F351765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 239 | 164 | 239 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100058638|Ga0070665_1000586384 |
| Length | 334 |
| Sequence | MFVCFERAAYLIVCSLKMPMNIEENIHKSVLPAETVELLKPQADEIFVDATLGLGGHAEKILSINEKIRLIGIDQDTEAIKLATHRLEKFGSRIEIFHSNFSEIKQVLKQAGIEKVDGILADLGVSSLQFDSAERGFSFRFDAPLDMRMNADDETETAADLLATLSEFEIARIIYEYGEERLSRKIARRIVWKRELGEPIETTKHLAETVEKAVGRGKKDKIHPATKTFQALRIAVNGELEILERFLRDSVEVLKKDGRLAVITFHSLEDRIVKQTFQKLAGKCDCPPRLPKCVCGAKREVEILTRKPIVPNEIELQENPRARSAKLRACLKLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 164 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 2.93 |
| Rhizosphere | 94.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000322 | 3300000549 | Bacteria | 8400 |
| 2 | JGI24741J21665_1010195 | 3300001915 | Bacteria | 1693 |
| 3 | JGI24747J21853_1000864 | 3300001978 | Bacteria | 2084 |
| 4 | JGI24743J22301_10003006 | 3300001991 | Bacteria | 2622 |
| 5 | JGI24748J21848_1006080 | 3300002074 | Bacteria | 1405 |
| 6 | JGI24034J26672_10005835 | 3300002239 | Bacteria | 1771 |
| 7 | JGI24751J29686_10001566 | 3300002459 | Bacteria | 4725 |
| 8 | Ga0058860_10071926 | 3300004801 | Bacteria | 1820 |
| 9 | Ga0065704_10119091 | 3300005289 | Bacteria | 1805 |
| 10 | Ga0065712_10102582 | 3300005290 | Unclassified | 2005 |
| 11 | Ga0065715_10101245 | 3300005293 | Unclassified | 3224 |
| 12 | Ga0065715_10126817 | 3300005293 | Bacteria | 2101 |
| 13 | Ga0070676_10099034 | 3300005328 | Bacteria | 1798 |
| 14 | Ga0070683_100000496 | 3300005329 | Bacteria | 27786 |
| 15 | Ga0070683_100070864 | 3300005329 | Unclassified | 3252 |
| 16 | Ga0070690_100001738 | 3300005330 | Bacteria | 11509 |
| 17 | Ga0070690_100078067 | 3300005330 | Unclassified | 2163 |
| 18 | Ga0070690_100102875 | 3300005330 | Bacteria | 1896 |
| 19 | Ga0070670_100038657 | 3300005331 | Unclassified | 4103 |
| 20 | Ga0070670_100075467 | 3300005331 | Bacteria | 2897 |
| 21 | Ga0068869_100042225 | 3300005334 | Unclassified | 3269 |
| 22 | Ga0070666_10027779 | 3300005335 | Bacteria | 3708 |
| 23 | Ga0070682_100000056 | 3300005337 | Bacteria | 108991 |
| 24 | Ga0070689_100005423 | 3300005340 | Bacteria | 8702 |
| 25 | Ga0070689_100012741 | 3300005340 | Bacteria | 6069 |
| 26 | Ga0070689_100021865 | 3300005340 | Unclassified | 4769 |
| 27 | Ga0070689_100291600 | 3300005340 | Bacteria | 1356 |
| 28 | Ga0070687_100001786 | 3300005343 | Bacteria | 7773 |
| 29 | Ga0070668_100014828 | 3300005347 | Bacteria | 5825 |
| 30 | Ga0070669_100003198 | 3300005353 | Bacteria | 11772 |
| 31 | Ga0070669_100039166 | 3300005353 | Bacteria | 3443 |
| 32 | Ga0070675_100360583 | 3300005354 | Unclassified | 1290 |
| 33 | Ga0070675_100483925 | 3300005354 | Bacteria | 1113 |
| 34 | Ga0070671_100037610 | 3300005355 | Bacteria | 4014 |
| 35 | Ga0070671_100041339 | 3300005355 | Bacteria | 3831 |
| 36 | Ga0070688_100000531 | 3300005365 | Bacteria | 19278 |
| 37 | Ga0070688_100026923 | 3300005365 | Unclassified | 3421 |
| 38 | Ga0070659_100003187 | 3300005366 | Bacteria | 11679 |
| 39 | Ga0070705_100159638 | 3300005440 | Bacteria | 1506 |
| 40 | Ga0070700_100004830 | 3300005441 | Bacteria | 7074 |
| 41 | Ga0070694_100105407 | 3300005444 | Unclassified | 2001 |
| 42 | Ga0070678_100026786 | 3300005456 | Bacteria | 3904 |
| 43 | Ga0070662_100005457 | 3300005457 | Bacteria | 8124 |
| 44 | Ga0070662_100314996 | 3300005457 | Bacteria | 1275 |
| 45 | Ga0070681_10009576 | 3300005458 | Bacteria | 9526 |
| 46 | Ga0068867_100003018 | 3300005459 | Bacteria | 11867 |
| 47 | Ga0068867_100174980 | 3300005459 | Bacteria | 1703 |
| 48 | Ga0070685_10030844 | 3300005466 | Bacteria | 2990 |
| 49 | Ga0070706_100141706 | 3300005467 | Unclassified | 2244 |
| 50 | Ga0070698_100019778 | 3300005471 | Bacteria | 7062 |
| 51 | Ga0070698_100060104 | 3300005471 | Bacteria | 3835 |
| 52 | Ga0070684_100002473 | 3300005535 | Bacteria | 13605 |
| 53 | Ga0070684_100048617 | 3300005535 | Bacteria | 3679 |
| 54 | Ga0070697_100000147 | 3300005536 | Bacteria | 57115 |
| 55 | Ga0070697_100000204 | 3300005536 | Bacteria | 48652 |
| 56 | Ga0068853_100027278 | 3300005539 | Unclassified | 4797 |
| 57 | Ga0068853_100030479 | 3300005539 | Bacteria | 4555 |
| 58 | Ga0070672_100087600 | 3300005543 | Unclassified | 2506 |
| 59 | Ga0070695_100089849 | 3300005545 | Unclassified | 2049 |
| 60 | Ga0070696_100022826 | 3300005546 | Bacteria | 4254 |
| 61 | Ga0070696_100166319 | 3300005546 | Unclassified | 1628 |
| 62 | Ga0070665_100058638 | 3300005548 | Unclassified | 3859 |
| 63 | Ga0070704_100006970 | 3300005549 | Bacteria | 6703 |
| 64 | Ga0068855_100060543 | 3300005563 | Bacteria | 4427 |
| 65 | Ga0068855_100596805 | 3300005563 | Unclassified | 1191 |
| 66 | Ga0068857_100006445 | 3300005577 | Bacteria | 10063 |
| 67 | Ga0068854_100140180 | 3300005578 | Bacteria | 1855 |
| 68 | Ga0068856_100007717 | 3300005614 | Bacteria | 10505 |
| 69 | Ga0070702_100054150 | 3300005615 | Bacteria | 2307 |
| 70 | Ga0068852_100041663 | 3300005616 | Bacteria | 3882 |
| 71 | Ga0068852_100184194 | 3300005616 | Bacteria | 1965 |
| 72 | Ga0068852_100399841 | 3300005616 | Unclassified | 1351 |
| 73 | Ga0068864_100025446 | 3300005618 | Bacteria | 4984 |
| 74 | Ga0068864_100438801 | 3300005618 | Bacteria | 1247 |
| 75 | Ga0068866_10002657 | 3300005718 | Bacteria | 7383 |
| 76 | Ga0068861_100013353 | 3300005719 | Bacteria | 5748 |
| 77 | Ga0068861_100105465 | 3300005719 | Unclassified | 2251 |
| 78 | Ga0068851_10027603 | 3300005834 | Bacteria | 2798 |
| 79 | Ga0068851_10031674 | 3300005834 | Bacteria | 2628 |
| 80 | Ga0068862_100007585 | 3300005844 | Bacteria | 8993 |
| 81 | Ga0068862_100045601 | 3300005844 | Bacteria | 3741 |
| 82 | Ga0081540_1086211 | 3300005983 | Unclassified | 1395 |
| 83 | Ga0097621_100236034 | 3300006237 | Bacteria | 1597 |
| 84 | Ga0075430_100235374 | 3300006846 | Bacteria | 1518 |
| 85 | Ga0068865_100027513 | 3300006881 | Bacteria | 3757 |
| 86 | Ga0105240_10030848 | 3300009093 | Bacteria | 6963 |
| 87 | Ga0105240_10137501 | 3300009093 | Bacteria | 2925 |
| 88 | Ga0105245_10011067 | 3300009098 | Bacteria | 7855 |
| 89 | Ga0105247_10002106 | 3300009101 | Bacteria | 13754 |
| 90 | Ga0114129_10006374 | 3300009147 | Bacteria | 16728 |
| 91 | Ga0105241_10055484 | 3300009174 | Bacteria | 3036 |
| 92 | Ga0105242_10005259 | 3300009176 | Bacteria | 9991 |
| 93 | Ga0105248_10303171 | 3300009177 | Bacteria | 1799 |
| 94 | Ga0105248_10437432 | 3300009177 | Unclassified | 1473 |
| 95 | Ga0105249_10017124 | 3300009553 | Bacteria | 6432 |
| 96 | Ga0105249_10030080 | 3300009553 | Unclassified | 4907 |
| 97 | Ga0105249_10031624 | 3300009553 | Bacteria | 4787 |
| 98 | Ga0105239_10005619 | 3300010375 | Bacteria | 14660 |
| 99 | Ga0105239_10069432 | 3300010375 | Unclassified | 3872 |
| 100 | Ga0157373_10020271 | 3300013100 | Bacteria | 4836 |
| 101 | Ga0157373_10025622 | 3300013100 | Unclassified | 4264 |
| 102 | Ga0157371_10007887 | 3300013102 | Bacteria | 8546 |
| 103 | Ga0157371_10169428 | 3300013102 | Bacteria | 1560 |
| 104 | Ga0157371_10287390 | 3300013102 | Unclassified | 1189 |
| 105 | Ga0157370_10037911 | 3300013104 | Bacteria | 4666 |
| 106 | Ga0157369_10060836 | 3300013105 | Unclassified | 4072 |
| 107 | Ga0157369_10071098 | 3300013105 | Bacteria | 3737 |
| 108 | Ga0157374_10251187 | 3300013296 | Bacteria | 1740 |
| 109 | Ga0157378_10050433 | 3300013297 | Bacteria | 3704 |
| 110 | Ga0157378_10098721 | 3300013297 | Bacteria | 2663 |
| 111 | Ga0157378_10111434 | 3300013297 | Unclassified | 2509 |
| 112 | Ga0157378_10171493 | 3300013297 | Unclassified | 2035 |
| 113 | Ga0157378_10594954 | 3300013297 | Bacteria | 1117 |
| 114 | Ga0163162_10147104 | 3300013306 | Bacteria | 2472 |
| 115 | Ga0163162_10363499 | 3300013306 | Unclassified | 1580 |
| 116 | Ga0163162_10776476 | 3300013306 | Bacteria | 1076 |
| 117 | Ga0157372_10045141 | 3300013307 | Bacteria | 4887 |
| 118 | Ga0157375_10047954 | 3300013308 | Bacteria | 4175 |
| 119 | Ga0157375_10053572 | 3300013308 | Bacteria | 3970 |
| 120 | Ga0157375_10305933 | 3300013308 | Bacteria | 1754 |
| 121 | Ga0163163_10003303 | 3300014325 | Bacteria | 13677 |
| 122 | Ga0157380_10001541 | 3300014326 | Bacteria | 15135 |
| 123 | Ga0157380_10017455 | 3300014326 | Bacteria | 5311 |
| 124 | Ga0157380_10153358 | 3300014326 | Unclassified | 1994 |
| 125 | Ga0157377_10074673 | 3300014745 | Bacteria | 1967 |
| 126 | Ga0157379_10003176 | 3300014968 | Bacteria | 13915 |
| 127 | Ga0163161_10000899 | 3300017792 | Bacteria | 23098 |
| 128 | Ga0163161_10002477 | 3300017792 | Bacteria | 13166 |
| 129 | Ga0163161_10088916 | 3300017792 | Bacteria | 2284 |
| 130 | Ga0163161_10290593 | 3300017792 | Unclassified | 1285 |
| 131 | Ga0213876_10013417 | 3300021384 | Bacteria | 4353 |
| 132 | Ga0207656_10036815 | 3300025321 | Bacteria | 2055 |
| 133 | Ga0207682_10021823 | 3300025893 | Bacteria | 2519 |
| 134 | Ga0207642_10025327 | 3300025899 | Bacteria | 2398 |
| 135 | Ga0207680_10014112 | 3300025903 | Bacteria | 4122 |
| 136 | Ga0207647_10001115 | 3300025904 | Bacteria | 20674 |
| 137 | Ga0207645_10000471 | 3300025907 | Bacteria | 33296 |
| 138 | Ga0207645_10079458 | 3300025907 | Bacteria | 2102 |
| 139 | Ga0207643_10000375 | 3300025908 | Bacteria | 30034 |
| 140 | Ga0207684_10031409 | 3300025910 | Unclassified | 4518 |
| 141 | Ga0207684_10113187 | 3300025910 | Unclassified | 2323 |
| 142 | Ga0207654_10196401 | 3300025911 | Unclassified | 1326 |
| 143 | Ga0207707_10003276 | 3300025912 | Bacteria | 14384 |
| 144 | Ga0207662_10001466 | 3300025918 | Bacteria | 11455 |
| 145 | Ga0207662_10071856 | 3300025918 | Bacteria | 2096 |
| 146 | Ga0207649_10000233 | 3300025920 | Bacteria | 45406 |
| 147 | Ga0207649_10192815 | 3300025920 | Unclassified | 1434 |
| 148 | Ga0207646_10266752 | 3300025922 | Bacteria | 1547 |
| 149 | Ga0207681_10006122 | 3300025923 | Bacteria | 7380 |
| 150 | Ga0207681_10067794 | 3300025923 | Bacteria | 2475 |
| 151 | Ga0207650_10000107 | 3300025925 | Bacteria | 109863 |
| 152 | Ga0207650_10030760 | 3300025925 | Unclassified | 3870 |
| 153 | Ga0207650_10088920 | 3300025925 | Unclassified | 2356 |
| 154 | Ga0207659_10288790 | 3300025926 | Bacteria | 1343 |
| 155 | Ga0207687_10171907 | 3300025927 | Bacteria | 1672 |
| 156 | Ga0207644_10017005 | 3300025931 | Bacteria | 4902 |
| 157 | Ga0207644_10162585 | 3300025931 | Bacteria | 1736 |
| 158 | Ga0207706_10000238 | 3300025933 | Bacteria | 60595 |
| 159 | Ga0207686_10096372 | 3300025934 | Bacteria | 1965 |
| 160 | Ga0207670_10006347 | 3300025936 | Bacteria | 6551 |
| 161 | Ga0207670_10012368 | 3300025936 | Bacteria | 4993 |
| 162 | Ga0207670_10014685 | 3300025936 | Unclassified | 4657 |
| 163 | Ga0207665_10227901 | 3300025939 | Unclassified | 1368 |
| 164 | Ga0207691_10000751 | 3300025940 | Bacteria | 32082 |
| 165 | Ga0207691_10019573 | 3300025940 | Bacteria | 6404 |
| 166 | Ga0207711_10025175 | 3300025941 | Bacteria | 4993 |
| 167 | Ga0207689_10043513 | 3300025942 | Unclassified | 3712 |
| 168 | Ga0207661_10000138 | 3300025944 | Bacteria | 46093 |
| 169 | Ga0207679_10000058 | 3300025945 | Bacteria | 101602 |
| 170 | Ga0207651_10080573 | 3300025960 | Bacteria | 2344 |
| 171 | Ga0207651_10114213 | 3300025960 | Bacteria | 2033 |
| 172 | Ga0207640_10025058 | 3300025981 | Bacteria | 3606 |
| 173 | Ga0207640_10066157 | 3300025981 | Bacteria | 2414 |
| 174 | Ga0207658_10013127 | 3300025986 | Bacteria | 5658 |
| 175 | Ga0207658_10274434 | 3300025986 | Bacteria | 1443 |
| 176 | Ga0207677_10009444 | 3300026023 | Bacteria | 5490 |
| 177 | Ga0207703_10051881 | 3300026035 | Bacteria | 3327 |
| 178 | Ga0207639_10081350 | 3300026041 | Bacteria | 2565 |
| 179 | Ga0207678_10001492 | 3300026067 | Bacteria | 21439 |
| 180 | Ga0207708_10004179 | 3300026075 | Bacteria | 10614 |
| 181 | Ga0207708_10085578 | 3300026075 | Bacteria | 2425 |
| 182 | Ga0207641_10000163 | 3300026088 | Bacteria | 94033 |
| 183 | Ga0207641_10090596 | 3300026088 | Unclassified | 2675 |
| 184 | Ga0207648_10001068 | 3300026089 | Bacteria | 30718 |
| 185 | Ga0207676_10000142 | 3300026095 | Bacteria | 62851 |
| 186 | Ga0207674_10000336 | 3300026116 | Bacteria | 60214 |
| 187 | Ga0207675_100085000 | 3300026118 | Bacteria | 2969 |
| 188 | Ga0207675_100101913 | 3300026118 | Bacteria | 2705 |
| 189 | Ga0207675_100104644 | 3300026118 | Unclassified | 2668 |
| 190 | Ga0207675_100516564 | 3300026118 | Bacteria | 1190 |
| 191 | Ga0207683_10002065 | 3300026121 | Bacteria | 17759 |
| 192 | Ga0207698_10525767 | 3300026142 | Bacteria | 1155 |
| 193 | Ga0207428_10043604 | 3300027907 | Bacteria | 3622 |
| 194 | Ga0268266_10037800 | 3300028379 | Bacteria | 4109 |
| 195 | Ga0268266_10062005 | 3300028379 | Unclassified | 3226 |
| 196 | Ga0268265_10009646 | 3300028380 | Bacteria | 6517 |
| 197 | Ga0268265_10023740 | 3300028380 | Bacteria | 4327 |
| 198 | Ga0268264_10063158 | 3300028381 | Bacteria | 3112 |
| 199 | Ga0265320_10011200 | 3300031240 | Bacteria | 5289 |
| 200 | Ga0307410_10011433 | 3300031852 | Bacteria | 5077 |
| 201 | Ga0307410_10075044 | 3300031852 | Bacteria | 2357 |
| 202 | Ga0307410_10242227 | 3300031852 | Bacteria | 1398 |
| 203 | Ga0307406_10058796 | 3300031901 | Bacteria | 2472 |
| 204 | Ga0307407_10077552 | 3300031903 | Bacteria | 1999 |
| 205 | Ga0307412_10111003 | 3300031911 | Bacteria | 1958 |
| 206 | Ga0307412_10337653 | 3300031911 | Bacteria | 1205 |
| 207 | Ga0307409_100014968 | 3300031995 | Bacteria | 5070 |
| 208 | Ga0307416_100115615 | 3300032002 | Bacteria | 2376 |
| 209 | Ga0307414_10382550 | 3300032004 | Unclassified | 1217 |
| 210 | Ga0307411_10122462 | 3300032005 | Unclassified | 1885 |
| 211 | Ga0307411_10307465 | 3300032005 | Bacteria | 1274 |
| 212 | Ga0307415_100191301 | 3300032126 | Bacteria | 1615 |
| 213 | Ga0373943_0060213 | 3300035170 | Bacteria | 1895 |
| 214 | Ga0373943_0155328 | 3300035170 | Bacteria | 1242 |
| 215 | Ga0373955_0222176 | 3300035172 | Bacteria | 1128 |
| 216 | Ga0373962_0029248 | 3300035242 | Bacteria | 1500 |
| 217 | Ga0436365_0399460 | 3300039437 | Bacteria | 5870 |
| 218 | Ga0436365_1056637 | 3300039437 | Bacteria | 1466 |
| 219 | Ga0451576_0189648 | 3300045051 | Bacteria | 2147 |
| 220 | Ga0495618_0070806 | 3300046514 | Bacteria | 2218 |
| 221 | Ga0495628_0156675 | 3300046516 | Bacteria | 1732 |
| 222 | Ga0495630_0005124 | 3300046517 | Bacteria | 9221 |
| 223 | Ga0495663_0000912 | 3300046525 | Bacteria | 9873 |
| 224 | Ga0495586_0074791 | 3300046535 | Bacteria | 1854 |
| 225 | Ga0495621_0005762 | 3300046539 | Bacteria | 3580 |
| 226 | Ga0495668_0004924 | 3300046616 | Bacteria | 9266 |
| 227 | Ga0495672_0036943 | 3300047320 | Bacteria | 2994 |
| 228 | Ga0496101_0172288 | 3300048904 | Bacteria | 1664 |
| 229 | Ga0496108_0000082 | 3300048911 | Bacteria | 101998 |
| 230 | Ga0496109_0000148 | 3300048912 | Bacteria | 69299 |
| 231 | Ga0496110_0000377 | 3300048913 | Bacteria | 29876 |
| 232 | Ga0496111_0000789 | 3300048914 | Bacteria | 16936 |
| 233 | Ga0496112_0000151 | 3300048915 | Bacteria | 43735 |
| 234 | Ga0496113_0001130 | 3300048916 | Bacteria | 14502 |
| 235 | Ga0501072_0197665 | 3300049588 | Bacteria | 1603 |
| 236 | nmdc:mga06r32_650247_c1 | 3300050510 | Bacteria | 1022 |
| 237 | Ga0495612_0029713 | 3300053078 | Bacteria | 2202 |
| 238 | Ga0500577_0000864 | 3300053142 | Bacteria | 7829 |
| 239 | Ga0501084_0082431 | 3300054114 | Unclassified | 2699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1056637 | Ga0436365_1056637_399_1196 | 261 |
| 2 | 3300021384 | Ga0213876_10013417 | Ga0213876_100134174 | 274 |
| 3 | 3300039437 | Ga0436365_0399460 | Ga0436365_0399460_1937_2773 | 274 |
| 4 | 3300004801 | Ga0058860_10071926 | Ga0058860_100719263 | 276 |
| 5 | 3300053142 | Ga0500577_0000864 | Ga0500577_0000864_2352_3302 | 281 |
| 6 | 3300005471 | Ga0070698_100060104 | Ga0070698_1000601045 | 283 |
| 7 | 3300006846 | Ga0075430_100235374 | Ga0075430_1002353743 | 283 |
| 8 | 3300035170 | Ga0373943_0060213 | Ga0373943_0060213_506_1369 | 283 |
| 9 | 3300035172 | Ga0373955_0222176 | Ga0373955_0222176_225_1088 | 283 |
| 10 | 3300046514 | Ga0495618_0070806 | Ga0495618_0070806_67_930 | 283 |
| 11 | 3300046516 | Ga0495628_0156675 | Ga0495628_0156675_815_1678 | 283 |
| 12 | 3300046517 | Ga0495630_0005124 | Ga0495630_0005124_2859_3722 | 283 |
| 13 | 3300046535 | Ga0495586_0074791 | Ga0495586_0074791_971_1834 | 283 |
| 14 | 3300050510 | nmdc:mga06r32_650247_c1 | nmdc:mga06r32_650247_c1_48_905 | 283 |
| 15 | 3300053078 | Ga0495612_0029713 | Ga0495612_0029713_1202_2065 | 283 |
| 16 | 3300013102 | Ga0157371_10287390 | Ga0157371_102873901 | 284 |
| 17 | 3300035242 | Ga0373962_0029248 | Ga0373962_0029248_393_1259 | 284 |
| 18 | 3300013307 | Ga0157372_10045141 | Ga0157372_100451414 | 285 |
| 19 | 3300005354 | Ga0070675_100360583 | Ga0070675_1003605831 | 286 |
| 20 | 3300031240 | Ga0265320_10011200 | Ga0265320_100112003 | 286 |
| 21 | 3300046525 | Ga0495663_0000912 | Ga0495663_0000912_110_1018 | 289 |
| 22 | 3300046539 | Ga0495621_0005762 | Ga0495621_0005762_24_932 | 289 |
| 23 | 3300054114 | Ga0501084_0082431 | Ga0501084_0082431_1333_2343 | 290 |
| 24 | 3300005340 | Ga0070689_100291600 | Ga0070689_1002916001 | 291 |
| 25 | 3300005440 | Ga0070705_100159638 | Ga0070705_1001596381 | 291 |
| 26 | 3300025918 | Ga0207662_10071856 | Ga0207662_100718563 | 291 |
| 27 | 3300025922 | Ga0207646_10266752 | Ga0207646_102667522 | 291 |
| 28 | 3300025981 | Ga0207640_10066157 | Ga0207640_100661572 | 291 |
| 29 | 3300001915 | JGI24741J21665_1010195 | JGI24741J21665_10101952 | 293 |
| 30 | 3300001978 | JGI24747J21853_1000864 | JGI24747J21853_10008643 | 293 |
| 31 | 3300001991 | JGI24743J22301_10003006 | JGI24743J22301_100030064 | 293 |
| 32 | 3300002074 | JGI24748J21848_1006080 | JGI24748J21848_10060802 | 293 |
| 33 | 3300002239 | JGI24034J26672_10005835 | JGI24034J26672_100058353 | 293 |
| 34 | 3300002459 | JGI24751J29686_10001566 | JGI24751J29686_100015666 | 293 |
| 35 | 3300005329 | Ga0070683_100000496 | Ga0070683_10000049611 | 293 |
| 36 | 3300005330 | Ga0070690_100001738 | Ga0070690_1000017384 | 293 |
| 37 | 3300005335 | Ga0070666_10027779 | Ga0070666_100277794 | 293 |
| 38 | 3300005340 | Ga0070689_100005423 | Ga0070689_1000054235 | 293 |
| 39 | 3300005343 | Ga0070687_100001786 | Ga0070687_1000017866 | 293 |
| 40 | 3300005347 | Ga0070668_100014828 | Ga0070668_1000148283 | 293 |
| 41 | 3300005353 | Ga0070669_100039166 | Ga0070669_1000391663 | 293 |
| 42 | 3300005354 | Ga0070675_100483925 | Ga0070675_1004839251 | 293 |
| 43 | 3300005355 | Ga0070671_100037610 | Ga0070671_1000376103 | 293 |
| 44 | 3300005365 | Ga0070688_100000531 | Ga0070688_1000005314 | 293 |
| 45 | 3300005366 | Ga0070659_100003187 | Ga0070659_1000031877 | 293 |
| 46 | 3300005456 | Ga0070678_100026786 | Ga0070678_1000267863 | 293 |
| 47 | 3300005457 | Ga0070662_100005457 | Ga0070662_1000054576 | 293 |
| 48 | 3300005459 | Ga0068867_100003018 | Ga0068867_1000030184 | 293 |
| 49 | 3300005535 | Ga0070684_100002473 | Ga0070684_10000247311 | 293 |
| 50 | 3300005539 | Ga0068853_100030479 | Ga0068853_1000304793 | 293 |
| 51 | 3300005563 | Ga0068855_100060543 | Ga0068855_1000605434 | 293 |
| 52 | 3300005577 | Ga0068857_100006445 | Ga0068857_1000064454 | 293 |
| 53 | 3300005614 | Ga0068856_100007717 | Ga0068856_1000077179 | 293 |
| 54 | 3300005616 | Ga0068852_100041663 | Ga0068852_1000416634 | 293 |
| 55 | 3300005718 | Ga0068866_10002657 | Ga0068866_100026578 | 293 |
| 56 | 3300005834 | Ga0068851_10027603 | Ga0068851_100276032 | 293 |
| 57 | 3300005844 | Ga0068862_100007585 | Ga0068862_1000075854 | 293 |
| 58 | 3300006237 | Ga0097621_100236034 | Ga0097621_1002360341 | 293 |
| 59 | 3300006881 | Ga0068865_100027513 | Ga0068865_1000275134 | 293 |
| 60 | 3300009093 | Ga0105240_10137501 | Ga0105240_101375012 | 293 |
| 61 | 3300009098 | Ga0105245_10011067 | Ga0105245_100110675 | 293 |
| 62 | 3300009101 | Ga0105247_10002106 | Ga0105247_1000210612 | 293 |
| 63 | 3300009174 | Ga0105241_10055484 | Ga0105241_100554841 | 293 |
| 64 | 3300009176 | Ga0105242_10005259 | Ga0105242_100052594 | 293 |
| 65 | 3300009177 | Ga0105248_10303171 | Ga0105248_103031712 | 293 |
| 66 | 3300009553 | Ga0105249_10031624 | Ga0105249_100316243 | 293 |
| 67 | 3300010375 | Ga0105239_10005619 | Ga0105239_100056197 | 293 |
| 68 | 3300013100 | Ga0157373_10020271 | Ga0157373_100202712 | 293 |
| 69 | 3300013102 | Ga0157371_10007887 | Ga0157371_100078877 | 293 |
| 70 | 3300013105 | Ga0157369_10071098 | Ga0157369_100710981 | 293 |
| 71 | 3300013296 | Ga0157374_10251187 | Ga0157374_102511872 | 293 |
| 72 | 3300013297 | Ga0157378_10050433 | Ga0157378_100504334 | 293 |
| 73 | 3300013308 | Ga0157375_10047954 | Ga0157375_100479543 | 293 |
| 74 | 3300014325 | Ga0163163_10003303 | Ga0163163_100033035 | 293 |
| 75 | 3300014326 | Ga0157380_10017455 | Ga0157380_100174554 | 293 |
| 76 | 3300014745 | Ga0157377_10074673 | Ga0157377_100746733 | 293 |
| 77 | 3300014968 | Ga0157379_10003176 | Ga0157379_1000317611 | 293 |
| 78 | 3300017792 | Ga0163161_10002477 | Ga0163161_1000247716 | 293 |
| 79 | 3300025321 | Ga0207656_10036815 | Ga0207656_100368152 | 293 |
| 80 | 3300025893 | Ga0207682_10021823 | Ga0207682_100218233 | 293 |
| 81 | 3300025899 | Ga0207642_10025327 | Ga0207642_100253272 | 293 |
| 82 | 3300025903 | Ga0207680_10014112 | Ga0207680_100141123 | 293 |
| 83 | 3300025904 | Ga0207647_10001115 | Ga0207647_100011158 | 293 |
| 84 | 3300025907 | Ga0207645_10000471 | Ga0207645_1000047127 | 293 |
| 85 | 3300025908 | Ga0207643_10000375 | Ga0207643_1000037521 | 293 |
| 86 | 3300025918 | Ga0207662_10001466 | Ga0207662_100014667 | 293 |
| 87 | 3300025920 | Ga0207649_10000233 | Ga0207649_1000023338 | 293 |
| 88 | 3300025923 | Ga0207681_10067794 | Ga0207681_100677943 | 293 |
| 89 | 3300025925 | Ga0207650_10000107 | Ga0207650_1000010768 | 293 |
| 90 | 3300025926 | Ga0207659_10288790 | Ga0207659_102887902 | 293 |
| 91 | 3300025927 | Ga0207687_10171907 | Ga0207687_101719073 | 293 |
| 92 | 3300025931 | Ga0207644_10017005 | Ga0207644_100170056 | 293 |
| 93 | 3300025933 | Ga0207706_10000238 | Ga0207706_1000023828 | 293 |
| 94 | 3300025934 | Ga0207686_10096372 | Ga0207686_100963723 | 293 |
| 95 | 3300025936 | Ga0207670_10006347 | Ga0207670_100063474 | 293 |
| 96 | 3300025940 | Ga0207691_10000751 | Ga0207691_100007514 | 293 |
| 97 | 3300025941 | Ga0207711_10025175 | Ga0207711_100251754 | 293 |
| 98 | 3300025944 | Ga0207661_10000138 | Ga0207661_1000013839 | 293 |
| 99 | 3300025945 | Ga0207679_10000058 | Ga0207679_1000005830 | 293 |
| 100 | 3300025960 | Ga0207651_10114213 | Ga0207651_101142132 | 293 |
| 101 | 3300025981 | Ga0207640_10025058 | Ga0207640_100250584 | 293 |
| 102 | 3300025986 | Ga0207658_10013127 | Ga0207658_100131274 | 293 |
| 103 | 3300026023 | Ga0207677_10009444 | Ga0207677_100094444 | 293 |
| 104 | 3300026035 | Ga0207703_10051881 | Ga0207703_100518812 | 293 |
| 105 | 3300026041 | Ga0207639_10081350 | Ga0207639_100813504 | 293 |
| 106 | 3300026067 | Ga0207678_10001492 | Ga0207678_100014924 | 293 |
| 107 | 3300026088 | Ga0207641_10000163 | Ga0207641_1000016348 | 293 |
| 108 | 3300026089 | Ga0207648_10001068 | Ga0207648_1000106825 | 293 |
| 109 | 3300026095 | Ga0207676_10000142 | Ga0207676_1000014230 | 293 |
| 110 | 3300026116 | Ga0207674_10000336 | Ga0207674_1000033625 | 293 |
| 111 | 3300026118 | Ga0207675_100085000 | Ga0207675_1000850004 | 293 |
| 112 | 3300026121 | Ga0207683_10002065 | Ga0207683_1000206512 | 293 |
| 113 | 3300026142 | Ga0207698_10525767 | Ga0207698_105257671 | 293 |
| 114 | 3300028379 | Ga0268266_10037800 | Ga0268266_100378004 | 293 |
| 115 | 3300028380 | Ga0268265_10009646 | Ga0268265_100096468 | 293 |
| 116 | 3300028381 | Ga0268264_10063158 | Ga0268264_100631583 | 293 |
| 117 | 3300048904 | Ga0496101_0172288 | Ga0496101_0172288_474_1412 | 293 |
| 118 | 3300048911 | Ga0496108_0000082 | Ga0496108_0000082_77499_78437 | 293 |
| 119 | 3300048912 | Ga0496109_0000148 | Ga0496109_0000148_33559_34497 | 293 |
| 120 | 3300048913 | Ga0496110_0000377 | Ga0496110_0000377_26745_27683 | 293 |
| 121 | 3300048914 | Ga0496111_0000789 | Ga0496111_0000789_5143_6081 | 293 |
| 122 | 3300048915 | Ga0496112_0000151 | Ga0496112_0000151_34770_35708 | 293 |
| 123 | 3300048916 | Ga0496113_0001130 | Ga0496113_0001130_3147_4085 | 293 |
| 124 | 3300005289 | Ga0065704_10119091 | Ga0065704_101190912 | 296 |
| 125 | 3300047320 | Ga0495672_0036943 | Ga0495672_0036943_1445_2347 | 298 |
| 126 | 3300005983 | Ga0081540_1086211 | Ga0081540_10862112 | 299 |
| 127 | 3300013308 | Ga0157375_10305933 | Ga0157375_103059331 | 299 |
| 128 | 3300035170 | Ga0373943_0155328 | Ga0373943_0155328_230_1183 | 299 |
| 129 | 3300031852 | Ga0307410_10242227 | Ga0307410_102422272 | 303 |
| 130 | 3300045051 | Ga0451576_0189648 | Ga0451576_0189648_952_1872 | 304 |
| 131 | 3300005330 | Ga0070690_100102875 | Ga0070690_1001028753 | 305 |
| 132 | 3300026075 | Ga0207708_10085578 | Ga0207708_100855782 | 305 |
| 133 | 3300005719 | Ga0068861_100013353 | Ga0068861_1000133533 | 306 |
| 134 | 3300026118 | Ga0207675_100101913 | Ga0207675_1001019132 | 306 |
| 135 | 3300005331 | Ga0070670_100038657 | Ga0070670_1000386573 | 308 |
| 136 | 3300005337 | Ga0070682_100000056 | Ga0070682_10000005635 | 308 |
| 137 | 3300005340 | Ga0070689_100021865 | Ga0070689_1000218653 | 308 |
| 138 | 3300005365 | Ga0070688_100026923 | Ga0070688_1000269233 | 308 |
| 139 | 3300005466 | Ga0070685_10030844 | Ga0070685_100308442 | 308 |
| 140 | 3300009553 | Ga0105249_10030080 | Ga0105249_100300805 | 308 |
| 141 | 3300025925 | Ga0207650_10030760 | Ga0207650_100307603 | 308 |
| 142 | 3300025936 | Ga0207670_10014685 | Ga0207670_100146851 | 308 |
| 143 | 3300026088 | Ga0207641_10090596 | Ga0207641_100905963 | 308 |
| 144 | 3300005328 | Ga0070676_10099034 | Ga0070676_100990341 | 311 |
| 145 | 3300013100 | Ga0157373_10025622 | Ga0157373_100256223 | 311 |
| 146 | 3300005340 | Ga0070689_100012741 | Ga0070689_1000127414 | 312 |
| 147 | 3300025936 | Ga0207670_10012368 | Ga0207670_100123685 | 312 |
| 148 | 3300013308 | Ga0157375_10053572 | Ga0157375_100535724 | 313 |
| 149 | 3300025907 | Ga0207645_10079458 | Ga0207645_100794582 | 313 |
| 150 | 3300025911 | Ga0207654_10196401 | Ga0207654_101964012 | 313 |
| 151 | 3300031852 | Ga0307410_10075044 | Ga0307410_100750442 | 313 |
| 152 | 3300031903 | Ga0307407_10077552 | Ga0307407_100775522 | 313 |
| 153 | 3300032005 | Ga0307411_10307465 | Ga0307411_103074651 | 313 |
| 154 | 3300032126 | Ga0307415_100191301 | Ga0307415_1001913011 | 313 |
| 155 | 3300046616 | Ga0495668_0004924 | Ga0495668_0004924_7499_8443 | 313 |
| 156 | 3300005290 | Ga0065712_10102582 | Ga0065712_101025822 | 314 |
| 157 | 3300005293 | Ga0065715_10101245 | Ga0065715_101012453 | 314 |
| 158 | 3300005293 | Ga0065715_10126817 | Ga0065715_101268172 | 314 |
| 159 | 3300005329 | Ga0070683_100070864 | Ga0070683_1000708643 | 314 |
| 160 | 3300005334 | Ga0068869_100042225 | Ga0068869_1000422254 | 314 |
| 161 | 3300005355 | Ga0070671_100041339 | Ga0070671_1000413391 | 314 |
| 162 | 3300005471 | Ga0070698_100019778 | Ga0070698_1000197783 | 314 |
| 163 | 3300005535 | Ga0070684_100048617 | Ga0070684_1000486173 | 314 |
| 164 | 3300005536 | Ga0070697_100000204 | Ga0070697_10000020441 | 314 |
| 165 | 3300005545 | Ga0070695_100089849 | Ga0070695_1000898492 | 314 |
| 166 | 3300005546 | Ga0070696_100166319 | Ga0070696_1001663192 | 314 |
| 167 | 3300005563 | Ga0068855_100596805 | Ga0068855_1005968051 | 314 |
| 168 | 3300005578 | Ga0068854_100140180 | Ga0068854_1001401802 | 314 |
| 169 | 3300005616 | Ga0068852_100184194 | Ga0068852_1001841942 | 314 |
| 170 | 3300005618 | Ga0068864_100025446 | Ga0068864_1000254464 | 314 |
| 171 | 3300005834 | Ga0068851_10031674 | Ga0068851_100316743 | 314 |
| 172 | 3300013104 | Ga0157370_10037911 | Ga0157370_100379113 | 314 |
| 173 | 3300013297 | Ga0157378_10111434 | Ga0157378_101114342 | 314 |
| 174 | 3300013297 | Ga0157378_10171493 | Ga0157378_101714933 | 314 |
| 175 | 3300013297 | Ga0157378_10594954 | Ga0157378_105949541 | 314 |
| 176 | 3300013306 | Ga0163162_10776476 | Ga0163162_107764761 | 314 |
| 177 | 3300017792 | Ga0163161_10000899 | Ga0163161_100008993 | 314 |
| 178 | 3300025910 | Ga0207684_10031409 | Ga0207684_100314094 | 314 |
| 179 | 3300025925 | Ga0207650_10088920 | Ga0207650_100889203 | 314 |
| 180 | 3300025931 | Ga0207644_10162585 | Ga0207644_101625852 | 314 |
| 181 | 3300025940 | Ga0207691_10019573 | Ga0207691_100195735 | 314 |
| 182 | 3300025942 | Ga0207689_10043513 | Ga0207689_100435132 | 314 |
| 183 | 3300025960 | Ga0207651_10080573 | Ga0207651_100805732 | 314 |
| 184 | 3300025986 | Ga0207658_10274434 | Ga0207658_102744342 | 314 |
| 185 | 3300026118 | Ga0207675_100516564 | Ga0207675_1005165642 | 314 |
| 186 | 3300031911 | Ga0307412_10337653 | Ga0307412_103376531 | 314 |
| 187 | 3300005330 | Ga0070690_100078067 | Ga0070690_1000780672 | 315 |
| 188 | 3300005331 | Ga0070670_100075467 | Ga0070670_1000754672 | 315 |
| 189 | 3300005353 | Ga0070669_100003198 | Ga0070669_1000031989 | 315 |
| 190 | 3300005441 | Ga0070700_100004830 | Ga0070700_1000048303 | 315 |
| 191 | 3300005444 | Ga0070694_100105407 | Ga0070694_1001054073 | 315 |
| 192 | 3300005457 | Ga0070662_100314996 | Ga0070662_1003149962 | 315 |
| 193 | 3300005458 | Ga0070681_10009576 | Ga0070681_100095769 | 315 |
| 194 | 3300005459 | Ga0068867_100174980 | Ga0068867_1001749801 | 315 |
| 195 | 3300005467 | Ga0070706_100141706 | Ga0070706_1001417063 | 315 |
| 196 | 3300005536 | Ga0070697_100000147 | Ga0070697_10000014747 | 315 |
| 197 | 3300005539 | Ga0068853_100027278 | Ga0068853_1000272782 | 315 |
| 198 | 3300005543 | Ga0070672_100087600 | Ga0070672_1000876002 | 315 |
| 199 | 3300005546 | Ga0070696_100022826 | Ga0070696_1000228263 | 315 |
| 200 | 3300005549 | Ga0070704_100006970 | Ga0070704_1000069701 | 315 |
| 201 | 3300005615 | Ga0070702_100054150 | Ga0070702_1000541502 | 315 |
| 202 | 3300005616 | Ga0068852_100399841 | Ga0068852_1003998412 | 315 |
| 203 | 3300005618 | Ga0068864_100438801 | Ga0068864_1004388011 | 315 |
| 204 | 3300005719 | Ga0068861_100105465 | Ga0068861_1001054652 | 315 |
| 205 | 3300005844 | Ga0068862_100045601 | Ga0068862_1000456012 | 315 |
| 206 | 3300009093 | Ga0105240_10030848 | Ga0105240_100308484 | 315 |
| 207 | 3300009147 | Ga0114129_10006374 | Ga0114129_1000637419 | 315 |
| 208 | 3300009177 | Ga0105248_10437432 | Ga0105248_104374321 | 315 |
| 209 | 3300009553 | Ga0105249_10017124 | Ga0105249_100171242 | 315 |
| 210 | 3300010375 | Ga0105239_10069432 | Ga0105239_100694323 | 315 |
| 211 | 3300013102 | Ga0157371_10169428 | Ga0157371_101694282 | 315 |
| 212 | 3300013105 | Ga0157369_10060836 | Ga0157369_100608363 | 315 |
| 213 | 3300013297 | Ga0157378_10098721 | Ga0157378_100987212 | 315 |
| 214 | 3300013306 | Ga0163162_10147104 | Ga0163162_101471042 | 315 |
| 215 | 3300013306 | Ga0163162_10363499 | Ga0163162_103634992 | 315 |
| 216 | 3300014326 | Ga0157380_10001541 | Ga0157380_1000154118 | 315 |
| 217 | 3300014326 | Ga0157380_10153358 | Ga0157380_101533583 | 315 |
| 218 | 3300017792 | Ga0163161_10088916 | Ga0163161_100889163 | 315 |
| 219 | 3300017792 | Ga0163161_10290593 | Ga0163161_102905931 | 315 |
| 220 | 3300025910 | Ga0207684_10113187 | Ga0207684_101131873 | 315 |
| 221 | 3300025912 | Ga0207707_10003276 | Ga0207707_100032767 | 315 |
| 222 | 3300025920 | Ga0207649_10192815 | Ga0207649_101928151 | 315 |
| 223 | 3300025923 | Ga0207681_10006122 | Ga0207681_100061223 | 315 |
| 224 | 3300025939 | Ga0207665_10227901 | Ga0207665_102279011 | 315 |
| 225 | 3300026075 | Ga0207708_10004179 | Ga0207708_100041794 | 315 |
| 226 | 3300026118 | Ga0207675_100104644 | Ga0207675_1001046443 | 315 |
| 227 | 3300027907 | Ga0207428_10043604 | Ga0207428_100436043 | 315 |
| 228 | 3300028380 | Ga0268265_10023740 | Ga0268265_100237403 | 315 |
| 229 | 3300032002 | Ga0307416_100115615 | Ga0307416_1001156152 | 315 |
| 230 | 3300000549 | LJQas_1000322 | LJQas_10003221 | 317 |
| 231 | 3300005548 | Ga0070665_100058638 | Ga0070665_1000586384 | 317 |
| 232 | 3300028379 | Ga0268266_10062005 | Ga0268266_100620052 | 317 |
| 233 | 3300031852 | Ga0307410_10011433 | Ga0307410_100114333 | 317 |
| 234 | 3300031901 | Ga0307406_10058796 | Ga0307406_100587963 | 317 |
| 235 | 3300031911 | Ga0307412_10111003 | Ga0307412_101110032 | 317 |
| 236 | 3300031995 | Ga0307409_100014968 | Ga0307409_1000149684 | 317 |
| 237 | 3300032004 | Ga0307414_10382550 | Ga0307414_103825501 | 317 |
| 238 | 3300032005 | Ga0307411_10122462 | Ga0307411_101224622 | 317 |
| 239 | 3300049588 | Ga0501072_0197665 | Ga0501072_0197665_307_1263 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9498 | 10 | 316 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9466 | 10 | 316 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9461 | 10 | 317 |
| 1n2x-assembly2.cif.gz_B | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9415 | 10 | 313 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9396 | 10 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n2xB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9504 | 10 | 313 | 3.40.50.150 |
| 1n2xB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9397 | 10 | 313 | 3.40.50.150 |
| 1wg8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9341 | 10 | 317 | 3.40.50.150 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9309 | 115 | 220 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9289 | 118 | 220 | 1.10.150.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L4Z1T6-F1-model_v4 | 16S rRNA (Cytosine1402-N4)-methyltransferase | 0.9777 | 204 | 317 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A6L4Z1T6-F1-model_v4 | 16S rRNA (Cytosine1402-N4)-methyltransferase | 0.9693 | 204 | 317 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A3D0V5H2-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9664 | 9 | 316 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A3M1SEM3-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9651 | 7 | 316 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A660WL32-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.963 | 10 | 316 |
GO:0005737
GO:0070475 GO:0071424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar