F351513

General Info

Members Datasets Scaffolds Average Seq Length
239 142 478 123

Family's Representative Sequence

Representative Sequence 2162886012|MBSR1b_contig_1211762|MBSR1b_0102.00003840
Length 140
Sequence LSASAQKLNRSTPQQLVTSFLAALPHQIPFRAASCVLRRDDKSIEGTYLVTADEPLPFDVMLVEAMAQFAGALALEPGRPGMLTGIDGCQVDRLPVAGDVVRIVVTLDASFGGVHRFSGSGSIDGVEVVSGRFYLADAQA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 17.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1211762 2162886012 Unclassified 1338
2 Ga0070683_100000042 3300005329 Bacteria 115507
3 Ga0070683_100994768 3300005329 Bacteria 805
4 Ga0070683_101447273 3300005329 Bacteria 660
5 Ga0070690_100198409 3300005330 Unclassified 1395
6 Ga0070670_100000311 3300005331 Bacteria 41777
7 Ga0070670_100225496 3300005331 Bacteria 1630
8 Ga0070677_10032374 3300005333 Bacteria 2005
9 Ga0068869_100005177 3300005334 Bacteria 8185
10 Ga0068869_100021310 3300005334 Bacteria 4457
11 Ga0070680_100003549 3300005336 Bacteria 11633
12 Ga0070682_100000033 3300005337 Bacteria 154740
13 Ga0070682_100125050 3300005337 Bacteria 1732
14 Ga0068868_100000318 3300005338 Bacteria 32344
15 Ga0068868_100006370 3300005338 Bacteria 8348
16 Ga0068868_101556097 3300005338 Bacteria 620
17 Ga0070689_100000833 3300005340 Bacteria 19089
18 Ga0070689_100510176 3300005340 Bacteria 1031
19 Ga0070689_101176975 3300005340 Bacteria 687
20 Ga0070689_101222166 3300005340 Bacteria 675
21 Ga0070687_100156997 3300005343 Bacteria 1341
22 Ga0070661_100500710 3300005344 Bacteria 972
23 Ga0070692_10004028 3300005345 Bacteria 6070
24 Ga0070692_10975670 3300005345 Bacteria 591
25 Ga0070671_100213885 3300005355 Bacteria 1635
26 Ga0070673_100733768 3300005364 Unclassified 909
27 Ga0070673_101411559 3300005364 Bacteria 655
28 Ga0070673_101596567 3300005364 Bacteria 616
29 Ga0070703_10181969 3300005406 Bacteria 812
30 Ga0070709_10577851 3300005434 Bacteria 863
31 Ga0070709_11220671 3300005434 Bacteria 605
32 Ga0070713_100004254 3300005436 Bacteria 9572
33 Ga0070713_101240535 3300005436 Unclassified 722
34 Ga0070700_100000187 3300005441 Bacteria 35371
35 Ga0070708_100006042 3300005445 Bacteria 9627
36 Ga0070708_100274247 3300005445 Bacteria 1587
37 Ga0070678_100587409 3300005456 Bacteria 993
38 Ga0068867_100494069 3300005459 Bacteria 1051
39 Ga0068867_101377014 3300005459 Unclassified 653
40 Ga0068867_102351543 3300005459 Bacteria 507
41 Ga0070685_10064393 3300005466 Bacteria 2155
42 Ga0070706_100011844 3300005467 Bacteria 8095
43 Ga0070706_100016013 3300005467 Bacteria 6925
44 Ga0070706_100154879 3300005467 Bacteria 2139
45 Ga0070707_100036372 3300005468 Bacteria 4698
46 Ga0070707_100121777 3300005468 Unclassified 2533
47 Ga0070707_100391773 3300005468 Unclassified 1349
48 Ga0070707_100420951 3300005468 Bacteria 1296
49 Ga0070707_100627087 3300005468 Bacteria 1038
50 Ga0070698_100052149 3300005471 Bacteria 4163
51 Ga0070698_100564656 3300005471 Bacteria 1078
52 Ga0070699_100257899 3300005518 Unclassified 1559
53 Ga0070699_100480646 3300005518 Unclassified 1127
54 Ga0070684_100000303 3300005535 Bacteria 34159
55 Ga0070697_100085964 3300005536 Bacteria 2595
56 Ga0070697_100418246 3300005536 Bacteria 1165
57 Ga0070697_100435537 3300005536 Bacteria 1140
58 Ga0068853_100145912 3300005539 Bacteria 2127
59 Ga0068853_101172324 3300005539 Unclassified 741
60 Ga0068853_102305970 3300005539 Bacteria 521
61 Ga0070672_100001309 3300005543 Bacteria 15351
62 Ga0070672_101040900 3300005543 Unclassified 726
63 Ga0070686_100219905 3300005544 Unclassified 1372
64 Ga0070686_100796252 3300005544 Bacteria 761
65 Ga0070696_100131822 3300005546 Bacteria 1819
66 Ga0070696_101136789 3300005546 Bacteria 658
67 Ga0070693_100049874 3300005547 Bacteria 2390
68 Ga0070693_100600385 3300005547 Bacteria 794
69 Ga0070704_100408525 3300005549 Bacteria 1160
70 Ga0070664_101189521 3300005564 Bacteria 719
71 Ga0068857_100008384 3300005577 Bacteria 8932
72 Ga0068854_100006101 3300005578 Bacteria 7644
73 Ga0068854_100217632 3300005578 Bacteria 1509
74 Ga0070702_100001405 3300005615 Bacteria 9832
75 Ga0070702_100160414 3300005615 Bacteria 1453
76 Ga0070702_100463114 3300005615 Bacteria 922
77 Ga0068852_100669152 3300005616 Bacteria 1047
78 Ga0068859_100539503 3300005617 Bacteria 1261
79 Ga0068859_100716054 3300005617 Bacteria 1091
80 Ga0068864_100000007 3300005618 Bacteria 392187
81 Ga0068861_100063627 3300005719 Bacteria 2836
82 Ga0068861_100973536 3300005719 Unclassified 808
83 Ga0068851_10267338 3300005834 Bacteria 974
84 Ga0068858_100002729 3300005842 Bacteria 17768
85 Ga0070717_10000552 3300006028 Bacteria 23739
86 Ga0070716_100038770 3300006173 Bacteria 2640
87 Ga0097621_100238543 3300006237 Bacteria 1589
88 Ga0068871_101762408 3300006358 Bacteria 588
89 Ga0075431_100008462 3300006847 Bacteria 10303
90 Ga0075434_100183690 3300006871 Bacteria 2112
91 Ga0075434_100428150 3300006871 Unclassified 1344
92 Ga0075429_100140961 3300006880 Bacteria 2110
93 Ga0075429_100382030 3300006880 Bacteria 1233
94 Ga0075436_100004833 3300006914 Bacteria 9264
95 Ga0097620_100539629 3300006931 Bacteria 1261
96 Ga0097620_100715974 3300006931 Bacteria 1091
97 Ga0075435_100000240 3300007076 Bacteria 33766
98 Ga0075435_100005592 3300007076 Bacteria 8800
99 Ga0075435_100203188 3300007076 Bacteria 1679
100 Ga0105240_10067305 3300009093 Bacteria 4440
101 Ga0111539_10000004 3300009094 Bacteria 751278
102 Ga0105245_10000035 3300009098 Bacteria 147165
103 Ga0105245_10000496 3300009098 Bacteria 36130
104 Ga0105245_10005101 3300009098 Bacteria 11548
105 Ga0105245_10021156 3300009098 Bacteria 5704
106 Ga0105245_11649704 3300009098 Unclassified 693
107 Ga0114129_11647972 3300009147 Bacteria 784
108 Ga0105243_10402369 3300009148 Bacteria 1272
109 Ga0105242_10000933 3300009176 Bacteria 22770
110 Ga0105242_11202488 3300009176 Unclassified 777
111 Ga0105242_12361795 3300009176 Unclassified 579
112 Ga0105238_10000008 3300009551 Bacteria 307196
113 Ga0105239_11057483 3300010375 Unclassified 934
114 Ga0157369_10000146 3300013105 Bacteria 100176
115 Ga0157369_10449129 3300013105 Bacteria 1335
116 Ga0157374_10000008 3300013296 Bacteria 588863
117 Ga0157378_10001713 3300013297 Bacteria 19722
118 Ga0157378_10002039 3300013297 Bacteria 18100
119 Ga0157378_10028594 3300013297 Bacteria 4920
120 Ga0157378_12046949 3300013297 Bacteria 623
121 Ga0157378_13236377 3300013297 Bacteria 506
122 Ga0163162_10174046 3300013306 Bacteria 2277
123 Ga0157375_10000003 3300013308 Bacteria 476325
124 Ga0157375_10000164 3300013308 Bacteria 62161
125 Ga0157375_10003294 3300013308 Bacteria 13982
126 Ga0163163_10195015 3300014325 Bacteria 2073
127 Ga0157380_10007403 3300014326 Bacteria 7793
128 Ga0157377_10000042 3300014745 Bacteria 106623
129 Ga0157377_10000146 3300014745 Bacteria 44456
130 Ga0157379_10481841 3300014968 Unclassified 1148
131 Ga0157376_10000002 3300014969 Bacteria 684532
132 Ga0213873_10000001 3300021358 Bacteria 1657979
133 Ga0213874_10045500 3300021377 Bacteria 1329
134 Ga0213876_10000002 3300021384 Bacteria 1168769
135 Ga0213876_10000429 3300021384 Bacteria 34730
136 Ga0213876_10026003 3300021384 Bacteria 3087
137 Ga0213876_10125092 3300021384 Unclassified 1365
138 Ga0207682_10140018 3300025893 Bacteria 1085
139 Ga0207699_10102507 3300025906 Bacteria 1819
140 Ga0207643_10127944 3300025908 Unclassified 1509
141 Ga0207684_10130421 3300025910 Bacteria 2158
142 Ga0207695_10039908 3300025913 Bacteria 5041
143 Ga0207660_10004998 3300025917 Bacteria 8646
144 Ga0207662_10169415 3300025918 Unclassified 1400
145 Ga0207662_10365860 3300025918 Bacteria 971
146 Ga0207649_10444583 3300025920 Bacteria 977
147 Ga0207646_11089795 3300025922 Bacteria 703
148 Ga0207694_10000001 3300025924 Bacteria 4078485
149 Ga0207650_10716506 3300025925 Bacteria 846
150 Ga0207650_11012639 3300025925 Unclassified 707
151 Ga0207687_10000009 3300025927 Bacteria 443946
152 Ga0207687_10002854 3300025927 Bacteria 11734
153 Ga0207687_10003446 3300025927 Bacteria 10659
154 Ga0207687_10194406 3300025927 Bacteria 1581
155 Ga0207687_11199087 3300025927 Bacteria 652
156 Ga0207687_11938505 3300025927 Unclassified 503
157 Ga0207700_10003447 3300025928 Bacteria 9201
158 Ga0207700_10566788 3300025928 Bacteria 1009
159 Ga0207644_10970355 3300025931 Bacteria 713
160 Ga0207686_10030085 3300025934 Bacteria 3211
161 Ga0207670_10001301 3300025936 Bacteria 13173
162 Ga0207670_10421486 3300025936 Bacteria 1071
163 Ga0207669_10188961 3300025937 Unclassified 1484
164 Ga0207704_10077133 3300025938 Bacteria 2138
165 Ga0207665_10051160 3300025939 Bacteria 2780
166 Ga0207665_10120747 3300025939 Unclassified 1851
167 Ga0207691_10003450 3300025940 Bacteria 15379
168 Ga0207689_10002638 3300025942 Bacteria 16607
169 Ga0207689_10020524 3300025942 Bacteria 5559
170 Ga0207661_10000002 3300025944 Bacteria 816104
171 Ga0207661_11383274 3300025944 Bacteria 646
172 Ga0207679_10334166 3300025945 Bacteria 1316
173 Ga0207651_10599994 3300025960 Unclassified 962
174 Ga0207640_10007490 3300025981 Bacteria 6030
175 Ga0207640_10025854 3300025981 Bacteria 3559
176 Ga0207677_10000001 3300026023 Bacteria 534789
177 Ga0207677_10000067 3300026023 Bacteria 87739
178 Ga0207703_10000329 3300026035 Bacteria 51667
179 Ga0207639_10000028 3300026041 Bacteria 197736
180 Ga0207639_10367591 3300026041 Bacteria 1289
181 Ga0207708_10000035 3300026075 Bacteria 140227
182 Ga0207648_10435270 3300026089 Unclassified 1192
183 Ga0207648_10680921 3300026089 Bacteria 952
184 Ga0207648_11730366 3300026089 Unclassified 587
185 Ga0207676_10000015 3300026095 Bacteria 329100
186 Ga0207676_11080396 3300026095 Bacteria 793
187 Ga0207674_10013876 3300026116 Bacteria 8913
188 Ga0207675_100049286 3300026118 Bacteria 3931
189 Ga0207675_101296204 3300026118 Unclassified 749
190 Ga0207683_10249817 3300026121 Unclassified 1619
191 Ga0207698_10496433 3300026142 Bacteria 1187
192 Ga0207428_10000006 3300027907 Bacteria 491716
193 Ga0307511_10000789 3300030521 Bacteria 33817
194 Ga0307408_101372256 3300031548 Unclassified 664
195 Ga0307416_100406256 3300032002 Bacteria 1401
196 Ga0307416_101574841 3300032002 Unclassified 762
197 Ga0307416_102579620 3300032002 Unclassified 606
198 Ga0373932_0000033 3300035112 Bacteria 36976
199 Ga0373941_0073810 3300035115 Bacteria 1138
200 Ga0373947_0400849 3300035725 Bacteria 925
201 Ga0436365_0070365 3300039437 Bacteria 7581
202 Ga0436365_0298762 3300039437 Bacteria 35550
203 Ga0436365_0483088 3300039437 Bacteria 7740
204 Ga0436365_0906921 3300039437 Unclassified 615
205 Ga0436365_1183419 3300039437 Bacteria 72863
206 Ga0436363_1680496 3300039450 Bacteria 1996
207 Ga0436363_1702008 3300039450 Bacteria 1504
208 Ga0436362_0842419 3300039453 Bacteria 317447
209 Ga0436362_1044383 3300039453 Bacteria 8764
210 Ga0451839_0053233 3300041496 Bacteria 2115
211 Ga0451577_0219923 3300042876 Bacteria 1717
212 Ga0451577_0487235 3300042876 Archaea 1120
213 Ga0451577_0564585 3300042876 Unclassified 1033
214 Ga0451577_0789413 3300042876 Unclassified 858
215 Ga0453683_0095313 3300044673 Bacteria 1867
216 Ga0453683_0509516 3300044673 Bacteria 781
217 Ga0453683_0573954 3300044673 Unclassified 735
218 Ga0466964_0245558 3300044706 Bacteria 880
219 Ga0466960_0160911 3300044901 Unclassified 1205
220 Ga0451576_0197298 3300045051 Bacteria 2103
221 Ga0451576_0395258 3300045051 Bacteria 1449
222 Ga0495620_0016084 3300046515 Bacteria 3764
223 Ga0495630_1051506 3300046517 Unclassified 618
224 Ga0496106_0151002 3300048909 Bacteria 1832
225 Ga0496112_0879530 3300048915 Bacteria 819
226 Ga0501073_0006142 3300049589 Bacteria 8965
227 Ga0501074_0375921 3300049590 Unclassified 1008
228 Ga0501080_0063997 3300049742 Unclassified 3422
229 Ga0501083_0715013 3300049744 Bacteria 651
230 nmdc:mga09592_53698_c1 3300050508 Bacteria 3403
231 nmdc:mga06r32_2418_c1 3300050510 Bacteria 16704
232 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
233 nmdc:mga0rr50_3199_c1 3300050513 Bacteria 9368
234 nmdc:mga0rr50_32752_c1 3300050513 Bacteria 3707
235 nmdc:mga0rr50_44_c1 3300050513 Bacteria 75700
236 nmdc:mga08x19_1589_c1 3300050514 Bacteria 14092
237 nmdc:mga08x19_688453_c1 3300050514 Bacteria 725
238 Ga0495655_0000203 3300053083 Bacteria 11271
239 Ga0501084_0310096 3300054114 Unclassified 1333
240 MBSR1b_contig_1211762
241 Ga0070683_100000042
242 Ga0070683_100994768
243 Ga0070683_101447273
244 Ga0070690_100198409
245 Ga0070670_100000311
246 Ga0070670_100225496
247 Ga0070677_10032374
248 Ga0068869_100005177
249 Ga0068869_100021310
250 Ga0070680_100003549
251 Ga0070682_100000033
252 Ga0070682_100125050
253 Ga0068868_100000318
254 Ga0068868_100006370
255 Ga0068868_101556097
256 Ga0070689_100000833
257 Ga0070689_100510176
258 Ga0070689_101176975
259 Ga0070689_101222166
260 Ga0070687_100156997
261 Ga0070661_100500710
262 Ga0070692_10004028
263 Ga0070692_10975670
264 Ga0070671_100213885
265 Ga0070673_100733768
266 Ga0070673_101411559
267 Ga0070673_101596567
268 Ga0070703_10181969
269 Ga0070709_10577851
270 Ga0070709_11220671
271 Ga0070713_100004254
272 Ga0070713_101240535
273 Ga0070700_100000187
274 Ga0070708_100006042
275 Ga0070708_100274247
276 Ga0070678_100587409
277 Ga0068867_100494069
278 Ga0068867_101377014
279 Ga0068867_102351543
280 Ga0070685_10064393
281 Ga0070706_100011844
282 Ga0070706_100016013
283 Ga0070706_100154879
284 Ga0070707_100036372
285 Ga0070707_100121777
286 Ga0070707_100391773
287 Ga0070707_100420951
288 Ga0070707_100627087
289 Ga0070698_100052149
290 Ga0070698_100564656
291 Ga0070699_100257899
292 Ga0070699_100480646
293 Ga0070684_100000303
294 Ga0070697_100085964
295 Ga0070697_100418246
296 Ga0070697_100435537
297 Ga0068853_100145912
298 Ga0068853_101172324
299 Ga0068853_102305970
300 Ga0070672_100001309
301 Ga0070672_101040900
302 Ga0070686_100219905
303 Ga0070686_100796252
304 Ga0070696_100131822
305 Ga0070696_101136789
306 Ga0070693_100049874
307 Ga0070693_100600385
308 Ga0070704_100408525
309 Ga0070664_101189521
310 Ga0068857_100008384
311 Ga0068854_100006101
312 Ga0068854_100217632
313 Ga0070702_100001405
314 Ga0070702_100160414
315 Ga0070702_100463114
316 Ga0068852_100669152
317 Ga0068859_100539503
318 Ga0068859_100716054
319 Ga0068864_100000007
320 Ga0068861_100063627
321 Ga0068861_100973536
322 Ga0068851_10267338
323 Ga0068858_100002729
324 Ga0070717_10000552
325 Ga0070716_100038770
326 Ga0097621_100238543
327 Ga0068871_101762408
328 Ga0075431_100008462
329 Ga0075434_100183690
330 Ga0075434_100428150
331 Ga0075429_100140961
332 Ga0075429_100382030
333 Ga0075436_100004833
334 Ga0097620_100539629
335 Ga0097620_100715974
336 Ga0075435_100000240
337 Ga0075435_100005592
338 Ga0075435_100203188
339 Ga0105240_10067305
340 Ga0111539_10000004
341 Ga0105245_10000035
342 Ga0105245_10000496
343 Ga0105245_10005101
344 Ga0105245_10021156
345 Ga0105245_11649704
346 Ga0114129_11647972
347 Ga0105243_10402369
348 Ga0105242_10000933
349 Ga0105242_11202488
350 Ga0105242_12361795
351 Ga0105238_10000008
352 Ga0105239_11057483
353 Ga0157369_10000146
354 Ga0157369_10449129
355 Ga0157374_10000008
356 Ga0157378_10001713
357 Ga0157378_10002039
358 Ga0157378_10028594
359 Ga0157378_12046949
360 Ga0157378_13236377
361 Ga0163162_10174046
362 Ga0157375_10000003
363 Ga0157375_10000164
364 Ga0157375_10003294
365 Ga0163163_10195015
366 Ga0157380_10007403
367 Ga0157377_10000042
368 Ga0157377_10000146
369 Ga0157379_10481841
370 Ga0157376_10000002
371 Ga0213873_10000001
372 Ga0213874_10045500
373 Ga0213876_10000002
374 Ga0213876_10000429
375 Ga0213876_10026003
376 Ga0213876_10125092
377 Ga0207682_10140018
378 Ga0207699_10102507
379 Ga0207643_10127944
380 Ga0207684_10130421
381 Ga0207695_10039908
382 Ga0207660_10004998
383 Ga0207662_10169415
384 Ga0207662_10365860
385 Ga0207649_10444583
386 Ga0207646_11089795
387 Ga0207694_10000001
388 Ga0207650_10716506
389 Ga0207650_11012639
390 Ga0207687_10000009
391 Ga0207687_10002854
392 Ga0207687_10003446
393 Ga0207687_10194406
394 Ga0207687_11199087
395 Ga0207687_11938505
396 Ga0207700_10003447
397 Ga0207700_10566788
398 Ga0207644_10970355
399 Ga0207686_10030085
400 Ga0207670_10001301
401 Ga0207670_10421486
402 Ga0207669_10188961
403 Ga0207704_10077133
404 Ga0207665_10051160
405 Ga0207665_10120747
406 Ga0207691_10003450
407 Ga0207689_10002638
408 Ga0207689_10020524
409 Ga0207661_10000002
410 Ga0207661_11383274
411 Ga0207679_10334166
412 Ga0207651_10599994
413 Ga0207640_10007490
414 Ga0207640_10025854
415 Ga0207677_10000001
416 Ga0207677_10000067
417 Ga0207703_10000329
418 Ga0207639_10000028
419 Ga0207639_10367591
420 Ga0207708_10000035
421 Ga0207648_10435270
422 Ga0207648_10680921
423 Ga0207648_11730366
424 Ga0207676_10000015
425 Ga0207676_11080396
426 Ga0207674_10013876
427 Ga0207675_100049286
428 Ga0207675_101296204
429 Ga0207683_10249817
430 Ga0207698_10496433
431 Ga0207428_10000006
432 Ga0307511_10000789
433 Ga0307408_101372256
434 Ga0307416_100406256
435 Ga0307416_101574841
436 Ga0307416_102579620
437 Ga0373932_0000033
438 Ga0373941_0073810
439 Ga0373947_0400849
440 Ga0436365_0070365
441 Ga0436365_0298762
442 Ga0436365_0483088
443 Ga0436365_0906921
444 Ga0436365_1183419
445 Ga0436363_1680496
446 Ga0436363_1702008
447 Ga0436362_0842419
448 Ga0436362_1044383
449 Ga0451839_0053233
450 Ga0451577_0219923
451 Ga0451577_0487235
452 Ga0451577_0564585
453 Ga0451577_0789413
454 Ga0453683_0095313
455 Ga0453683_0509516
456 Ga0453683_0573954
457 Ga0466964_0245558
458 Ga0466960_0160911
459 Ga0451576_0197298
460 Ga0451576_0395258
461 Ga0495620_0016084
462 Ga0495630_1051506
463 Ga0496106_0151002
464 Ga0496112_0879530
465 Ga0501073_0006142
466 Ga0501074_0375921
467 Ga0501080_0063997
468 Ga0501083_0715013
469 nmdc:mga09592_53698_c1
470 nmdc:mga06r32_2418_c1
471 nmdc:mga08y16_5_c1
472 nmdc:mga0rr50_3199_c1
473 nmdc:mga0rr50_32752_c1
474 nmdc:mga0rr50_44_c1
475 nmdc:mga08x19_1589_c1
476 nmdc:mga08x19_688453_c1
477 Ga0495655_0000203
478 Ga0501084_0310096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xmg-assembly1.cif.gz_A crystal structure of nitrophorin 7 from rhodnius prolixus at ph 7.8 complexed with imidazole 0.89 101 136
6n3p-assembly1.cif.gz_A crosslinked acpp=fabz complex from e. coli type ii fas 0.8894 17 139
5m6k-assembly1.cif.gz_A crystal structure of nitrophorin 7 e27v mutant from rhodnius prolixus with imidazole 0.8894 101 136
4i83-assembly1.cif.gz_F crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18 0.889 18 137
1z6b-assembly4.cif.gz_C crystal structure of plasmodium falciparum fabz at 2.1 a 0.8863 17 136
ID Description Score Start End Superfamily
af_K7L5F2_57_205_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.89 17 136 3.10.129.10
4xmhA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8865 101 136 2.40.128.20
1zhgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8839 24 138 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8806 18 140 3.10.129.10
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8783 17 136 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V7Y0X2-F1-model_v4 Uncharacterized protein 0.9227 20 138
AF-A0A522UCY6-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9218 32 140 GO:0016829
AF-A0A2A5SG72-F1-model_v4 deleted 0.9215 32 139
AF-A0A4P5X1H5-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9209 32 137 GO:0016829
AF-A0A519TMC5-F1-model_v4 3-hydroxyacyl-ACP dehydratase 0.9205 32 140

Map