F351762

General Info

Members Datasets Scaffolds Average Seq Length
239 148 225 275

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000017|Ga0070665_100000017158
Length 325
Sequence MPRPPYFEPSPKESFGQYDTVALSYVYSSPIVTTTLLRDKNVIDYISIMMFIKNRSALYLLPFALIAASCSPKGPYAATNKFYKHHADSAMKVVQLEQPAMLVDSTGAQVPSEFVGTVNFNLRKPNYVIIHFTAQDSLGQTLHTFTIQQTQVSAHYVVGKDGKVVHMLNDYLRAWHAGVSRWGSISDMNSCSIGIEIDNNGNEPFTGPQIKSLLALLSYLKKTYNIPATNFIGHQDIAPLRKPDPGPYFPWKTLAQHGFGYWSDDILELAPENFDYTTALKLIGYDTRDISAAVVAFKRHFVQTDTKPQLTQLDLNVLYNVYQKY

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
13 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
133 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
144 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.48
Nodule 0
Rhizoplane 0.84
Rhizosphere 71.13
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011373 3300001989 Bacteria 3287
2 JGI24737J22298_10004383 3300001990 Bacteria 4927
3 JGI24735J21928_10000020 3300002067 Bacteria 108706
4 JGI25162J39368_1000400 3300002737 Bacteria 36323
5 JGI25162J39368_1001264 3300002737 Bacteria 14427
6 JGI25164J39214_1001131 3300002772 Bacteria 7583
7 JGI25165J46597_1000305 3300003214 Bacteria 61229
8 rootH1_10072837 3300003316 Bacteria 3050
9 rootH2_10003269 3300003320 Bacteria 51191
10 rootH2_10015381 3300003320 Bacteria 19009
11 rootH2_10145498 3300003320 Bacteria 1778
12 rootH2_10175870 3300003320 Bacteria 1500
13 rootL2_10019626 3300003322 Bacteria 8011
14 rootL2_10096122 3300003322 Bacteria 2376
15 rootL2_10116430 3300003322 Bacteria 5805
16 rootL2_10149872 3300003322 Bacteria 3644
17 rootH1_10006108 3300003323 Bacteria 45232
18 rootH1_10007907 3300003323 Bacteria 7854
19 rootH1_10047240 3300003323 Bacteria 8676
20 rootH1_10109850 3300003323 Bacteria 5304
21 rootH1_10128100 3300003323 Bacteria 1546
22 rootH1_10242805 3300003323 Bacteria 8320
23 Ga0055531_10000875 3300003794 Bacteria 24688
24 Ga0065714_10147750 3300005288 Bacteria 1096
25 Ga0065714_10151798 3300005288 Bacteria 1101
26 Ga0070658_10427426 3300005327 Bacteria 1140
27 Ga0070676_10000728 3300005328 Bacteria 16117
28 Ga0070683_100014426 3300005329 Bacteria 6912
29 Ga0068868_100139388 3300005338 Bacteria 1990
30 Ga0070673_100025094 3300005364 Bacteria 4381
31 Ga0070711_100311311 3300005439 Bacteria 1255
32 Ga0070678_100009181 3300005456 Bacteria 5974
33 Ga0068867_100002572 3300005459 Bacteria 12790
34 Ga0068853_100135701 3300005539 Bacteria 2206
35 Ga0070672_100327013 3300005543 Bacteria 1304
36 Ga0070665_100000017 3300005548 Bacteria 448013
37 Ga0070665_100342773 3300005548 Bacteria 1499
38 Ga0068855_100000074 3300005563 Bacteria 119759
39 Ga0068855_100003626 3300005563 Bacteria 18882
40 Ga0068855_100039561 3300005563 Bacteria 5599
41 Ga0068855_100068624 3300005563 Bacteria 4127
42 Ga0068855_100109244 3300005563 Bacteria 3177
43 Ga0068855_100224949 3300005563 Bacteria 2103
44 Ga0068856_100000030 3300005614 Bacteria 128494
45 Ga0068856_100053949 3300005614 Bacteria 3964
46 Ga0068856_100257324 3300005614 Bacteria 1761
47 Ga0068852_100008148 3300005616 Bacteria 7694
48 Ga0075366_10000112 3300006195 Bacteria 33220
49 Ga0075366_10005642 3300006195 Bacteria 6785
50 Ga0075366_10010756 3300006195 Bacteria 5144
51 Ga0097621_100002156 3300006237 Bacteria 13466
52 Ga0068871_100000491 3300006358 Bacteria 27057
53 Ga0068865_100000070 3300006881 Bacteria 53670
54 Ga0105240_10000083 3300009093 Bacteria 192934
55 Ga0105240_10054726 3300009093 Bacteria 4999
56 Ga0105240_10058776 3300009093 Bacteria 4799
57 Ga0105240_10136352 3300009093 Bacteria 2939
58 Ga0105240_10204787 3300009093 Bacteria 2310
59 Ga0105240_10344076 3300009093 Bacteria 1693
60 Ga0105245_10209168 3300009098 Bacteria 1877
61 Ga0105242_10043583 3300009176 Bacteria 3630
62 Ga0105237_10000198 3300009545 Bacteria 85302
63 Ga0105237_10001072 3300009545 Bacteria 36764
64 Ga0105237_10013450 3300009545 Bacteria 8582
65 Ga0105237_10018749 3300009545 Bacteria 7155
66 Ga0105237_10149364 3300009545 Bacteria 2333
67 Ga0105238_10004702 3300009551 Bacteria 13503
68 Ga0105238_10341136 3300009551 Bacteria 1486
69 Ga0105239_10000186 3300010375 Bacteria 90998
70 Ga0105239_10004713 3300010375 Bacteria 16192
71 Ga0105239_10008812 3300010375 Bacteria 11416
72 Ga0105239_10018902 3300010375 Bacteria 7613
73 Ga0105239_10031081 3300010375 Bacteria 5874
74 Ga0105239_10035336 3300010375 Bacteria 5488
75 Ga0105239_10745431 3300010375 Bacteria 1121
76 Ga0105246_10028212 3300011119 Bacteria 3686
77 Ga0157373_10000090 3300013100 Bacteria 78142
78 Ga0157373_10034010 3300013100 Bacteria 3662
79 Ga0157371_10003272 3300013102 Bacteria 14852
80 Ga0157370_10093692 3300013104 Bacteria 2818
81 Ga0157369_10000952 3300013105 Bacteria 36747
82 Ga0157374_10000858 3300013296 Bacteria 26614
83 Ga0157378_10145271 3300013297 Bacteria 2206
84 Ga0163162_10006984 3300013306 Bacteria 10951
85 Ga0163162_10009819 3300013306 Bacteria 9312
86 Ga0157372_10000077 3300013307 Bacteria 102192
87 Ga0157372_10008792 3300013307 Bacteria 10725
88 Ga0157372_10024608 3300013307 Bacteria 6544
89 Ga0157372_11076234 3300013307 Unclassified 930
90 Ga0157377_10171502 3300014745 Bacteria 1357
91 Ga0182005_1000098 3300015265 Bacteria 66185
92 Ga0163161_10159352 3300017792 Unclassified 1720
93 Ga0209436_103216 3300025208 Bacteria 4443
94 Ga0209563_106793 3300025230 Bacteria 1935
95 Ga0207427_100423 3300025231 Bacteria 23892
96 Ga0209437_100026 3300025233 Bacteria 542698
97 Ga0209437_100130 3300025233 Bacteria 183731
98 Ga0209233_1000206 3300025261 Bacteria 117820
99 Ga0209233_1015138 3300025261 Bacteria 2158
100 Ga0209257_1000001 3300025304 Bacteria 2274655
101 Ga0207647_10000961 3300025904 Bacteria 22327
102 Ga0207645_10000172 3300025907 Bacteria 51794
103 Ga0207705_10000111 3300025909 Bacteria 92842
104 Ga0207705_10074029 3300025909 Bacteria 2472
105 Ga0207654_10149136 3300025911 Bacteria 1499
106 Ga0207695_10000127 3300025913 Bacteria 227338
107 Ga0207695_10007163 3300025913 Bacteria 14274
108 Ga0207695_10025091 3300025913 Bacteria 6686
109 Ga0207695_10080526 3300025913 Bacteria 3297
110 Ga0207695_10133621 3300025913 Bacteria 2436
111 Ga0207671_10000254 3300025914 Bacteria 79974
112 Ga0207671_10003796 3300025914 Bacteria 14817
113 Ga0207671_10006795 3300025914 Bacteria 10109
114 Ga0207671_10007067 3300025914 Bacteria 9819
115 Ga0207671_10021928 3300025914 Bacteria 4838
116 Ga0207671_10124617 3300025914 Bacteria 1972
117 Ga0207671_10226594 3300025914 Bacteria 1465
118 Ga0207652_10357284 3300025921 Bacteria 1318
119 Ga0207694_10030009 3300025924 Bacteria 4152
120 Ga0207644_10172076 3300025931 Bacteria 1691
121 Ga0207706_10000662 3300025933 Bacteria 36264
122 Ga0207704_10000342 3300025938 Bacteria 21647
123 Ga0207691_10311126 3300025940 Bacteria 1352
124 Ga0207661_10013011 3300025944 Bacteria 6072
125 Ga0207667_10000014 3300025949 Bacteria 421261
126 Ga0207667_10004161 3300025949 Bacteria 17778
127 Ga0207667_10004605 3300025949 Bacteria 16909
128 Ga0207667_10061899 3300025949 Bacteria 3914
129 Ga0207667_10247713 3300025949 Bacteria 1823
130 Ga0207651_10022802 3300025960 Bacteria 3837
131 Ga0207677_10101804 3300026023 Bacteria 2116
132 Ga0207703_10369250 3300026035 Bacteria 1325
133 Ga0207678_10394276 3300026067 Bacteria 1198
134 Ga0207702_10000133 3300026078 Bacteria 88338
135 Ga0207702_10084859 3300026078 Bacteria 2758
136 Ga0207702_10218256 3300026078 Bacteria 1776
137 Ga0207648_10000658 3300026089 Bacteria 38677
138 Ga0207683_10008888 3300026121 Bacteria 8564
139 Ga0207698_10006801 3300026142 Bacteria 7151
140 Ga0268266_10000037 3300028379 Bacteria 342368
141 Ga0307517_10001388 3300028786 Bacteria 40654
142 Ga0307515_10029848 3300028794 Bacteria 9191
143 Ga0307515_10074717 3300028794 Bacteria 4528
144 Ga0307515_10218262 3300028794 Bacteria 1732
145 Ga0265338_10191210 3300028800 Bacteria 1551
146 Ga0307509_10216885 3300031507 Bacteria 1731
147 Ga0307412_10060468 3300031911 Bacteria 2543
148 Ga0307507_10000143 3300033179 Bacteria 124248
149 Ga0307510_10000419 3300033180 Bacteria 40732
150 Ga0395899_0000257 3300037312 Bacteria 69779
151 Ga0395899_0009567 3300037312 Bacteria 7440
152 Ga0395900_0000327 3300037418 Bacteria 70365
153 Ga0395900_0020423 3300037418 Bacteria 6762
154 Ga0395898_0208419 3300037466 Bacteria 1865
155 Ga0395905_0000671 3300037471 Bacteria 45503
156 Ga0395905_0303925 3300037471 Bacteria 1483
157 Ga0436361_1011184 3300039447 Bacteria 16427
158 Ga0466969_0133500 3300044656 Bacteria 1150
159 Ga0466961_0195210 3300044693 Bacteria 1253
160 Ga0466957_0081852 3300044842 Bacteria 2011
161 Ga0466957_0177271 3300044842 Bacteria 1391
162 Ga0466959_0059638 3300045049 Bacteria 2779
163 Ga0495651_0105022 3300046462 Bacteria 2096
164 Ga0495650_0000095 3300046471 Bacteria 218020
165 Ga0495585_0000459 3300046492 Bacteria 38959
166 Ga0495596_0014880 3300046500 Bacteria 3271
167 Ga0495606_0000009 3300046507 Bacteria 306313
168 Ga0495606_0006333 3300046507 Bacteria 10954
169 Ga0495606_0008253 3300046507 Bacteria 9089
170 Ga0495610_0070410 3300046512 Bacteria 1633
171 Ga0495616_0005563 3300046513 Bacteria 7733
172 Ga0495616_0014011 3300046513 Bacteria 4505
173 Ga0495631_0016001 3300046518 Bacteria 3583
174 Ga0495632_0036422 3300046519 Bacteria 2503
175 Ga0495632_0086400 3300046519 Bacteria 1492
176 Ga0495637_0033034 3300046520 Bacteria 2276
177 Ga0495637_0042297 3300046520 Bacteria 1950
178 Ga0495648_0001585 3300046524 Bacteria 22152
179 Ga0495652_0240006 3300046529 Bacteria 1349
180 Ga0495609_0001203 3300046538 Bacteria 17830
181 Ga0495633_0000175 3300046558 Bacteria 83653
182 Ga0495633_0002520 3300046558 Bacteria 12876
183 Ga0495668_0000121 3300046616 Bacteria 116234
184 Ga0495668_0126014 3300046616 Bacteria 1402
185 Ga0495625_0000007 3300046660 Bacteria 565749
186 Ga0495625_0001612 3300046660 Bacteria 26626
187 Ga0495625_0001789 3300046660 Bacteria 24694
188 Ga0495625_0013268 3300046660 Bacteria 6628
189 Ga0495625_0338696 3300046660 Bacteria 954
190 Ga0495661_0001645 3300046665 Bacteria 18216
191 Ga0495661_0003454 3300046665 Bacteria 11664
192 Ga0495661_0008455 3300046665 Bacteria 7117
193 Ga0495661_0124376 3300046665 Bacteria 1421
194 Ga0495658_0076911 3300046683 Bacteria 1951
195 Ga0495671_0199652 3300046692 Bacteria 970
196 Ga0495649_0000007 3300046694 Bacteria 518037
197 Ga0495636_0000003 3300047318 Bacteria 132818
198 Ga0495683_0047368 3300047323 Bacteria 2158
199 Ga0495687_000960 3300047443 Bacteria 29594
200 Ga0495687_001260 3300047443 Bacteria 23990
201 Ga0495686_0000152 3300047472 Bacteria 133713
202 Ga0495686_0085399 3300047472 Bacteria 1922
203 Ga0496114_0001150 3300048917 Bacteria 19981
204 Ga0501241_000382 3300049758 Bacteria 9698
205 Ga0501280_004238 3300049776 Unclassified 2122
206 nmdc:mga0k408_230_c2 3300050493 Bacteria 23722
207 nmdc:mga0k408_341741_c1 3300050493 Unclassified 892
208 nmdc:mga0k408_63_c1 3300050493 Bacteria 52809
209 nmdc:mga0k408_7416_c1 3300050493 Bacteria 5855
210 Ga0500635_0011574 3300053080 Bacteria 2511
211 Ga0500644_0000099 3300053088 Bacteria 54817
212 Ga0500646_0002067 3300053090 Bacteria 5236
213 Ga0500583_0065397 3300053092 Bacteria 1727
214 Ga0500651_0043812 3300053093 Bacteria 2818
215 Ga0500651_0093428 3300053093 Unclassified 1849
216 Ga0500569_000090 3300053109 Bacteria 14410
217 Ga0500608_008011 3300053122 Bacteria 4412
218 Ga0500618_012660 3300053125 Bacteria 2203
219 Ga0500658_0008154 3300053134 Bacteria 3874
220 Ga0500590_009326 3300053148 Bacteria 4935
221 Ga0500616_0006001 3300053153 Bacteria 8085
222 Ga0500622_0000291 3300053156 Bacteria 51275
223 Ga0500622_0001144 3300053156 Bacteria 22146
224 Ga0500624_000160 3300053157 Bacteria 27540
225 Ga0500636_0020445 3300053177 Bacteria 3921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100224949 Ga0068855_1002249492 235
2 3300025949 Ga0207667_10247713 Ga0207667_102477132 235
3 3300003320 rootH2_10145498 rootH2_101454982 245
4 iso_pu_bacteria 2929239360 2929240784 250
5 3300046558 Ga0495633_0000175 Ga0495633_0000175_19725_20552 251
6 3300053093 Ga0500651_0093428 Ga0500651_0093428_577_1404 251
7 3300015265 Ga0182005_1000098 Ga0182005_100009821 252
8 3300025208 Ga0209436_103216 Ga0209436_1032163 252
9 3300044842 Ga0466957_0081852 Ga0466957_0081852_870_1664 252
10 iso_pu_bacteria 2818991442 2819573182 252
11 iso_pu_bacteria 2821136567 2821136601 252
12 iso_pu_bacteria 2904467357 2904468654 252
13 3300046519 Ga0495632_0086400 Ga0495632_0086400_61_870 254
14 3300053088 Ga0500644_0000099 Ga0500644_0000099_42821_43630 254
15 3300053090 Ga0500646_0002067 Ga0500646_0002067_2178_2987 254
16 3300053092 Ga0500583_0065397 Ga0500583_0065397_52_861 254
17 3300053093 Ga0500651_0043812 Ga0500651_0043812_535_1344 254
18 3300053109 Ga0500569_000090 Ga0500569_000090_7608_8417 254
19 3300053134 Ga0500658_0008154 Ga0500658_0008154_824_1633 254
20 3300053148 Ga0500590_009326 Ga0500590_009326_176_985 254
21 3300053153 Ga0500616_0006001 Ga0500616_0006001_2293_3102 254
22 3300053177 Ga0500636_0020445 Ga0500636_0020445_1980_2789 254
23 3300003316 rootH1_10072837 rootH1_100728372 257
24 3300003322 rootL2_10116430 rootL2_101164301 257
25 3300003322 rootL2_10149872 rootL2_101498723 257
26 3300005563 Ga0068855_100000074 Ga0068855_10000007453 257
27 3300025949 Ga0207667_10000014 Ga0207667_1000001454 257
28 3300003320 rootH2_10175870 rootH2_101758701 259
29 3300003322 rootL2_10096122 rootL2_100961222 259
30 3300003794 Ga0055531_10000875 Ga0055531_1000087511 259
31 3300010375 Ga0105239_10031081 Ga0105239_100310814 259
32 3300013307 Ga0157372_11076234 Ga0157372_110762341 259
33 3300025304 Ga0209257_1000001 Ga0209257_10000011861 259
34 3300049758 Ga0501241_000382 Ga0501241_000382_59_886 259
35 3300050493 nmdc:mga0k408_341741_c1 nmdc:mga0k408_341741_c1_79_873 259
36 3300053156 Ga0500622_0001144 Ga0500622_0001144_5785_6621 259
37 iso_pu_bacteria 2896085136 2896089330 259
38 3300046507 Ga0495606_0008253 Ga0495606_0008253_1742_2572 260
39 3300017792 Ga0163161_10159352 Ga0163161_101593521 261
40 3300028794 Ga0307515_10218262 Ga0307515_102182622 261
41 3300037471 Ga0395905_0303925 Ga0395905_0303925_303_1115 261
42 3300046665 Ga0495661_0124376 Ga0495661_0124376_49_861 261
43 3300047318 Ga0495636_0000003 Ga0495636_0000003_44427_45239 261
44 3300048917 Ga0496114_0001150 Ga0496114_0001150_10859_11704 261
45 3300049776 Ga0501280_004238 Ga0501280_004238_455_1288 261
46 iso_pu_bacteria 2599185184 2599481210 262
47 iso_pu_bacteria 2928078545 2928081805 262
48 iso_pu_bacteria 2928147474 2928151832 262
49 3300046513 Ga0495616_0005563 Ga0495616_0005563_6314_7147 263
50 3300047472 Ga0495686_0085399 Ga0495686_0085399_800_1720 263
51 3300003320 rootH2_10015381 rootH2_1001538116 264
52 3300005563 Ga0068855_100068624 Ga0068855_1000686247 264
53 3300025909 Ga0207705_10000111 Ga0207705_1000011130 264
54 3300025949 Ga0207667_10061899 Ga0207667_100618996 264
55 3300046507 Ga0495606_0006333 Ga0495606_0006333_3491_4321 264
56 iso_pu_bacteria 2895498888 2895503201 264
57 iso_pu_bacteria 2977232053 2977234649 264
58 3300002737 JGI25162J39368_1000400 JGI25162J39368_10004004 265
59 3300002737 JGI25162J39368_1001264 JGI25162J39368_10012643 265
60 3300002772 JGI25164J39214_1001131 JGI25164J39214_10011312 265
61 3300003214 JGI25165J46597_1000305 JGI25165J46597_100030521 265
62 3300003320 rootH2_10003269 rootH2_1000326933 265
63 3300003322 rootL2_10019626 rootL2_100196265 265
64 3300003323 rootH1_10006108 rootH1_1000610812 265
65 3300003323 rootH1_10047240 rootH1_100472405 265
66 3300003323 rootH1_10109850 rootH1_101098501 265
67 3300003323 rootH1_10128100 rootH1_101281002 265
68 3300003323 rootH1_10242805 rootH1_102428054 265
69 3300005288 Ga0065714_10147750 Ga0065714_101477501 265
70 3300005288 Ga0065714_10151798 Ga0065714_101517981 265
71 3300005327 Ga0070658_10427426 Ga0070658_104274262 265
72 3300005328 Ga0070676_10000728 Ga0070676_100007281 265
73 3300005329 Ga0070683_100014426 Ga0070683_1000144266 265
74 3300005338 Ga0068868_100139388 Ga0068868_1001393882 265
75 3300005364 Ga0070673_100025094 Ga0070673_1000250942 265
76 3300005439 Ga0070711_100311311 Ga0070711_1003113111 265
77 3300005456 Ga0070678_100009181 Ga0070678_1000091812 265
78 3300005459 Ga0068867_100002572 Ga0068867_1000025727 265
79 3300005539 Ga0068853_100135701 Ga0068853_1001357012 265
80 3300005543 Ga0070672_100327013 Ga0070672_1003270132 265
81 3300005548 Ga0070665_100000017 Ga0070665_100000017158 265
82 3300005548 Ga0070665_100342773 Ga0070665_1003427732 265
83 3300005563 Ga0068855_100003626 Ga0068855_10000362617 265
84 3300005563 Ga0068855_100039561 Ga0068855_1000395616 265
85 3300005614 Ga0068856_100000030 Ga0068856_100000030116 265
86 3300005614 Ga0068856_100053949 Ga0068856_1000539494 265
87 3300005614 Ga0068856_100257324 Ga0068856_1002573242 265
88 3300005616 Ga0068852_100008148 Ga0068852_1000081482 265
89 3300006195 Ga0075366_10000112 Ga0075366_1000011225 265
90 3300006195 Ga0075366_10010756 Ga0075366_100107561 265
91 3300006237 Ga0097621_100002156 Ga0097621_1000021562 265
92 3300006358 Ga0068871_100000491 Ga0068871_10000049123 265
93 3300006881 Ga0068865_100000070 Ga0068865_1000000709 265
94 3300009093 Ga0105240_10000083 Ga0105240_10000083135 265
95 3300009093 Ga0105240_10054726 Ga0105240_100547262 265
96 3300009093 Ga0105240_10058776 Ga0105240_100587763 265
97 3300009093 Ga0105240_10136352 Ga0105240_101363522 265
98 3300009093 Ga0105240_10204787 Ga0105240_102047874 265
99 3300009093 Ga0105240_10344076 Ga0105240_103440763 265
100 3300009098 Ga0105245_10209168 Ga0105245_102091683 265
101 3300009176 Ga0105242_10043583 Ga0105242_100435832 265
102 3300009545 Ga0105237_10000198 Ga0105237_1000019867 265
103 3300009545 Ga0105237_10001072 Ga0105237_1000107240 265
104 3300009545 Ga0105237_10013450 Ga0105237_100134507 265
105 3300009545 Ga0105237_10018749 Ga0105237_100187494 265
106 3300009545 Ga0105237_10149364 Ga0105237_101493642 265
107 3300009551 Ga0105238_10004702 Ga0105238_100047022 265
108 3300009551 Ga0105238_10341136 Ga0105238_103411361 265
109 3300010375 Ga0105239_10000186 Ga0105239_100001868 265
110 3300010375 Ga0105239_10004713 Ga0105239_100047138 265
111 3300010375 Ga0105239_10008812 Ga0105239_100088122 265
112 3300010375 Ga0105239_10018902 Ga0105239_100189022 265
113 3300010375 Ga0105239_10035336 Ga0105239_100353363 265
114 3300010375 Ga0105239_10745431 Ga0105239_107454311 265
115 3300011119 Ga0105246_10028212 Ga0105246_100282124 265
116 3300013100 Ga0157373_10000090 Ga0157373_1000009021 265
117 3300013100 Ga0157373_10034010 Ga0157373_100340103 265
118 3300013102 Ga0157371_10003272 Ga0157371_1000327215 265
119 3300013104 Ga0157370_10093692 Ga0157370_100936921 265
120 3300013105 Ga0157369_10000952 Ga0157369_1000095212 265
121 3300013296 Ga0157374_10000858 Ga0157374_100008588 265
122 3300013297 Ga0157378_10145271 Ga0157378_101452712 265
123 3300013306 Ga0163162_10009819 Ga0163162_100098192 265
124 3300013307 Ga0157372_10000077 Ga0157372_1000007742 265
125 3300013307 Ga0157372_10008792 Ga0157372_100087927 265
126 3300014745 Ga0157377_10171502 Ga0157377_101715022 265
127 3300025230 Ga0209563_106793 Ga0209563_1067932 265
128 3300025231 Ga0207427_100423 Ga0207427_1004235 265
129 3300025233 Ga0209437_100026 Ga0209437_100026355 265
130 3300025233 Ga0209437_100026 Ga0209437_10002673 265
131 3300025233 Ga0209437_100130 Ga0209437_10013033 265
132 3300025261 Ga0209233_1000206 Ga0209233_100020654 265
133 3300025261 Ga0209233_1015138 Ga0209233_10151382 265
134 3300025904 Ga0207647_10000961 Ga0207647_1000096115 265
135 3300025907 Ga0207645_10000172 Ga0207645_100001721 265
136 3300025909 Ga0207705_10074029 Ga0207705_100740293 265
137 3300025911 Ga0207654_10149136 Ga0207654_101491362 265
138 3300025913 Ga0207695_10000127 Ga0207695_10000127135 265
139 3300025913 Ga0207695_10007163 Ga0207695_1000716312 265
140 3300025913 Ga0207695_10025091 Ga0207695_100250914 265
141 3300025913 Ga0207695_10080526 Ga0207695_100805262 265
142 3300025913 Ga0207695_10133621 Ga0207695_101336212 265
143 3300025914 Ga0207671_10000254 Ga0207671_1000025466 265
144 3300025914 Ga0207671_10003796 Ga0207671_1000379610 265
145 3300025914 Ga0207671_10006795 Ga0207671_100067952 265
146 3300025914 Ga0207671_10007067 Ga0207671_100070677 265
147 3300025914 Ga0207671_10021928 Ga0207671_100219283 265
148 3300025914 Ga0207671_10124617 Ga0207671_101246172 265
149 3300025914 Ga0207671_10226594 Ga0207671_102265942 265
150 3300025921 Ga0207652_10357284 Ga0207652_103572841 265
151 3300025924 Ga0207694_10030009 Ga0207694_100300092 265
152 3300025931 Ga0207644_10172076 Ga0207644_101720764 265
153 3300025933 Ga0207706_10000662 Ga0207706_1000066220 265
154 3300025938 Ga0207704_10000342 Ga0207704_100003429 265
155 3300025940 Ga0207691_10311126 Ga0207691_103111262 265
156 3300025944 Ga0207661_10013011 Ga0207661_100130114 265
157 3300025949 Ga0207667_10004161 Ga0207667_100041614 265
158 3300025949 Ga0207667_10004605 Ga0207667_1000460512 265
159 3300025960 Ga0207651_10022802 Ga0207651_100228022 265
160 3300026023 Ga0207677_10101804 Ga0207677_101018042 265
161 3300026035 Ga0207703_10369250 Ga0207703_103692501 265
162 3300026067 Ga0207678_10394276 Ga0207678_103942762 265
163 3300026078 Ga0207702_10000133 Ga0207702_1000013392 265
164 3300026078 Ga0207702_10084859 Ga0207702_100848592 265
165 3300026078 Ga0207702_10218256 Ga0207702_102182564 265
166 3300026089 Ga0207648_10000658 Ga0207648_100006583 265
167 3300026121 Ga0207683_10008888 Ga0207683_100088886 265
168 3300026142 Ga0207698_10006801 Ga0207698_100068015 265
169 3300028379 Ga0268266_10000037 Ga0268266_10000037158 265
170 3300028786 Ga0307517_10001388 Ga0307517_1000138821 265
171 3300028794 Ga0307515_10029848 Ga0307515_100298487 265
172 3300028794 Ga0307515_10074717 Ga0307515_100747172 265
173 3300028800 Ga0265338_10191210 Ga0265338_101912102 265
174 3300031507 Ga0307509_10216885 Ga0307509_102168852 265
175 3300031911 Ga0307412_10060468 Ga0307412_100604682 265
176 3300033179 Ga0307507_10000143 Ga0307507_1000014351 265
177 3300033180 Ga0307510_10000419 Ga0307510_1000041913 265
178 3300037312 Ga0395899_0000257 Ga0395899_0000257_29306_30127 265
179 3300037312 Ga0395899_0009567 Ga0395899_0009567_5635_6462 265
180 3300037418 Ga0395900_0000327 Ga0395900_0000327_23992_24813 265
181 3300037418 Ga0395900_0020423 Ga0395900_0020423_4891_5718 265
182 3300037466 Ga0395898_0208419 Ga0395898_0208419_217_1044 265
183 3300037471 Ga0395905_0000671 Ga0395905_0000671_27394_28221 265
184 3300039447 Ga0436361_1011184 Ga0436361_1011184_3560_4483 265
185 3300044656 Ga0466969_0133500 Ga0466969_0133500_17_838 265
186 3300044693 Ga0466961_0195210 Ga0466961_0195210_75_896 265
187 3300044842 Ga0466957_0177271 Ga0466957_0177271_201_1022 265
188 3300045049 Ga0466959_0059638 Ga0466959_0059638_227_1048 265
189 3300046462 Ga0495651_0105022 Ga0495651_0105022_1128_1955 265
190 3300046492 Ga0495585_0000459 Ga0495585_0000459_19039_19866 265
191 3300046500 Ga0495596_0014880 Ga0495596_0014880_2293_3117 265
192 3300046518 Ga0495631_0016001 Ga0495631_0016001_1955_2779 265
193 3300046519 Ga0495632_0036422 Ga0495632_0036422_240_1064 265
194 3300046524 Ga0495648_0001585 Ga0495648_0001585_17384_18211 265
195 3300046529 Ga0495652_0240006 Ga0495652_0240006_468_1295 265
196 3300046538 Ga0495609_0001203 Ga0495609_0001203_14675_15502 265
197 3300046616 Ga0495668_0000121 Ga0495668_0000121_84252_85079 265
198 3300046660 Ga0495625_0001612 Ga0495625_0001612_6704_7531 265
199 3300046660 Ga0495625_0001789 Ga0495625_0001789_4138_4965 265
200 3300046660 Ga0495625_0013268 Ga0495625_0013268_2448_3275 265
201 3300046660 Ga0495625_0338696 Ga0495625_0338696_82_906 265
202 3300046665 Ga0495661_0001645 Ga0495661_0001645_7092_7922 265
203 3300046665 Ga0495661_0008455 Ga0495661_0008455_2525_3355 265
204 3300046683 Ga0495658_0076911 Ga0495658_0076911_489_1316 265
205 3300046692 Ga0495671_0199652 Ga0495671_0199652_111_944 265
206 3300047443 Ga0495687_001260 Ga0495687_001260_746_1576 265
207 3300047472 Ga0495686_0000152 Ga0495686_0000152_71246_72070 265
208 3300050493 nmdc:mga0k408_230_c2 nmdc:mga0k408_230_c2_5940_6767 265
209 3300050493 nmdc:mga0k408_63_c1 nmdc:mga0k408_63_c1_29791_30618 265
210 3300053080 Ga0500635_0011574 Ga0500635_0011574_1649_2473 265
211 3300053122 Ga0500608_008011 Ga0500608_008011_1185_2012 265
212 3300053156 Ga0500622_0000291 Ga0500622_0000291_46379_47206 265
213 3300053157 Ga0500624_000160 Ga0500624_000160_17605_18429 265
214 iso_pu_bacteria 2852623160 2852626222 265
215 iso_pu_bacteria 2884933994 2884935234 265
216 iso_pu_bacteria 2919437846 2919439632 265
217 3300001989 JGI24739J22299_10011373 JGI24739J22299_100113732 266
218 3300001990 JGI24737J22298_10004383 JGI24737J22298_100043833 266
219 3300002067 JGI24735J21928_10000020 JGI24735J21928_100000209 266
220 3300003323 rootH1_10007907 rootH1_100079073 266
221 3300005563 Ga0068855_100109244 Ga0068855_1001092442 266
222 3300006195 Ga0075366_10005642 Ga0075366_100056426 266
223 3300013306 Ga0163162_10006984 Ga0163162_100069843 266
224 3300013307 Ga0157372_10024608 Ga0157372_100246083 266
225 3300046471 Ga0495650_0000095 Ga0495650_0000095_48883_49713 266
226 3300046507 Ga0495606_0000009 Ga0495606_0000009_199937_200767 266
227 3300046512 Ga0495610_0070410 Ga0495610_0070410_632_1456 266
228 3300046513 Ga0495616_0014011 Ga0495616_0014011_2520_3350 266
229 3300046520 Ga0495637_0033034 Ga0495637_0033034_430_1308 266
230 3300046520 Ga0495637_0042297 Ga0495637_0042297_713_1597 266
231 3300046558 Ga0495633_0002520 Ga0495633_0002520_7362_8186 266
232 3300046616 Ga0495668_0126014 Ga0495668_0126014_56_880 266
233 3300046660 Ga0495625_0000007 Ga0495625_0000007_131746_132576 266
234 3300046665 Ga0495661_0003454 Ga0495661_0003454_264_1088 266
235 3300046694 Ga0495649_0000007 Ga0495649_0000007_302840_303670 266
236 3300047323 Ga0495683_0047368 Ga0495683_0047368_455_1279 266
237 3300047443 Ga0495687_000960 Ga0495687_000960_1165_2046 266
238 3300050493 nmdc:mga0k408_7416_c1 nmdc:mga0k408_7416_c1_3199_3999 266
239 3300053125 Ga0500618_012660 Ga0500618_012660_423_1307 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

121

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bxj-assembly1.cif.gz_A-2 crystal structure of ampdh3 from pseudomonas aeruginosa 0.7471 64 266
4bol-assembly1.cif.gz_A crystal structure of ampdh2 from pseudomonas aeruginosa in complex with pentapeptide 0.7191 62 262
4bxe-assembly1.cif.gz_A crystal structure of ampdh3 from pseudomonas aeruginosa in complex with anhydromuramic pentapeptide 0.714 64 266
3d2y-assembly1.cif.gz_A complex of the n-acetylmuramyl-l-alanine amidase amid from e.coli with the substrate anhydro-n-acetylmuramic acid-l-ala-d-gamma-glu-l-lys 0.6512 43 266
6dcz-assembly1.cif.gz_A the n-terminal domain of pa endonuclease from the influenza h1n1 virus in complex with 3-hydroxy-4-oxo-4h-pyran-2-carboxylic acid 0.6225 67 107
ID Description Score Start End Superfamily
af_P75820_193_276_1.10.101.10 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.7453 202 266 1.10.101.10
af_Q0WVZ1_60_299_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6469 129 177 3.60.21.10
4bxjB02 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.6443 192 266 1.10.101.10
4bxeB02 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.6362 192 266 1.10.101.10
af_Q8BKF1_910_1095_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.6099 15 54 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A3C0B2T5-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9903 211 266
AF-A0A3C0B2T5-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9566 211 266
AF-A0A7L4TCT0-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9497 191 266
AF-A0A7L4TCT0-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9262 191 266
AF-A0A349QVB6-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9078 182 266

Feature Viewer

pLDDT pTM Quality
72.82 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map