F351190

General Info

Members Datasets Scaffolds Average Seq Length
238 168 232 157

Family's Representative Sequence

Representative Sequence 3300042134|Ga0450898_061158|Ga0450898_061158_105_653
Length 182
Sequence MSSIMGKAIDSVNQQGGKAPRREPALPGAAPTRGGRHAASSGDEVLELVHTVMHQLRSQQYQALRDGPLALTHMEGKVLGYFGRHAGATQSDLVEHSGRDKAQLARLIKGLRERGLLAAEADAGDRRQLRLSLTEAGHGLLGMLQQRTRKLHAQAVRGLSGAEREQLRSLLQRLRDNLGRDI

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
70 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
71 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
76 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
77 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
78 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
153 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
154 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
155 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
156 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
157 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
162 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
163 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
164 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.73
Nodule 0
Rhizoplane 2.94
Rhizosphere 52.1
Stem 0
Stem Tuber 0
Unclassified 17.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000562 3300003215 Bacteria 22974
2 rootH1_10051535 3300003316 Bacteria 1322
3 rootH2_10094996 3300003320 Bacteria 4015
4 rootL2_10053949 3300003322 Bacteria 1396
5 rootL2_10258018 3300003322 Bacteria 1493
6 rootH1_10012083 3300003323 Bacteria 3455
7 rootH1_10137973 3300003323 Plasmid 2564
8 Ga0055540_1049676 3300003792 Bacteria 870
9 Ga0070658_10017221 3300005327 Bacteria 5783
10 Ga0068869_100563958 3300005334 Bacteria 958
11 Ga0068869_100851448 3300005334 Bacteria 786
12 Ga0070673_100469029 3300005364 Bacteria 1135
13 Ga0070667_100143844 3300005367 Bacteria 2090
14 Ga0070678_100113793 3300005456 Bacteria 2122
15 Ga0068867_100000093 3300005459 Bacteria 57534
16 Ga0070665_100366277 3300005548 Unclassified 1448
17 Ga0068857_100022694 3300005577 Bacteria 5521
18 Ga0068854_100273336 3300005578 Bacteria 1358
19 Ga0068852_100001578 3300005616 Bacteria 15487
20 Ga0068852_100170295 3300005616 Bacteria 2041
21 Ga0068860_100060676 3300005843 Bacteria 3594
22 Ga0075368_10033734 3300006042 Bacteria 1992
23 Ga0075368_10084652 3300006042 Bacteria 1293
24 Ga0075363_100038037 3300006048 Bacteria 2528
25 Ga0075364_10154208 3300006051 Bacteria 1549
26 Ga0075362_10049622 3300006177 Bacteria 1875
27 Ga0075362_10062233 3300006177 Bacteria 1690
28 Ga0075362_10173479 3300006177 Bacteria 1043
29 Ga0075367_10069644 3300006178 Bacteria 2112
30 Ga0075367_10076003 3300006178 Bacteria 2026
31 Ga0075367_10082908 3300006178 Bacteria 1942
32 Ga0075367_10166843 3300006178 Bacteria 1370
33 Ga0075367_10385449 3300006178 Bacteria 886
34 Ga0075366_10003063 3300006195 Bacteria 8731
35 Ga0075366_10038463 3300006195 Bacteria 2825
36 Ga0075366_10481633 3300006195 Bacteria 767
37 Ga0075370_10023079 3300006353 Bacteria 3423
38 Ga0075433_11280496 3300006852 Unclassified 635
39 Ga0105240_10122421 3300009093 Bacteria 3130
40 Ga0105243_10002291 3300009148 Bacteria 16050
41 Ga0105243_10469267 3300009148 Bacteria 1185
42 Ga0105237_10005542 3300009545 Bacteria 14230
43 Ga0105237_10272782 3300009545 Bacteria 1694
44 Ga0105249_10276461 3300009553 Bacteria 1675
45 Ga0105239_10074773 3300010375 Bacteria 3725
46 Ga0157377_10000036 3300014745 Bacteria 116358
47 Ga0157379_10652605 3300014968 Bacteria 985
48 Ga0209129_1044220 3300025258 Bacteria 696
49 Ga0209673_1007622 3300025273 Bacteria 4946
50 Ga0209758_1000500 3300025297 Bacteria 63618
51 Ga0209050_1000223 3300025298 Bacteria 125465
52 Ga0209051_1010940 3300025303 Bacteria 4528
53 Ga0207695_10064712 3300025913 Bacteria 3763
54 Ga0207671_10015445 3300025914 Bacteria 5977
55 Ga0207671_10343432 3300025914 Unclassified 1183
56 Ga0207706_10162436 3300025933 Bacteria 1963
57 Ga0207709_10001511 3300025935 Bacteria 16065
58 Ga0207709_10095758 3300025935 Bacteria 1951
59 Ga0207689_10021967 3300025942 Bacteria 5365
60 Ga0207651_10396392 3300025960 Bacteria 1173
61 Ga0207640_10213739 3300025981 Bacteria 1471
62 Ga0207658_10316683 3300025986 Bacteria 1349
63 Ga0207639_10272231 3300026041 Bacteria 1486
64 Ga0207639_10707539 3300026041 Bacteria 935
65 Ga0207678_10102362 3300026067 Bacteria 2445
66 Ga0207648_10000039 3300026089 Bacteria 118860
67 Ga0207674_10551030 3300026116 Bacteria 1114
68 Ga0207683_10059804 3300026121 Bacteria 3348
69 Ga0207698_10128327 3300026142 Bacteria 2162
70 Ga0209813_10016996 3300027866 Bacteria 1993
71 Ga0268264_10089472 3300028381 Bacteria 2651
72 Ga0307515_10007997 3300028794 Bacteria 20750
73 Ga0307515_10055684 3300028794 Bacteria 5771
74 Ga0307515_10106693 3300028794 Bacteria 3319
75 Ga0307515_10424993 3300028794 Bacteria 948
76 Ga0307513_10030209 3300031456 Bacteria 6158
77 Ga0307509_10034224 3300031507 Bacteria 5582
78 Ga0307509_10046939 3300031507 Bacteria 4647
79 Ga0307509_10168874 3300031507 Bacteria 2071
80 Ga0307509_10302713 3300031507 Bacteria 1346
81 Ga0307509_10350517 3300031507 Bacteria 1200
82 Ga0307509_10373889 3300031507 Bacteria 1140
83 Ga0307509_10396982 3300031507 Bacteria 1087
84 Ga0307514_10104067 3300031649 Bacteria 2031
85 Ga0307516_10000248 3300031730 Bacteria 69744
86 Ga0307516_10109473 3300031730 Bacteria 2567
87 Ga0307516_10368390 3300031730 Bacteria 1100
88 Ga0307516_10604206 3300031730 Bacteria 751
89 Ga0307412_10021983 3300031911 Bacteria 3904
90 Ga0307412_10841716 3300031911 Bacteria 800
91 Ga0307507_10134411 3300033179 Bacteria 1922
92 Ga0307507_10293668 3300033179 Bacteria 1003
93 Ga0307510_10154227 3300033180 Bacteria 1907
94 Ga0395905_0076108 3300037471 Bacteria 3145
95 Ga0395905_0274155 3300037471 Bacteria 1573
96 Ga0439436_0120006 3300041404 Bacteria 735
97 Ga0451797_0295084 3300041453 Bacteria 1437
98 Ga0451797_1291222 3300041453 Bacteria 610
99 Ga0451797_1385152 3300041453 Bacteria 515
100 Ga0451800_0331394 3300041459 Bacteria 2617
101 Ga0451800_1196551 3300041459 Bacteria 755
102 Ga0451802_0128248 3300041460 Bacteria 1155
103 Ga0451843_0144345 3300041509 Bacteria 1636
104 Ga0451853_0356964 3300041512 Bacteria 1765
105 Ga0451853_1730596 3300041512 Bacteria 1153
106 Ga0439445_0006209 3300042004 Bacteria 2744
107 Ga0450911_001406 3300042115 Bacteria 5562
108 Ga0450898_061158 3300042134 Bacteria 741
109 Ga0450893_0010049 3300042532 Bacteria 1551
110 Ga0451577_0002963 3300042876 Bacteria 19426
111 Ga0466957_0332207 3300044842 Bacteria 1028
112 Ga0495590_0000139 3300046457 Bacteria 43517
113 Ga0495629_0325990 3300046459 Bacteria 1049
114 Ga0495638_0070484 3300046460 Bacteria 2140
115 Ga0495653_0042045 3300046463 Bacteria 3563
116 Ga0495650_0013705 3300046471 Bacteria 4271
117 Ga0495580_0311598 3300046472 Bacteria 1070
118 Ga0495582_0003302 3300046473 Bacteria 9064
119 Ga0495639_0081682 3300046475 Bacteria 1506
120 Ga0495584_0013549 3300046491 Bacteria 4162
121 Ga0495584_0154653 3300046491 Bacteria 1165
122 Ga0495584_0168538 3300046491 Bacteria 1113
123 Ga0495585_0108698 3300046492 Bacteria 1477
124 Ga0495585_0225231 3300046492 Bacteria 944
125 Ga0495594_0010104 3300046499 Bacteria 4890
126 Ga0495596_0011582 3300046500 Bacteria 3797
127 Ga0495607_0204924 3300046501 Bacteria 973
128 Ga0495583_0000064 3300046506 Bacteria 192380
129 Ga0495583_0124166 3300046506 Bacteria 1084
130 Ga0495606_0018749 3300046507 Bacteria 5176
131 Ga0495606_0378569 3300046507 Bacteria 743
132 Ga0495610_0261647 3300046512 Bacteria 681
133 Ga0495631_0204941 3300046518 Bacteria 843
134 Ga0495632_0060514 3300046519 Bacteria 1840
135 Ga0495632_0117743 3300046519 Bacteria 1243
136 Ga0495643_0001396 3300046522 Bacteria 22518
137 Ga0495643_0125582 3300046522 Bacteria 1292
138 Ga0495644_0046540 3300046523 Bacteria 1630
139 Ga0495666_0045522 3300046526 Bacteria 2116
140 Ga0495652_0022306 3300046529 Bacteria 5618
141 Ga0495665_0059224 3300046531 Bacteria 2021
142 Ga0495586_0017869 3300046535 Bacteria 3772
143 Ga0495609_0130411 3300046538 Bacteria 1077
144 Ga0495597_0000919 3300046542 Bacteria 22835
145 Ga0495633_0068292 3300046558 Bacteria 1659
146 Ga0495633_0073154 3300046558 Bacteria 1598
147 Ga0495668_0186835 3300046616 Bacteria 1135
148 Ga0495634_0011819 3300046642 Bacteria 6349
149 Ga0495634_0524453 3300046642 Bacteria 693
150 Ga0495611_0018772 3300046648 Bacteria 2966
151 Ga0495625_0077774 3300046660 Bacteria 2317
152 Ga0495661_0317436 3300046665 Bacteria 775
153 Ga0495588_0022147 3300046674 Bacteria 3139
154 Ga0495623_0055261 3300046679 Bacteria 2503
155 Ga0495658_0332970 3300046683 Bacteria 963
156 Ga0495624_0390039 3300046690 Unclassified 836
157 Ga0495649_0002043 3300046694 Bacteria 14565
158 Ga0495649_0141077 3300046694 Bacteria 1268
159 Ga0495589_0000045 3300046794 Bacteria 123922
160 Ga0495589_0020437 3300046794 Bacteria 3386
161 Ga0495589_0185425 3300046794 Bacteria 986
162 Ga0495600_0031500 3300046809 Bacteria 3436
163 Ga0495660_0012798 3300046810 Bacteria 4866
164 Ga0495581_0333672 3300047315 Bacteria 885
165 Ga0495604_0093298 3300047317 Bacteria 2227
166 Ga0495672_0208506 3300047320 Bacteria 972
167 Ga0495680_0069995 3300047322 Bacteria 2676
168 Ga0495683_0009565 3300047323 Bacteria 5162
169 Ga0495675_0022106 3300047444 Bacteria 4053
170 Ga0495675_0152459 3300047444 Bacteria 1427
171 Ga0495677_0001493 3300047445 Bacteria 9408
172 Ga0495602_0015160 3300048088 Bacteria 7789
173 Ga0495626_0000017 3300048091 Bacteria 231648
174 Ga0495626_0005860 3300048091 Bacteria 7083
175 Ga0495626_0058084 3300048091 Bacteria 1769
176 Ga0495626_0222429 3300048091 Bacteria 766
177 Ga0496115_1156696 3300048918 Bacteria 584
178 Ga0496118_0150671 3300048921 Bacteria 1457
179 Ga0496121_0012639 3300048924 Bacteria 9172
180 Ga0496121_0016827 3300048924 Bacteria 7520
181 Ga0496124_0015565 3300048927 Bacteria 7282
182 Ga0496124_0026457 3300048927 Bacteria 5230
183 Ga0496124_0084322 3300048927 Bacteria 2606
184 Ga0496125_0010085 3300048928 Bacteria 9585
185 Ga0496125_0031621 3300048928 Bacteria 4714
186 Ga0496126_0468338 3300048929 Bacteria 1011
187 Ga0495678_160517 3300049459 Unclassified 719
188 Ga0495682_0087060 3300049460 Bacteria 1123
189 Ga0501249_115236 3300049679 Bacteria 652
190 Ga0501257_061439 3300049686 Bacteria 950
191 nmdc:mga03683_107916_c1 3300050489 Bacteria 1228
192 nmdc:mga03683_159714_c1 3300050489 Bacteria 1020
193 nmdc:mga03n38_200662_c1 3300050490 Bacteria 1032
194 nmdc:mga03n38_371778_c1 3300050490 Bacteria 782
195 nmdc:mga00v17_197391_c1 3300050491 Bacteria 1300
196 nmdc:mga0k408_101002_c1 3300050493 Bacteria 1701
197 nmdc:mga0k408_130461_c1 3300050493 Bacteria 1492
198 nmdc:mga0k408_274_c1 3300050493 Bacteria 28068
199 nmdc:mga0k408_390309_c1 3300050493 Bacteria 829
200 nmdc:mga0k408_470209_c1 3300050493 Bacteria 746
201 nmdc:mga04h51_32106_c1 3300050495 Bacteria 1663
202 nmdc:mga07m45_34439_c1 3300050496 Bacteria 2815
203 nmdc:mga07m45_76374_c1 3300050496 Bacteria 1910
204 Ga0500635_0000126 3300053080 Bacteria 45288
205 Ga0500578_0000549 3300053086 Bacteria 45594
206 Ga0500578_0203320 3300053086 Bacteria 1211
207 Ga0500644_0041985 3300053088 Bacteria 1522
208 Ga0500644_0459738 3300053088 Bacteria 558
209 Ga0500646_0016531 3300053090 Bacteria 1927
210 Ga0500650_0007076 3300053098 Bacteria 4338
211 Ga0500562_108649 3300053108 Bacteria 756
212 Ga0500562_153407 3300053108 Bacteria 627
213 Ga0500593_165803 3300053117 Bacteria 839
214 Ga0500594_0069090 3300053118 Bacteria 1035
215 Ga0500628_044692 3300053129 Bacteria 1026
216 Ga0500642_0018299 3300053130 Bacteria 2706
217 Ga0500652_001792 3300053131 Bacteria 6514
218 Ga0500658_0202179 3300053134 Bacteria 908
219 Ga0500559_0017806 3300053136 Bacteria 3004
220 Ga0500561_0081034 3300053137 Bacteria 945
221 Ga0500568_0086132 3300053139 Bacteria 1188
222 Ga0500568_0248962 3300053139 Bacteria 647
223 Ga0500577_0002743 3300053142 Bacteria 4524
224 Ga0500586_016172 3300053145 Bacteria 2258
225 Ga0500589_142306 3300053147 Bacteria 987
226 Ga0500589_333312 3300053147 Unclassified 526
227 Ga0500604_0031427 3300053151 Bacteria 1558
228 Ga0500604_0053925 3300053151 Bacteria 1247
229 Ga0500616_0035268 3300053153 Bacteria 2721
230 Ga0500622_0000146 3300053156 Bacteria 74615
231 Ga0500624_019530 3300053157 Bacteria 1078
232 Ga0500570_086327 3300053724 Bacteria 1388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10053949 rootL2_100539492 129
2 3300005548 Ga0070665_100366277 Ga0070665_1003662772 138
3 3300026121 Ga0207683_10059804 Ga0207683_100598043 138
4 3300048927 Ga0496124_0015565 Ga0496124_0015565_5094_5522 142
5 3300046683 Ga0495658_0332970 Ga0495658_0332970_340_834 145
6 3300044842 Ga0466957_0332207 Ga0466957_0332207_100_558 148
7 3300041453 Ga0451797_1385152 Ga0451797_1385152_41_490 149
8 3300048927 Ga0496124_0026457 Ga0496124_0026457_1695_2150 149
9 3300006178 Ga0075367_10069644 Ga0075367_100696442 152
10 3300031911 Ga0307412_10021983 Ga0307412_100219831 152
11 3300049686 Ga0501257_061439 Ga0501257_061439_168_641 152
12 3300006177 Ga0075362_10173479 Ga0075362_101734791 153
13 3300006195 Ga0075366_10481633 Ga0075366_104816332 153
14 3300009545 Ga0105237_10272782 Ga0105237_102727823 153
15 3300014968 Ga0157379_10652605 Ga0157379_106526053 153
16 3300025914 Ga0207671_10343432 Ga0207671_103434322 153
17 3300025942 Ga0207689_10021967 Ga0207689_100219678 153
18 3300028794 Ga0307515_10007997 Ga0307515_1000799717 153
19 3300031507 Ga0307509_10034224 Ga0307509_100342246 153
20 3300031507 Ga0307509_10046939 Ga0307509_100469396 153
21 3300031507 Ga0307509_10373889 Ga0307509_103738892 153
22 3300031507 Ga0307509_10396982 Ga0307509_103969822 153
23 3300031649 Ga0307514_10104067 Ga0307514_101040672 153
24 3300031730 Ga0307516_10368390 Ga0307516_103683902 153
25 3300031911 Ga0307412_10841716 Ga0307412_108417161 153
26 3300033179 Ga0307507_10134411 Ga0307507_101344112 153
27 3300033179 Ga0307507_10293668 Ga0307507_102936682 153
28 3300033180 Ga0307510_10154227 Ga0307510_101542272 153
29 3300041453 Ga0451797_0295084 Ga0451797_0295084_506_1000 153
30 3300041459 Ga0451800_0331394 Ga0451800_0331394_1629_2123 153
31 3300041460 Ga0451802_0128248 Ga0451802_0128248_285_779 153
32 3300041509 Ga0451843_0144345 Ga0451843_0144345_919_1413 153
33 3300041512 Ga0451853_0356964 Ga0451853_0356964_1172_1666 153
34 3300042004 Ga0439445_0006209 Ga0439445_0006209_1762_2232 153
35 3300042115 Ga0450911_001406 Ga0450911_001406_1999_2469 153
36 3300042532 Ga0450893_0010049 Ga0450893_0010049_984_1451 153
37 3300046457 Ga0495590_0000139 Ga0495590_0000139_33538_34008 153
38 3300046491 Ga0495584_0168538 Ga0495584_0168538_134_601 153
39 3300046506 Ga0495583_0000064 Ga0495583_0000064_151104_151586 153
40 3300046507 Ga0495606_0018749 Ga0495606_0018749_1222_1692 153
41 3300046522 Ga0495643_0125582 Ga0495643_0125582_615_1109 153
42 3300046523 Ga0495644_0046540 Ga0495644_0046540_666_1133 153
43 3300046665 Ga0495661_0317436 Ga0495661_0317436_190_660 153
44 3300046690 Ga0495624_0390039 Ga0495624_0390039_170_637 153
45 3300048091 Ga0495626_0058084 Ga0495626_0058084_742_1209 153
46 3300048924 Ga0496121_0016827 Ga0496121_0016827_2079_2549 153
47 3300048927 Ga0496124_0084322 Ga0496124_0084322_38_508 153
48 3300048928 Ga0496125_0010085 Ga0496125_0010085_2021_2491 153
49 3300048928 Ga0496125_0031621 Ga0496125_0031621_3431_3901 153
50 3300048929 Ga0496126_0468338 Ga0496126_0468338_525_995 153
51 3300049679 Ga0501249_115236 Ga0501249_115236_175_642 153
52 3300050489 nmdc:mga03683_159714_c1 nmdc:mga03683_159714_c1_96_572 153
53 3300050493 nmdc:mga0k408_130461_c1 nmdc:mga0k408_130461_c1_140_616 153
54 3300050493 nmdc:mga0k408_470209_c1 nmdc:mga0k408_470209_c1_248_712 153
55 3300053147 Ga0500589_333312 Ga0500589_333312_52_516 153
56 iso_pu_bacteria 2585428057 2587725878 153
57 iso_pu_bacteria 2585428058 2587736169 153
58 iso_pu_bacteria 2588253510 2588292908 153
59 iso_pu_bacteria 2643221592 2643968017 153
60 iso_pu_bacteria 2643221625 2644143059 153
61 iso_pu_bacteria 2643221648 2644271853 153
62 3300005459 Ga0068867_100000093 Ga0068867_10000009337 154
63 3300005616 Ga0068852_100001578 Ga0068852_1000015786 154
64 3300009148 Ga0105243_10002291 Ga0105243_100022911 154
65 3300014745 Ga0157377_10000036 Ga0157377_1000003659 154
66 3300025935 Ga0207709_10001511 Ga0207709_100015111 154
67 3300026089 Ga0207648_10000039 Ga0207648_100000396 154
68 3300028794 Ga0307515_10106693 Ga0307515_101066931 154
69 3300028794 Ga0307515_10424993 Ga0307515_104249932 154
70 3300031456 Ga0307513_10030209 Ga0307513_100302093 154
71 3300037471 Ga0395905_0076108 Ga0395905_0076108_763_1230 154
72 3300048918 Ga0496115_1156696 Ga0496115_1156696_85_552 154
73 3300053088 Ga0500644_0041985 Ga0500644_0041985_154_621 154
74 3300053108 Ga0500562_153407 Ga0500562_153407_49_516 154
75 3300053117 Ga0500593_165803 Ga0500593_165803_191_658 154
76 3300053139 Ga0500568_0248962 Ga0500568_0248962_51_530 154
77 3300053145 Ga0500586_016172 Ga0500586_016172_1643_2122 154
78 3300053153 Ga0500616_0035268 Ga0500616_0035268_1505_1972 154
79 3300003316 rootH1_10051535 rootH1_100515352 155
80 3300003322 rootL2_10258018 rootL2_102580182 155
81 3300005334 Ga0068869_100563958 Ga0068869_1005639581 155
82 3300005334 Ga0068869_100851448 Ga0068869_1008514482 155
83 3300005364 Ga0070673_100469029 Ga0070673_1004690292 155
84 3300005367 Ga0070667_100143844 Ga0070667_1001438441 155
85 3300005456 Ga0070678_100113793 Ga0070678_1001137932 155
86 3300005577 Ga0068857_100022694 Ga0068857_1000226948 155
87 3300005578 Ga0068854_100273336 Ga0068854_1002733362 155
88 3300005616 Ga0068852_100170295 Ga0068852_1001702952 155
89 3300005843 Ga0068860_100060676 Ga0068860_1000606763 155
90 3300006042 Ga0075368_10033734 Ga0075368_100337342 155
91 3300006042 Ga0075368_10084652 Ga0075368_100846522 155
92 3300006048 Ga0075363_100038037 Ga0075363_1000380374 155
93 3300006051 Ga0075364_10154208 Ga0075364_101542082 155
94 3300006177 Ga0075362_10049622 Ga0075362_100496223 155
95 3300006177 Ga0075362_10062233 Ga0075362_100622332 155
96 3300006178 Ga0075367_10076003 Ga0075367_100760032 155
97 3300006178 Ga0075367_10166843 Ga0075367_101668433 155
98 3300006195 Ga0075366_10038463 Ga0075366_100384633 155
99 3300006852 Ga0075433_11280496 Ga0075433_112804961 155
100 3300009093 Ga0105240_10122421 Ga0105240_101224213 155
101 3300009148 Ga0105243_10469267 Ga0105243_104692672 155
102 3300009545 Ga0105237_10005542 Ga0105237_100055427 155
103 3300009553 Ga0105249_10276461 Ga0105249_102764612 155
104 3300010375 Ga0105239_10074773 Ga0105239_100747734 155
105 3300025913 Ga0207695_10064712 Ga0207695_100647125 155
106 3300025914 Ga0207671_10015445 Ga0207671_100154457 155
107 3300025933 Ga0207706_10162436 Ga0207706_101624362 155
108 3300025935 Ga0207709_10095758 Ga0207709_100957582 155
109 3300025960 Ga0207651_10396392 Ga0207651_103963922 155
110 3300025981 Ga0207640_10213739 Ga0207640_102137392 155
111 3300025986 Ga0207658_10316683 Ga0207658_103166832 155
112 3300026041 Ga0207639_10707539 Ga0207639_107075392 155
113 3300026067 Ga0207678_10102362 Ga0207678_101023622 155
114 3300026116 Ga0207674_10551030 Ga0207674_105510303 155
115 3300026142 Ga0207698_10128327 Ga0207698_101283272 155
116 3300027866 Ga0209813_10016996 Ga0209813_100169963 155
117 3300028381 Ga0268264_10089472 Ga0268264_100894722 155
118 3300028794 Ga0307515_10055684 Ga0307515_100556842 155
119 3300031507 Ga0307509_10302713 Ga0307509_103027131 155
120 3300031730 Ga0307516_10109473 Ga0307516_101094732 155
121 3300031730 Ga0307516_10604206 Ga0307516_106042062 155
122 3300037471 Ga0395905_0274155 Ga0395905_0274155_101_586 155
123 3300041404 Ga0439436_0120006 Ga0439436_0120006_131_613 155
124 3300041459 Ga0451800_1196551 Ga0451800_1196551_63_533 155
125 3300046459 Ga0495629_0325990 Ga0495629_0325990_238_717 155
126 3300046463 Ga0495653_0042045 Ga0495653_0042045_440_913 155
127 3300046472 Ga0495580_0311598 Ga0495580_0311598_123_602 155
128 3300046473 Ga0495582_0003302 Ga0495582_0003302_8216_8695 155
129 3300046475 Ga0495639_0081682 Ga0495639_0081682_218_697 155
130 3300046491 Ga0495584_0013549 Ga0495584_0013549_1870_2343 155
131 3300046491 Ga0495584_0154653 Ga0495584_0154653_20_496 155
132 3300046492 Ga0495585_0225231 Ga0495585_0225231_315_788 155
133 3300046499 Ga0495594_0010104 Ga0495594_0010104_3936_4415 155
134 3300046500 Ga0495596_0011582 Ga0495596_0011582_2592_3065 155
135 3300046501 Ga0495607_0204924 Ga0495607_0204924_164_637 155
136 3300046506 Ga0495583_0124166 Ga0495583_0124166_416_892 155
137 3300046512 Ga0495610_0261647 Ga0495610_0261647_166_642 155
138 3300046518 Ga0495631_0204941 Ga0495631_0204941_197_673 155
139 3300046519 Ga0495632_0060514 Ga0495632_0060514_1169_1642 155
140 3300046522 Ga0495643_0001396 Ga0495643_0001396_11215_11688 155
141 3300046526 Ga0495666_0045522 Ga0495666_0045522_653_1132 155
142 3300046529 Ga0495652_0022306 Ga0495652_0022306_1825_2304 155
143 3300046531 Ga0495665_0059224 Ga0495665_0059224_787_1266 155
144 3300046535 Ga0495586_0017869 Ga0495586_0017869_512_991 155
145 3300046538 Ga0495609_0130411 Ga0495609_0130411_348_821 155
146 3300046542 Ga0495597_0000919 Ga0495597_0000919_13171_13671 155
147 3300046558 Ga0495633_0068292 Ga0495633_0068292_683_1156 155
148 3300046558 Ga0495633_0073154 Ga0495633_0073154_1082_1567 155
149 3300046616 Ga0495668_0186835 Ga0495668_0186835_149_622 155
150 3300046642 Ga0495634_0011819 Ga0495634_0011819_986_1465 155
151 3300046648 Ga0495611_0018772 Ga0495611_0018772_243_716 155
152 3300046660 Ga0495625_0077774 Ga0495625_0077774_1046_1519 155
153 3300046674 Ga0495588_0022147 Ga0495588_0022147_988_1467 155
154 3300046679 Ga0495623_0055261 Ga0495623_0055261_1012_1491 155
155 3300046694 Ga0495649_0002043 Ga0495649_0002043_11737_12213 155
156 3300046694 Ga0495649_0141077 Ga0495649_0141077_425_898 155
157 3300046794 Ga0495589_0000045 Ga0495589_0000045_9984_10484 155
158 3300046794 Ga0495589_0020437 Ga0495589_0020437_563_1036 155
159 3300046794 Ga0495589_0185425 Ga0495589_0185425_71_544 155
160 3300046809 Ga0495600_0031500 Ga0495600_0031500_2466_2945 155
161 3300046810 Ga0495660_0012798 Ga0495660_0012798_1309_1782 155
162 3300047315 Ga0495581_0333672 Ga0495581_0333672_342_815 155
163 3300047317 Ga0495604_0093298 Ga0495604_0093298_379_858 155
164 3300047320 Ga0495672_0208506 Ga0495672_0208506_100_573 155
165 3300047322 Ga0495680_0069995 Ga0495680_0069995_1402_1896 155
166 3300047323 Ga0495683_0009565 Ga0495683_0009565_185_658 155
167 3300047444 Ga0495675_0022106 Ga0495675_0022106_3162_3641 155
168 3300047444 Ga0495675_0152459 Ga0495675_0152459_630_1103 155
169 3300048088 Ga0495602_0015160 Ga0495602_0015160_3764_4270 155
170 3300048091 Ga0495626_0000017 Ga0495626_0000017_76244_76723 155
171 3300048091 Ga0495626_0005860 Ga0495626_0005860_4514_4987 155
172 3300048091 Ga0495626_0222429 Ga0495626_0222429_243_716 155
173 3300048921 Ga0496118_0150671 Ga0496118_0150671_100_582 155
174 3300048924 Ga0496121_0012639 Ga0496121_0012639_1851_2333 155
175 3300049459 Ga0495678_160517 Ga0495678_160517_29_505 155
176 3300049460 Ga0495682_0087060 Ga0495682_0087060_215_691 155
177 3300050490 nmdc:mga03n38_371778_c1 nmdc:mga03n38_371778_c1_291_764 155
178 3300050491 nmdc:mga00v17_197391_c1 nmdc:mga00v17_197391_c1_25_498 155
179 3300050493 nmdc:mga0k408_101002_c1 nmdc:mga0k408_101002_c1_196_669 155
180 3300050493 nmdc:mga0k408_274_c1 nmdc:mga0k408_274_c1_11283_11765 155
181 3300050493 nmdc:mga0k408_390309_c1 nmdc:mga0k408_390309_c1_42_512 155
182 3300050495 nmdc:mga04h51_32106_c1 nmdc:mga04h51_32106_c1_151_624 155
183 3300050496 nmdc:mga07m45_34439_c1 nmdc:mga07m45_34439_c1_2147_2620 155
184 3300053086 Ga0500578_0203320 Ga0500578_0203320_350_826 155
185 3300053134 Ga0500658_0202179 Ga0500658_0202179_418_894 155
186 3300053137 Ga0500561_0081034 Ga0500561_0081034_111_581 155
187 3300003323 rootH1_10012083 rootH1_100120833 156
188 3300006178 Ga0075367_10385449 Ga0075367_103854492 156
189 3300026041 Ga0207639_10272231 Ga0207639_102722313 156
190 3300031507 Ga0307509_10168874 Ga0307509_101688742 156
191 3300041453 Ga0451797_1291222 Ga0451797_1291222_48_521 156
192 3300042876 Ga0451577_0002963 Ga0451577_0002963_4148_4672 156
193 3300046492 Ga0495585_0108698 Ga0495585_0108698_421_894 156
194 3300046507 Ga0495606_0378569 Ga0495606_0378569_246_719 156
195 3300003215 JGI25153J46596_10000562 JGI25153J46596_1000056222 157
196 3300003320 rootH2_10094996 rootH2_100949966 157
197 3300003323 rootH1_10137973 rootH1_101379731 157
198 3300003792 Ga0055540_1049676 Ga0055540_10496761 157
199 3300005327 Ga0070658_10017221 Ga0070658_100172218 157
200 3300006178 Ga0075367_10082908 Ga0075367_100829082 157
201 3300006195 Ga0075366_10003063 Ga0075366_100030632 157
202 3300006353 Ga0075370_10023079 Ga0075370_100230792 157
203 3300025258 Ga0209129_1044220 Ga0209129_10442202 157
204 3300025273 Ga0209673_1007622 Ga0209673_10076223 157
205 3300025297 Ga0209758_1000500 Ga0209758_100050044 157
206 3300025298 Ga0209050_1000223 Ga0209050_1000223114 157
207 3300025303 Ga0209051_1010940 Ga0209051_10109403 157
208 3300031507 Ga0307509_10350517 Ga0307509_103505172 157
209 3300031730 Ga0307516_10000248 Ga0307516_1000024827 157
210 3300041512 Ga0451853_1730596 Ga0451853_1730596_334_813 157
211 3300042134 Ga0450898_061158 Ga0450898_061158_105_653 157
212 3300046460 Ga0495638_0070484 Ga0495638_0070484_653_1132 157
213 3300046471 Ga0495650_0013705 Ga0495650_0013705_3219_3713 157
214 3300046519 Ga0495632_0117743 Ga0495632_0117743_445_924 157
215 3300046642 Ga0495634_0524453 Ga0495634_0524453_129_635 157
216 3300047445 Ga0495677_0001493 Ga0495677_0001493_6274_6759 157
217 3300050489 nmdc:mga03683_107916_c1 nmdc:mga03683_107916_c1_46_525 157
218 3300050490 nmdc:mga03n38_200662_c1 nmdc:mga03n38_200662_c1_369_848 157
219 3300050496 nmdc:mga07m45_76374_c1 nmdc:mga07m45_76374_c1_359_838 157
220 3300053080 Ga0500635_0000126 Ga0500635_0000126_14709_15215 157
221 3300053086 Ga0500578_0000549 Ga0500578_0000549_20666_21139 157
222 3300053088 Ga0500644_0459738 Ga0500644_0459738_54_533 157
223 3300053090 Ga0500646_0016531 Ga0500646_0016531_535_1014 157
224 3300053098 Ga0500650_0007076 Ga0500650_0007076_2052_2531 157
225 3300053108 Ga0500562_108649 Ga0500562_108649_161_640 157
226 3300053118 Ga0500594_0069090 Ga0500594_0069090_239_718 157
227 3300053129 Ga0500628_044692 Ga0500628_044692_225_704 157
228 3300053130 Ga0500642_0018299 Ga0500642_0018299_485_964 157
229 3300053131 Ga0500652_001792 Ga0500652_001792_4468_4947 157
230 3300053136 Ga0500559_0017806 Ga0500559_0017806_1203_1697 157
231 3300053139 Ga0500568_0086132 Ga0500568_0086132_531_1010 157
232 3300053142 Ga0500577_0002743 Ga0500577_0002743_2585_3064 157
233 3300053147 Ga0500589_142306 Ga0500589_142306_373_852 157
234 3300053151 Ga0500604_0031427 Ga0500604_0031427_884_1357 157
235 3300053151 Ga0500604_0053925 Ga0500604_0053925_550_1029 157
236 3300053156 Ga0500622_0000146 Ga0500622_0000146_2043_2522 157
237 3300053157 Ga0500624_019530 Ga0500624_019530_460_954 157
238 3300053724 Ga0500570_086327 Ga0500570_086327_733_1206 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

76

121

0.95

PF12802

MarR_2

MarR family

71

128

0.95

PF13463

HTH_27

Winged helix DNA-binding domain

72

137

0.92

PF01047

MarR

MarR family

71

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9568 49 99
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9518 50 108
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9475 49 99
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9444 49 108
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.944 63 108
ID Description Score Start End Superfamily
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.961 47 110 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9522 47 109 1.10.10.10
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9513 49 89 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9475 46 107 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9444 49 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2P7RBK3-F1-model_v4 MarR family transcriptional regulator 0.9489 21 154 GO:0003677
GO:0003700
GO:0006950
AF-A0A1H6NKA0-F1-model_v4 deleted 0.9394 18 153
AF-A0A1E7RWW2-F1-model_v4 deleted 0.938 21 153
AF-A0A3C1GUK1-F1-model_v4 MarR family transcriptional regulator 0.9371 20 153 GO:0003677
GO:0003700
AF-A0A1M5RV62-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9333 17 157 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
87.37 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map