F351211

General Info

Members Datasets Scaffolds Average Seq Length
238 154 476 169

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0121753|Ga0466963_0121753_537_1121
Length 194
Sequence VSKASAVLAVVTSFLAMEAQMSGLVNALMIAAVVVLVIVRQFRAQRIGTGRRWWLVPVVLAVVALREPGIVDAHHRTESIALLGVELLIGLATGAGWAWTTRVWAEPDGAVWSKSTKASVTVWIIGIALRVGLFALGSALGVHQDSSALLVALAATLLLRGGILVWRAQSVTPAVSAATAYGDPMVRPTRKERV

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
10 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
11 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
12 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
17 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
21 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
25 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
26 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
32 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
33 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
41 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
53 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
54 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
55 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
66 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
79 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
124 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
125 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
126 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
129 2643221647 Streptomyces sp. Root369 Isolate Unclassified
130 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
131 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
132 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
133 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
134 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
135 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
136 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
137 2867428634 Streptomyces sp. RP5T Isolate Unclassified
138 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
139 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
140 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
141 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
142 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
143 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
144 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
145 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
146 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
147 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
148 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
149 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
150 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
151 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
152 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
153 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
154 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.66
Metatranscriptomes 0
Isolates 11.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.04
Nodule 0
Rhizoplane 1.26
Rhizosphere 81.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0121753 3300044694 Bacteria 1796
2 JGI24737J22298_10110813 3300001990 Bacteria 812
3 rootH1_10032664 3300003316 Bacteria 3656
4 Ga0068855_101039135 3300005563 Bacteria 859
5 Ga0081455_10121638 3300005937 Bacteria 2056
6 Ga0075363_100008195 3300006048 Bacteria 4853
7 Ga0075367_10134391 3300006178 Bacteria 1530
8 Ga0105251_10067841 3300009011 Bacteria 1665
9 Ga0157372_11160116 3300013307 Bacteria 893
10 Ga0182008_10000172 3300014497 Bacteria 50594
11 Ga0182006_1099864 3300015261 Bacteria 1031
12 Ga0182007_10001090 3300015262 Bacteria 14762
13 Ga0209758_1001363 3300025297 Bacteria 29239
14 Ga0207647_10031425 3300025904 Bacteria 3417
15 Ga0207702_10432729 3300026078 Bacteria 1274
16 Ga0209371_1019324 3300027312 Bacteria 1702
17 Ga0268256_1021682 3300030500 Bacteria 1702
18 Ga0307511_10001379 3300030521 Bacteria 25696
19 Ga0307511_10060134 3300030521 Bacteria 2912
20 Ga0307512_10011904 3300030522 Bacteria 8223
21 Ga0307512_10019746 3300030522 Bacteria 6128
22 Ga0307509_10019443 3300031507 Bacteria 7744
23 Ga0307509_10034296 3300031507 Bacteria 5575
24 Ga0307508_10017020 3300031616 Bacteria 6612
25 Ga0307508_10024920 3300031616 Bacteria 5426
26 Ga0307514_10002806 3300031649 Bacteria 17480
27 Ga0307514_10029616 3300031649 Bacteria 4399
28 Ga0307514_10274209 3300031649 Bacteria 973
29 Ga0307516_10001470 3300031730 Bacteria 32516
30 Ga0307516_10017909 3300031730 Bacteria 7377
31 Ga0307518_10064385 3300031838 Bacteria 2661
32 Ga0307518_10097393 3300031838 Bacteria 2110
33 Ga0307507_10007270 3300033179 Bacteria 16223
34 Ga0307507_10465928 3300033179 Bacteria 692
35 Ga0307510_10028081 3300033180 Bacteria 6431
36 Ga0307510_10055423 3300033180 Bacteria 4140
37 Ga0307510_10058084 3300033180 Bacteria 4009
38 Ga0395900_0458279 3300037418 Bacteria 1230
39 Ga0395898_0011428 3300037466 Bacteria 9221
40 Ga0395905_0361331 3300037471 Bacteria 1345
41 Ga0395901_0017775 3300038443 Bacteria 7259
42 Ga0395901_0142508 3300038443 Bacteria 2519
43 Ga0451791_0947654 3300041451 Bacteria 997
44 Ga0451853_0622117 3300041512 Bacteria 794
45 Ga0439448_0110321 3300042005 Bacteria 939
46 Ga0439449_0009903 3300042007 Bacteria 3605
47 Ga0439449_0060835 3300042007 Bacteria 1393
48 Ga0466969_0040536 3300044656 Bacteria 2333
49 Ga0466969_0069579 3300044656 Bacteria 1694
50 Ga0466972_0004201 3300044658 Bacteria 7196
51 Ga0466972_0009890 3300044658 Bacteria 4787
52 Ga0466965_0006700 3300044683 Bacteria 5254
53 Ga0466965_0054033 3300044683 Bacteria 1997
54 Ga0466965_0409705 3300044683 Bacteria 750
55 Ga0466966_0002961 3300044684 Bacteria 11175
56 Ga0466966_0010350 3300044684 Bacteria 6192
57 Ga0466966_0279025 3300044684 Bacteria 1005
58 Ga0466961_0003898 3300044693 Bacteria 9324
59 Ga0466961_0089455 3300044693 Bacteria 1944
60 Ga0466963_0000210 3300044694 Bacteria 24944
61 Ga0466964_0034072 3300044706 Bacteria 2031
62 Ga0466971_0004227 3300044719 Bacteria 6187
63 Ga0466971_0133333 3300044719 Bacteria 1154
64 Ga0466968_0018257 3300044735 Bacteria 2812
65 Ga0466970_0000480 3300044765 Bacteria 19686
66 Ga0466970_0323922 3300044765 Bacteria 871
67 Ga0466957_0000438 3300044842 Bacteria 20495
68 Ga0466959_0003208 3300045049 Bacteria 10633
69 Ga0466959_0320083 3300045049 Bacteria 1060
70 Ga0466958_0006684 3300045836 Bacteria 6293
71 Ga0466967_0003910 3300045976 Bacteria 9889
72 Ga0466967_0096767 3300045976 Bacteria 2693
73 Ga0495592_0005063 3300046454 Bacteria 9701
74 Ga0495629_0007117 3300046459 Bacteria 8243
75 Ga0495629_0033472 3300046459 Bacteria 3635
76 Ga0495629_0384178 3300046459 Bacteria 955
77 Ga0495638_0284524 3300046460 Bacteria 897
78 Ga0495651_0010747 3300046462 Bacteria 7038
79 Ga0495582_0057656 3300046473 Bacteria 2141
80 Ga0495582_0134761 3300046473 Bacteria 1397
81 Ga0495639_0008131 3300046475 Bacteria 4505
82 Ga0495662_0000476 3300046476 Bacteria 18183
83 Ga0495662_0050844 3300046476 Bacteria 2001
84 Ga0495662_0197219 3300046476 Bacteria 992
85 Ga0495662_0292527 3300046476 Bacteria 801
86 Ga0495664_0000182 3300046477 Bacteria 31040
87 Ga0495583_0023328 3300046506 Bacteria 3133
88 Ga0495583_0071097 3300046506 Bacteria 1529
89 Ga0495610_0249995 3300046512 Bacteria 703
90 Ga0495618_0068069 3300046514 Bacteria 2264
91 Ga0495620_0006092 3300046515 Bacteria 6663
92 Ga0495620_0171518 3300046515 Bacteria 841
93 Ga0495628_0014606 3300046516 Bacteria 6576
94 Ga0495628_0051343 3300046516 Bacteria 3260
95 Ga0495628_0114837 3300046516 Bacteria 2068
96 Ga0495643_0008360 3300046522 Bacteria 6559
97 Ga0495648_0207590 3300046524 Bacteria 975
98 Ga0495642_0223199 3300046528 Bacteria 823
99 Ga0495652_0015894 3300046529 Bacteria 6737
100 Ga0495640_0022565 3300046533 Bacteria 4597
101 Ga0495640_0648632 3300046533 Bacteria 635
102 Ga0495586_0036908 3300046535 Bacteria 2623
103 Ga0495587_0000377 3300046536 Bacteria 31781
104 Ga0495587_0340553 3300046536 Bacteria 836
105 Ga0495597_0039680 3300046542 Bacteria 2107
106 Ga0495645_0070028 3300046543 Bacteria 2532
107 Ga0495622_0019822 3300046557 Bacteria 3131
108 Ga0495667_0198001 3300046559 Bacteria 1286
109 Ga0495668_0114285 3300046616 Bacteria 1476
110 Ga0495634_0010439 3300046642 Bacteria 6803
111 Ga0495634_0370039 3300046642 Bacteria 855
112 Ga0495611_0136688 3300046648 Bacteria 1144
113 Ga0495625_0065379 3300046660 Bacteria 2564
114 Ga0495625_0140647 3300046660 Bacteria 1628
115 Ga0495635_0037372 3300046663 Bacteria 3361
116 Ga0495635_0505807 3300046663 Bacteria 795
117 Ga0495588_0596943 3300046674 Bacteria 578
118 Ga0495657_0005827 3300046675 Bacteria 9699
119 Ga0495657_0010711 3300046675 Bacteria 6893
120 Ga0495657_0014776 3300046675 Bacteria 5728
121 Ga0495657_0035600 3300046675 Bacteria 3449
122 Ga0495623_0032579 3300046679 Bacteria 3349
123 Ga0495646_0015265 3300046680 Bacteria 4876
124 Ga0495658_0021918 3300046683 Bacteria 3373
125 Ga0495613_0010023 3300046689 Bacteria 7038
126 Ga0495613_0016040 3300046689 Bacteria 5577
127 Ga0495613_0016448 3300046689 Bacteria 5509
128 Ga0495613_0066121 3300046689 Bacteria 2640
129 Ga0495613_0109516 3300046689 Bacteria 1991
130 Ga0495649_0064883 3300046694 Bacteria 1960
131 Ga0495589_0034005 3300046794 Bacteria 2559
132 Ga0495589_0036902 3300046794 Bacteria 2449
133 Ga0495589_0222987 3300046794 Bacteria 885
134 Ga0495600_0013590 3300046809 Bacteria 5119
135 Ga0495600_0016728 3300046809 Bacteria 4660
136 Ga0495600_0381364 3300046809 Bacteria 879
137 Ga0495660_0070714 3300046810 Bacteria 1851
138 Ga0495581_0059840 3300047315 Bacteria 2201
139 Ga0495581_0083856 3300047315 Bacteria 1846
140 Ga0495604_0002097 3300047317 Bacteria 16050
141 Ga0495604_0076291 3300047317 Bacteria 2521
142 Ga0495636_0019666 3300047318 Bacteria 2716
143 Ga0495636_0046987 3300047318 Bacteria 1802
144 Ga0495636_0105558 3300047318 Bacteria 1235
145 Ga0495676_0011106 3300047321 Bacteria 8137
146 Ga0495676_0019375 3300047321 Bacteria 5984
147 Ga0495680_0023981 3300047322 Bacteria 5067
148 Ga0495687_001325 3300047443 Bacteria 23102
149 Ga0495687_052463 3300047443 Bacteria 1724
150 Ga0495675_0064008 3300047444 Bacteria 2326
151 Ga0495675_0091795 3300047444 Bacteria 1906
152 Ga0495675_0303240 3300047444 Bacteria 948
153 Ga0495675_0374887 3300047444 Bacteria 833
154 Ga0495685_001627 3300047447 Bacteria 6935
155 Ga0495685_121040 3300047447 Bacteria 859
156 Ga0495684_0163335 3300047471 Bacteria 1660
157 Ga0495686_0100869 3300047472 Bacteria 1741
158 Ga0495593_0004100 3300047673 Bacteria 8666
159 Ga0495593_0009393 3300047673 Bacteria 5675
160 Ga0495593_0082524 3300047673 Bacteria 1661
161 Ga0495602_0039418 3300048088 Bacteria 4351
162 Ga0495614_0005504 3300048089 Bacteria 5710
163 Ga0495614_0099795 3300048089 Bacteria 1267
164 Ga0496108_0187825 3300048911 Bacteria 1790
165 Ga0496109_0644225 3300048912 Bacteria 996
166 Ga0501031_0147563 3300049568 Bacteria 1537
167 Ga0501032_0005052 3300049569 Bacteria 9865
168 Ga0501032_0137222 3300049569 Bacteria 1612
169 Ga0501033_0010757 3300049570 Bacteria 7015
170 Ga0501033_0281952 3300049570 Bacteria 1173
171 Ga0501034_0022480 3300049571 Bacteria 6426
172 Ga0501034_0133109 3300049571 Bacteria 2469
173 Ga0501034_0187015 3300049571 Bacteria 2034
174 Ga0501034_0255863 3300049571 Bacteria 1695
175 Ga0501036_0057630 3300049572 Bacteria 3291
176 Ga0501036_0129918 3300049572 Bacteria 2127
177 Ga0501037_0060819 3300049573 Bacteria 2755
178 Ga0501037_0136606 3300049573 Bacteria 1756
179 Ga0501038_0100478 3300049574 Bacteria 2410
180 Ga0501038_0243159 3300049574 Bacteria 1428
181 Ga0501039_0155430 3300049575 Bacteria 1797
182 Ga0501043_0004781 3300049579 Bacteria 10968
183 Ga0501043_0034197 3300049579 Bacteria 3998
184 Ga0501043_0828921 3300049579 Bacteria 667
185 Ga0501046_0004420 3300049580 Bacteria 12759
186 Ga0501046_0071856 3300049580 Bacteria 2687
187 Ga0501046_0666692 3300049580 Bacteria 734
188 Ga0501047_0020850 3300049581 Bacteria 6295
189 Ga0501047_0021704 3300049581 Bacteria 6164
190 Ga0501047_0074126 3300049581 Bacteria 3276
191 Ga0501048_0002632 3300049582 Bacteria 13727
192 Ga0501048_0024703 3300049582 Bacteria 4384
193 Ga0501070_0401209 3300049586 Bacteria 1109
194 Ga0501080_0461127 3300049742 Bacteria 1138
195 Ga0501080_0477221 3300049742 Bacteria 1116
196 Ga0501035_0011617 3300049822 Bacteria 8163
197 Ga0501035_0043145 3300049822 Bacteria 4065
198 Ga0501035_0057023 3300049822 Bacteria 3483
199 Ga0501035_0289917 3300049822 Bacteria 1381
200 Ga0501044_0026857 3300049823 Bacteria 6093
201 Ga0501044_0133012 3300049823 Bacteria 2480
202 nmdc:mga03n38_24015_c1 3300050490 Bacteria 2488
203 nmdc:mga06z11_929_c1 3300050494 Bacteria 10646
204 Ga0495601_0543518 3300053077 Bacteria 748
205 Ga0500578_0177488 3300053086 Bacteria 1314
206 Ga0500644_0055400 3300053088 Bacteria 1376
207 Ga0500640_020609 3300053095 Bacteria 2835
208 Ga0500553_020260 3300053101 Bacteria 3374
209 Ga0500614_080198 3300053123 Bacteria 912
210 Ga0500624_003372 3300053157 Bacteria 2101
211 Ga0500636_0195008 3300053177 Bacteria 1076
212 2616699281 2616644814 Bacteria 11555299
213 2644265034 2643221647 Bacteria 10741251
214 2644442332 2643221678 Bacteria 9540101
215 2785372018 2784746768 Bacteria 10036182
216 2786673133 2786546132 Bacteria 10419719
217 2808844520 2808606359 Bacteria 9866990
218 2808914093 2808606375 Bacteria 9466072
219 2812355509 2811994879 Bacteria 9313447
220 2862284164 2862281513 Bacteria 9621493
221 2867431059 2867428634 Bacteria 9590268
222 2912729728 2912723979 Bacteria 8557534
223 2919474156 2919468124 Bacteria 9133025
224 2946070298 2946064051 Bacteria 8957905
225 2947226476 2947224130 Bacteria 9938529
226 2954010635 2954002825 Bacteria 9173742
227 2954383528 2954380949 Bacteria 10050426
228 2954679449 2954673503 Bacteria 9685905
229 2954684707 2954682443 Bacteria 9862841
230 2954694320 2954691527 Bacteria 10720516
231 2954709523 2954701450 Bacteria 10834262
232 2954713828 2954711539 Bacteria 10867210
233 2954723795 2954721474 Bacteria 10456478
234 2954738041 2954731030 Bacteria 10243860
235 2954742695 2954740390 Bacteria 10229294
236 2954756899 2954749733 Bacteria 10366972
237 2954761657 2954759201 Bacteria 9358192
238 8056830050 8056829672 Bacteria 9045328
239 Ga0466963_0121753
240 JGI24737J22298_10110813
241 rootH1_10032664
242 Ga0068855_101039135
243 Ga0081455_10121638
244 Ga0075363_100008195
245 Ga0075367_10134391
246 Ga0105251_10067841
247 Ga0157372_11160116
248 Ga0182008_10000172
249 Ga0182006_1099864
250 Ga0182007_10001090
251 Ga0209758_1001363
252 Ga0207647_10031425
253 Ga0207702_10432729
254 Ga0209371_1019324
255 Ga0268256_1021682
256 Ga0307511_10001379
257 Ga0307511_10060134
258 Ga0307512_10011904
259 Ga0307512_10019746
260 Ga0307509_10019443
261 Ga0307509_10034296
262 Ga0307508_10017020
263 Ga0307508_10024920
264 Ga0307514_10002806
265 Ga0307514_10029616
266 Ga0307514_10274209
267 Ga0307516_10001470
268 Ga0307516_10017909
269 Ga0307518_10064385
270 Ga0307518_10097393
271 Ga0307507_10007270
272 Ga0307507_10465928
273 Ga0307510_10028081
274 Ga0307510_10055423
275 Ga0307510_10058084
276 Ga0395900_0458279
277 Ga0395898_0011428
278 Ga0395905_0361331
279 Ga0395901_0017775
280 Ga0395901_0142508
281 Ga0451791_0947654
282 Ga0451853_0622117
283 Ga0439448_0110321
284 Ga0439449_0009903
285 Ga0439449_0060835
286 Ga0466969_0040536
287 Ga0466969_0069579
288 Ga0466972_0004201
289 Ga0466972_0009890
290 Ga0466965_0006700
291 Ga0466965_0054033
292 Ga0466965_0409705
293 Ga0466966_0002961
294 Ga0466966_0010350
295 Ga0466966_0279025
296 Ga0466961_0003898
297 Ga0466961_0089455
298 Ga0466963_0000210
299 Ga0466964_0034072
300 Ga0466971_0004227
301 Ga0466971_0133333
302 Ga0466968_0018257
303 Ga0466970_0000480
304 Ga0466970_0323922
305 Ga0466957_0000438
306 Ga0466959_0003208
307 Ga0466959_0320083
308 Ga0466958_0006684
309 Ga0466967_0003910
310 Ga0466967_0096767
311 Ga0495592_0005063
312 Ga0495629_0007117
313 Ga0495629_0033472
314 Ga0495629_0384178
315 Ga0495638_0284524
316 Ga0495651_0010747
317 Ga0495582_0057656
318 Ga0495582_0134761
319 Ga0495639_0008131
320 Ga0495662_0000476
321 Ga0495662_0050844
322 Ga0495662_0197219
323 Ga0495662_0292527
324 Ga0495664_0000182
325 Ga0495583_0023328
326 Ga0495583_0071097
327 Ga0495610_0249995
328 Ga0495618_0068069
329 Ga0495620_0006092
330 Ga0495620_0171518
331 Ga0495628_0014606
332 Ga0495628_0051343
333 Ga0495628_0114837
334 Ga0495643_0008360
335 Ga0495648_0207590
336 Ga0495642_0223199
337 Ga0495652_0015894
338 Ga0495640_0022565
339 Ga0495640_0648632
340 Ga0495586_0036908
341 Ga0495587_0000377
342 Ga0495587_0340553
343 Ga0495597_0039680
344 Ga0495645_0070028
345 Ga0495622_0019822
346 Ga0495667_0198001
347 Ga0495668_0114285
348 Ga0495634_0010439
349 Ga0495634_0370039
350 Ga0495611_0136688
351 Ga0495625_0065379
352 Ga0495625_0140647
353 Ga0495635_0037372
354 Ga0495635_0505807
355 Ga0495588_0596943
356 Ga0495657_0005827
357 Ga0495657_0010711
358 Ga0495657_0014776
359 Ga0495657_0035600
360 Ga0495623_0032579
361 Ga0495646_0015265
362 Ga0495658_0021918
363 Ga0495613_0010023
364 Ga0495613_0016040
365 Ga0495613_0016448
366 Ga0495613_0066121
367 Ga0495613_0109516
368 Ga0495649_0064883
369 Ga0495589_0034005
370 Ga0495589_0036902
371 Ga0495589_0222987
372 Ga0495600_0013590
373 Ga0495600_0016728
374 Ga0495600_0381364
375 Ga0495660_0070714
376 Ga0495581_0059840
377 Ga0495581_0083856
378 Ga0495604_0002097
379 Ga0495604_0076291
380 Ga0495636_0019666
381 Ga0495636_0046987
382 Ga0495636_0105558
383 Ga0495676_0011106
384 Ga0495676_0019375
385 Ga0495680_0023981
386 Ga0495687_001325
387 Ga0495687_052463
388 Ga0495675_0064008
389 Ga0495675_0091795
390 Ga0495675_0303240
391 Ga0495675_0374887
392 Ga0495685_001627
393 Ga0495685_121040
394 Ga0495684_0163335
395 Ga0495686_0100869
396 Ga0495593_0004100
397 Ga0495593_0009393
398 Ga0495593_0082524
399 Ga0495602_0039418
400 Ga0495614_0005504
401 Ga0495614_0099795
402 Ga0496108_0187825
403 Ga0496109_0644225
404 Ga0501031_0147563
405 Ga0501032_0005052
406 Ga0501032_0137222
407 Ga0501033_0010757
408 Ga0501033_0281952
409 Ga0501034_0022480
410 Ga0501034_0133109
411 Ga0501034_0187015
412 Ga0501034_0255863
413 Ga0501036_0057630
414 Ga0501036_0129918
415 Ga0501037_0060819
416 Ga0501037_0136606
417 Ga0501038_0100478
418 Ga0501038_0243159
419 Ga0501039_0155430
420 Ga0501043_0004781
421 Ga0501043_0034197
422 Ga0501043_0828921
423 Ga0501046_0004420
424 Ga0501046_0071856
425 Ga0501046_0666692
426 Ga0501047_0020850
427 Ga0501047_0021704
428 Ga0501047_0074126
429 Ga0501048_0002632
430 Ga0501048_0024703
431 Ga0501070_0401209
432 Ga0501080_0461127
433 Ga0501080_0477221
434 Ga0501035_0011617
435 Ga0501035_0043145
436 Ga0501035_0057023
437 Ga0501035_0289917
438 Ga0501044_0026857
439 Ga0501044_0133012
440 nmdc:mga03n38_24015_c1
441 nmdc:mga06z11_929_c1
442 Ga0495601_0543518
443 Ga0500578_0177488
444 Ga0500644_0055400
445 Ga0500640_020609
446 Ga0500553_020260
447 Ga0500614_080198
448 Ga0500624_003372
449 Ga0500636_0195008
450 2616699281
451 2644265034
452 2644442332
453 2785372018
454 2786673133
455 2808844520
456 2808914093
457 2812355509
458 2862284164
459 2867431059
460 2912729728
461 2919474156
462 2946070298
463 2947226476
464 2954010635
465 2954383528
466 2954679449
467 2954684707
468 2954694320
469 2954709523
470 2954713828
471 2954723795
472 2954738041
473 2954742695
474 2954756899
475 2954761657
476 8056830050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eti-assembly1.cif.gz_X fkbp39 associated 60s nascent ribosome state 1 0.5856 76 103
1yj7-assembly1.cif.gz_C crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.4619 76 112
7ea3-assembly1.cif.gz_R intact ypt32-trappii (dimer). 0.4248 76 110
7e8t-assembly1.cif.gz_E monomer of ypt32-trappii 0.4248 76 110
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.4082 3 111
ID Description Score Start End Superfamily
5trdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5921 75 107 1.10.10.10
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.558 1 137 1.20.1250.20
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5512 1 137 1.20.1250.20
af_O80644_110_174_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5376 76 96 3.30.70.260
af_Q9SUY9_96_436_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.4837 75 112 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A516REN3-F1-model_v4 DUF1453 family protein 0.8768 4 138 GO:0016020
AF-A0A7K4FUP9-F1-model_v4 Uncharacterized protein 0.8565 55 142 GO:0016020
AF-A0A543CMV6-F1-model_v4 DUF1453 domain-containing protein 0.8242 4 136 GO:0016020
AF-A0A429TG94-F1-model_v4 DUF1453 domain-containing protein 0.8201 4 137 GO:0016020
AF-R4LG66-F1-model_v4 Integral membrane protein 0.82 4 148 GO:0016020

Map