga0207645_1000047127 293
85 3300025908 Ga0207643_10000375 Ga0207643_1000037521 293
86 3300025918 Ga0207662_10001466 Ga0207662_100014667 293
87 3300025920 Ga0207649_10000233 Ga0207649_1000023338 293
88 3300025923 Ga0207681_10067794 Ga0207681_100677943 293
89 3300025925 Ga0207650_10000107 Ga0207650_1000010768 293
90 3300025926 Ga0207659_10288790 Ga0207659_102887902 293
91 3300025927 Ga0207687_10171907 Ga0207687_101719073 293
92 3300025931 Ga0207644_10017005 Ga0207644_100170056 293
93 3300025933 Ga0207706_10000238 Ga0207706_1000023828 293
94 3300025934 Ga0207686_10096372 Ga0207686_100963723 293
95 3300025936 Ga0207670_10006347 Ga0207670_100063474 293
96 3300025940 Ga0207691_10000751 Ga0207691_100007514 293
97 3300025941 Ga0207711_10025175 Ga0207711_100251754 293
98 3300025944 Ga0207661_10000138 Ga0207661_1000013839 293
99 3300025945 Ga0207679_10000058 Ga0207679_1000005830 293
100 3300025960 Ga0207651_10114213 Ga0207651_101142132 293
101 3300025981 Ga0207640_10025058 Ga0207640_100250584 293
102 3300025986 Ga0207658_10013127 Ga0207658_100131274 293
103 3300026023 Ga0207677_10009444 Ga0207677_100094444 293
104 3300026035 Ga0207703_10051881 Ga0207703_100518812 293
105 3300026041 Ga0207639_10081350 Ga0207639_100813504 293
106 3300026067 Ga0207678_10001492 Ga0207678_100014924 293
107 3300026088 Ga0207641_10000163 Ga0207641_1000016348 293
108 3300026089 Ga0207648_10001068 Ga0207648_1000106825 293
109 3300026095 Ga0207676_10000142 Ga0207676_1000014230 293
110 3300026116 Ga0207674_10000336 Ga0207674_1000033625 293
111 3300026118 Ga0207675_100085000 Ga0207675_1000850004 293
112 3300026121 Ga0207683_10002065 Ga0207683_1000206512 293
113 3300026142 Ga0207698_10525767 Ga0207698_105257671 293
114 3300028379 Ga0268266_10037800 Ga0268266_100378004 293
115 3300028380 Ga0268265_10009646 Ga0268265_100096468 293
116 3300028381 Ga0268264_10063158 Ga0268264_100631583 293
117 3300048904 Ga0496101_0172288 Ga0496101_0172288_474_1412 293
118 3300048911 Ga0496108_0000082 Ga0496108_0000082_77499_78437 293
119 3300048912 Ga0496109_0000148 Ga0496109_0000148_33559_34497 293
120 3300048913 Ga0496110_0000377 Ga0496110_0000377_26745_27683 293
121 3300048914 Ga0496111_0000789 Ga0496111_0000789_5143_6081 293
122 3300048915 Ga0496112_0000151 Ga0496112_0000151_34770_35708 293
123 3300048916 Ga0496113_0001130 Ga0496113_0001130_3147_4085 293
124 3300005289 Ga0065704_10119091 Ga0065704_101190912 296
125 3300047320 Ga0495672_0036943 Ga0495672_0036943_1445_2347 298
126 3300005983 Ga0081540_1086211 Ga0081540_10862112 299
127 3300013308 Ga0157375_10305933 Ga0157375_103059331 299
128 3300035170 Ga0373943_0155328 Ga0373943_0155328_230_1183 299
129 3300031852 Ga0307410_10242227 Ga0307410_102422272 303
130 3300045051 Ga0451576_0189648 Ga0451576_0189648_952_1872 304
131 3300005330 Ga0070690_100102875 Ga0070690_1001028753 305
132 3300026075 Ga0207708_10085578 Ga0207708_100855782 305
133 3300005719 Ga0068861_100013353 Ga0068861_1000133533 306
134 3300026118 Ga0207675_100101913 Ga0207675_1001019132 306
135 3300005331 Ga0070670_100038657 Ga0070670_1000386573 308
136 3300005337 Ga0070682_100000056 Ga0070682_10000005635 308
137 3300005340 Ga0070689_100021865 Ga0070689_1000218653 308
138 3300005365 Ga0070688_100026923 Ga0070688_1000269233 308
139 3300005466 Ga0070685_10030844 Ga0070685_100308442 308
140 3300009553 Ga0105249_10030080 Ga0105249_100300805 308
141 3300025925 Ga0207650_10030760 Ga0207650_100307603 308
142 3300025936 Ga0207670_10014685 Ga0207670_100146851 308
143 3300026088 Ga0207641_10090596 Ga0207641_100905963 308
144 3300005328 Ga0070676_10099034 Ga0070676_100990341 311
145 3300013100 Ga0157373_10025622 Ga0157373_100256223 311
146 3300005340 Ga0070689_100012741 Ga0070689_1000127414 312
147 3300025936 Ga0207670_10012368 Ga0207670_100123685 312
148 3300013308 Ga0157375_10053572 Ga0157375_100535724 313
149 3300025907 Ga0207645_10079458 Ga0207645_100794582 313
150 3300025911 Ga0207654_10196401 Ga0207654_101964012 313
151 3300031852 Ga0307410_10075044 Ga0307410_100750442 313
152 3300031903 Ga0307407_10077552 Ga0307407_100775522 313
153 3300032005 Ga0307411_10307465 Ga0307411_103074651 313
154 3300032126 Ga0307415_100191301 Ga0307415_1001913011 313
155 3300046616 Ga0495668_0004924 Ga0495668_0004924_7499_8443 313
156 3300005290 Ga0065712_10102582 Ga0065712_101025822 314
157 3300005293 Ga0065715_10101245 Ga0065715_101012453 314
158 3300005293 Ga0065715_10126817 Ga0065715_101268172 314
159 3300005329 Ga0070683_100070864 Ga0070683_1000708643 314
160 3300005334 Ga0068869_100042225 Ga0068869_1000422254 314
161 3300005355 Ga0070671_100041339 Ga0070671_1000413391 314
162 3300005471 Ga0070698_100019778 Ga0070698_1000197783 314
163 3300005535 Ga0070684_100048617 Ga0070684_1000486173 314
164 3300005536 Ga0070697_100000204 Ga0070697_10000020441 314
165 3300005545 Ga0070695_100089849 Ga0070695_1000898492 314
166 3300005546 Ga0070696_100166319 Ga0070696_1001663192 314
167 3300005563 Ga0068855_100596805 Ga0068855_1005968051 314
168 3300005578 Ga0068854_100140180 Ga0068854_1001401802 314
169 3300005616 Ga0068852_100184194 Ga0068852_1001841942 314
170 3300005618 Ga0068864_100025446 Ga0068864_1000254464 314
171 3300005834 Ga0068851_10031674 Ga0068851_100316743 314
172 3300013104 Ga0157370_10037911 Ga0157370_100379113 314
173 3300013297 Ga0157378_10111434 Ga0157378_101114342 314
174 3300013297 Ga0157378_10171493 Ga0157378_101714933 314
175 3300013297 Ga0157378_10594954 Ga0157378_105949541 314
176 3300013306 Ga0163162_10776476 Ga0163162_107764761 314
177 3300017792 Ga0163161_10000899 Ga0163161_100008993 314
178 3300025910 Ga0207684_10031409 Ga0207684_100314094 314
179 3300025925 Ga0207650_10088920 Ga0207650_100889203 314
180 3300025931 Ga0207644_10162585 Ga0207644_101625852 314
181 3300025940 Ga0207691_10019573 Ga0207691_100195735 314
182 3300025942 Ga0207689_10043513 Ga0207689_100435132 314
183 3300025960 Ga0207651_10080573 Ga0207651_100805732 314
184 3300025986 Ga0207658_10274434 Ga0207658_102744342 314
185 3300026118 Ga0207675_100516564 Ga0207675_1005165642 314
186 3300031911 Ga0307412_10337653 Ga0307412_103376531 314
187 3300005330 Ga0070690_100078067 Ga0070690_1000780672 315
188 3300005331 Ga0070670_100075467 Ga0070670_1000754672 315
189 3300005353 Ga0070669_100003198 Ga0070669_1000031989 315
190 3300005441 Ga0070700_100004830 Ga0070700_1000048303 315
191 3300005444 Ga0070694_100105407 Ga0070694_1001054073 315
192 3300005457 Ga0070662_100314996 Ga0070662_1003149962 315
193 3300005458 Ga0070681_10009576 Ga0070681_100095769 315
194 3300005459 Ga0068867_100174980 Ga0068867_1001749801 315
195 3300005467 Ga0070706_100141706 Ga0070706_1001417063 315
196 3300005536 Ga0070697_100000147 Ga0070697_10000014747 315
197 3300005539 Ga0068853_100027278 Ga0068853_1000272782 315
198 3300005543 Ga0070672_100087600 Ga0070672_1000876002 315
199 3300005546 Ga0070696_100022826 Ga0070696_1000228263 315
200 3300005549 Ga0070704_100006970 Ga0070704_1000069701 315
201 3300005615 Ga0070702_100054150 Ga0070702_1000541502 315
202 3300005616 Ga0068852_100399841 Ga0068852_1003998412 315
203 3300005618 Ga0068864_100438801 Ga0068864_1004388011 315
204 3300005719 Ga0068861_100105465 Ga0068861_1001054652 315
205 3300005844 Ga0068862_100045601 Ga0068862_1000456012 315
206 3300009093 Ga0105240_10030848 Ga0105240_100308484 315
207 3300009147 Ga0114129_10006374 Ga0114129_1000637419 315
208 3300009177 Ga0105248_10437432 Ga0105248_104374321 315
209 3300009553 Ga0105249_10017124 Ga0105249_100171242 315
210 3300010375 Ga0105239_10069432 Ga0105239_100694323 315
211 3300013102 Ga0157371_10169428 Ga0157371_101694282 315
212 3300013105 Ga0157369_10060836 Ga0157369_100608363 315
213 3300013297 Ga0157378_10098721 Ga0157378_100987212 315
214 3300013306 Ga0163162_10147104 Ga0163162_101471042 315
215 3300013306 Ga0163162_10363499 Ga0163162_103634992 315
216 3300014326 Ga0157380_10001541 Ga0157380_1000154118 315
217 3300014326 Ga0157380_10153358 Ga0157380_101533583 315
218 3300017792 Ga0163161_10088916 Ga0163161_100889163 315
219 3300017792 Ga0163161_10290593 Ga0163161_102905931 315
220 3300025910 Ga0207684_10113187 Ga0207684_101131873 315
221 3300025912 Ga0207707_10003276 Ga0207707_100032767 315
222 3300025920 Ga0207649_10192815 Ga0207649_101928151 315
223 3300025923 Ga0207681_10006122 Ga0207681_100061223 315
224 3300025939 Ga0207665_10227901 Ga0207665_102279011 315
225 3300026075 Ga0207708_10004179 Ga0207708_100041794 315
226 3300026118 Ga0207675_100104644 Ga0207675_1001046443 315
227 3300027907 Ga0207428_10043604 Ga0207428_100436043 315
228 3300028380 Ga0268265_10023740 Ga0268265_100237403 315
229 3300032002 Ga0307416_100115615 Ga0307416_1001156152 315
230 3300000549 LJQas_1000322 LJQas_10003221 317
231 3300005548 Ga0070665_100058638 Ga0070665_1000586384 317
232 3300028379 Ga0268266_10062005 Ga0268266_100620052 317
233 3300031852 Ga0307410_10011433 Ga0307410_100114333 317
234 3300031901 Ga0307406_10058796 Ga0307406_100587963 317
235 3300031911 Ga0307412_10111003 Ga0307412_101110032 317
236 3300031995 Ga0307409_100014968 Ga0307409_1000149684 317
237 3300032004 Ga0307414_10382550 Ga0307414_103825501 317
238 3300032005 Ga0307411_10122462 Ga0307411_101224622 317
239 3300049588 Ga0501072_0197665 Ga0501072_0197665_307_1263 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

24

333

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9498 10 316
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9466 10 316
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9461 10 317
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9415 10 313
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9396 10 317
ID Description Score Start End Superfamily
1n2xB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9504 10 313 3.40.50.150
1n2xB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9397 10 313 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9341 10 317 3.40.50.150
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9309 115 220 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9289 118 220 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A6L4Z1T6-F1-model_v4 16S rRNA (Cytosine1402-N4)-methyltransferase 0.9777 204 317 GO:0005737
GO:0070475
GO:0071424
AF-A0A6L4Z1T6-F1-model_v4 16S rRNA (Cytosine1402-N4)-methyltransferase 0.9693 204 317 GO:0005737
GO:0070475
GO:0071424
AF-A0A3D0V5H2-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9664 9 316 GO:0005737
GO:0070475
GO:0071424
AF-A0A3M1SEM3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9651 7 316 GO:0005737
GO:0070475
GO:0071424
AF-A0A660WL32-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.963 10 316 GO:0005737
GO:0070475
GO:0071424

Feature Viewer

pLDDT pTM Quality
89.83 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map