F350263
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 199 | 118 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0157814|Ga0451576_0157814_175_1188 |
| Length | 337 |
| Sequence | VALSGDARQSGLAPFPEQAWSFRIKRVQARADRDTQTSHFLCPFNGRRAMSDTGSDYILTISCPDAVGIVFAVSGFLAERSCNIIDSAQFGDRISGLFFLRVHFSAGSGGPSQASLEADFAAHVAERFAMTWKLHDAGRRQRVLIMVSKFGHCLNDLLYRYRTGYLPIEIPAIVSNHRDFYQLAAWHNIPFHHIPVGPDNKAQQEERLLEIVETEKVDLVVLARYMQVLSGRLCERMAGRVINIHHSFLPSFKGAKPYHQAHTRGVKLIGATAHYVTSNLDEGPIIEQEAERVDHTMTPDDLVAIGRDIENVVLARAVRYHVEHRVLLNGNKTVVFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 5 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 6 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 7 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 8 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 9 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 10 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 11 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 12 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 13 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 14 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 15 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 16 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 17 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 18 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 19 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 20 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 21 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 22 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 23 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 24 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 25 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 26 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 27 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 28 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 29 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 30 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 31 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 32 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 33 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 34 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 35 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 36 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 37 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 38 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 39 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 40 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 41 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 42 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 43 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 44 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 45 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 46 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 47 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 48 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 49 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 50 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 51 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 52 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 53 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 54 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 55 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 56 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 57 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 58 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 59 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 60 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 61 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 62 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 63 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 64 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 65 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 66 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 67 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 68 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 69 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 70 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 71 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 72 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 73 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 74 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 75 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 76 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 77 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 78 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 79 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 80 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 81 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 82 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 83 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 84 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 85 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 86 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 87 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 88 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 89 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 90 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 91 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 92 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 93 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 94 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 95 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 96 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 97 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 98 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 99 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 100 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 117 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 122 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 159 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 160 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 181 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 182 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 183 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 187 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 188 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 189 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 191 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 192 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 193 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 194 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 195 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 196 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 197 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 198 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 199 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.37 |
| Metatranscriptomes | 0.42 |
| Isolates | 50.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.42 |
| Bulb | 0 |
| Endosphere | 11.39 |
| Nodule | 35.44 |
| Rhizoplane | 0 |
| Rhizosphere | 33.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1019541 | 3300002773 | Bacteria | 1230 |
| 2 | JGI25151J46595_10037440 | 3300003187 | Bacteria | 1819 |
| 3 | JGI25153J46596_10048955 | 3300003215 | Bacteria | 1230 |
| 4 | Ga0055528_1007979 | 3300003790 | Bacteria | 4606 |
| 5 | Ga0055528_1016184 | 3300003790 | Bacteria | 2651 |
| 6 | Ga0055531_10004993 | 3300003794 | Bacteria | 7871 |
| 7 | Ga0070667_100065661 | 3300005367 | Bacteria | 3081 |
| 8 | Ga0068853_100057562 | 3300005539 | Bacteria | 3355 |
| 9 | Ga0070665_100147258 | 3300005548 | Bacteria | 2357 |
| 10 | Ga0070665_100161959 | 3300005548 | Bacteria | 2239 |
| 11 | Ga0068855_100355579 | 3300005563 | Bacteria | 1612 |
| 12 | Ga0068854_100044602 | 3300005578 | Bacteria | 3148 |
| 13 | Ga0068852_100075313 | 3300005616 | Bacteria | 2977 |
| 14 | Ga0068851_10031030 | 3300005834 | Bacteria | 2652 |
| 15 | Ga0075363_100071184 | 3300006048 | Bacteria | 1889 |
| 16 | Ga0079104_1003775 | 3300006946 | Bacteria | 6819 |
| 17 | Ga0105251_10082457 | 3300009011 | Bacteria | 1485 |
| 18 | Ga0105240_10036083 | 3300009093 | Bacteria | 6365 |
| 19 | Ga0105241_10471416 | 3300009174 | Bacteria | 1114 |
| 20 | Ga0105248_10113477 | 3300009177 | Bacteria | 3056 |
| 21 | Ga0105237_10002086 | 3300009545 | Bacteria | 25280 |
| 22 | Ga0105238_10012125 | 3300009551 | Bacteria | 8688 |
| 23 | Ga0123341_1011174 | 3300009765 | Bacteria | 8176 |
| 24 | Ga0123342_1027450 | 3300009766 | Bacteria | 3182 |
| 25 | Ga0123342_1028976 | 3300009766 | Bacteria | 2925 |
| 26 | Ga0105239_10001046 | 3300010375 | Bacteria | 38548 |
| 27 | Ga0182005_1000435 | 3300015265 | Bacteria | 22162 |
| 28 | Ga0163161_10000267 | 3300017792 | Bacteria | 45913 |
| 29 | Ga0228711_1018171 | 3300022739 | Bacteria | 6758 |
| 30 | Ga0228710_1015174 | 3300022740 | Bacteria | 8554 |
| 31 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 32 | Ga0209437_100312 | 3300025233 | Bacteria | 65593 |
| 33 | Ga0207425_1028045 | 3300025245 | Bacteria | 1144 |
| 34 | Ga0209677_100223 | 3300025253 | Bacteria | 40538 |
| 35 | Ga0209129_1000251 | 3300025258 | Bacteria | 56210 |
| 36 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 37 | Ga0209673_1002281 | 3300025273 | Bacteria | 13713 |
| 38 | Ga0209673_1003409 | 3300025273 | Bacteria | 9420 |
| 39 | Ga0209676_1012836 | 3300025292 | Bacteria | 3257 |
| 40 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 41 | Ga0209025_1018708 | 3300025294 | Bacteria | 3903 |
| 42 | Ga0209564_1000112 | 3300025295 | Bacteria | 211939 |
| 43 | Ga0209758_1000460 | 3300025297 | Bacteria | 67486 |
| 44 | Ga0209050_1007829 | 3300025298 | Bacteria | 5872 |
| 45 | Ga0209050_1044407 | 3300025298 | Bacteria | 1189 |
| 46 | Ga0209256_1000715 | 3300025299 | Bacteria | 44055 |
| 47 | Ga0209256_1005030 | 3300025299 | Bacteria | 7889 |
| 48 | Ga0207656_10017746 | 3300025321 | Bacteria | 2792 |
| 49 | Ga0207713_1009301 | 3300025735 | Bacteria | 5555 |
| 50 | Ga0207654_10359573 | 3300025911 | Bacteria | 1004 |
| 51 | Ga0207695_10000036 | 3300025913 | Bacteria | 477897 |
| 52 | Ga0207695_10089164 | 3300025913 | Bacteria | 3102 |
| 53 | Ga0207671_10000345 | 3300025914 | Bacteria | 68112 |
| 54 | Ga0207671_10019951 | 3300025914 | Bacteria | 5114 |
| 55 | Ga0207694_10046717 | 3300025924 | Bacteria | 3347 |
| 56 | Ga0207711_10148500 | 3300025941 | Bacteria | 2114 |
| 57 | Ga0207667_10273057 | 3300025949 | Bacteria | 1728 |
| 58 | Ga0207640_10039611 | 3300025981 | Bacteria | 2984 |
| 59 | Ga0207639_10240114 | 3300026041 | Bacteria | 1575 |
| 60 | Ga0207702_10120478 | 3300026078 | Bacteria | 2347 |
| 61 | Ga0207698_10048900 | 3300026142 | Bacteria | 3214 |
| 62 | Ga0209281_1000102 | 3300027111 | Bacteria | 221665 |
| 63 | Ga0209281_1001303 | 3300027111 | Bacteria | 15920 |
| 64 | Ga0209282_1000615 | 3300027666 | Bacteria | 17495 |
| 65 | Ga0207428_10020952 | 3300027907 | Bacteria | 5542 |
| 66 | Ga0207428_10133819 | 3300027907 | Bacteria | 1896 |
| 67 | Ga0268266_10149621 | 3300028379 | Bacteria | 2103 |
| 68 | Ga0307515_10078429 | 3300028794 | Bacteria | 4343 |
| 69 | Ga0307512_10079577 | 3300030522 | Bacteria | 2366 |
| 70 | Ga0265327_10002851 | 3300031251 | Bacteria | 17423 |
| 71 | Ga0307410_10235839 | 3300031852 | Bacteria | 1415 |
| 72 | Ga0307407_10146427 | 3300031903 | Bacteria | 1530 |
| 73 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 74 | Ga0315914_1005970 | 3300031967 | Bacteria | 17494 |
| 75 | Ga0315914_1011098 | 3300031967 | Bacteria | 10939 |
| 76 | Ga0307416_100173643 | 3300032002 | Bacteria | 2010 |
| 77 | Ga0315913_1014093 | 3300033430 | Bacteria | 8589 |
| 78 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 79 | Ga0315915_1001412 | 3300033464 | Bacteria | 28995 |
| 80 | Ga0400489_61760 | 3300039093 | Bacteria | 1260 |
| 81 | Ga0453684_0407438 | 3300044712 | Bacteria | 1521 |
| 82 | Ga0466968_0018642 | 3300044735 | Bacteria | 2785 |
| 83 | Ga0451576_0157814 | 3300045051 | Bacteria | 2367 |
| 84 | Ga0495591_048903 | 3300046458 | Bacteria | 1164 |
| 85 | Ga0495650_0003553 | 3300046471 | Bacteria | 11284 |
| 86 | Ga0495584_0000990 | 3300046491 | Bacteria | 17819 |
| 87 | Ga0495596_0000409 | 3300046500 | Bacteria | 27456 |
| 88 | Ga0495606_0014217 | 3300046507 | Bacteria | 6228 |
| 89 | Ga0495632_0009050 | 3300046519 | Bacteria | 6036 |
| 90 | Ga0495597_0000130 | 3300046542 | Bacteria | 68087 |
| 91 | Ga0495633_0175999 | 3300046558 | Bacteria | 985 |
| 92 | Ga0495625_0009024 | 3300046660 | Bacteria | 8420 |
| 93 | Ga0495661_0002606 | 3300046665 | Bacteria | 13823 |
| 94 | Ga0495661_0021624 | 3300046665 | Bacteria | 4191 |
| 95 | Ga0495671_0091562 | 3300046692 | Bacteria | 1488 |
| 96 | Ga0495649_0005734 | 3300046694 | Bacteria | 7831 |
| 97 | Ga0495660_0000730 | 3300046810 | Bacteria | 24993 |
| 98 | Ga0495687_040182 | 3300047443 | Bacteria | 2063 |
| 99 | Ga0495673_0001652 | 3300047469 | Bacteria | 17220 |
| 100 | Ga0495681_0009609 | 3300047470 | Bacteria | 5940 |
| 101 | Ga0496116_0001731 | 3300048919 | Bacteria | 23842 |
| 102 | Ga0496117_0001691 | 3300048920 | Bacteria | 30611 |
| 103 | Ga0496117_0155845 | 3300048920 | Bacteria | 1344 |
| 104 | Ga0496122_0000072 | 3300048925 | Bacteria | 222436 |
| 105 | Ga0496122_0003068 | 3300048925 | Bacteria | 22527 |
| 106 | Ga0496122_0006632 | 3300048925 | Bacteria | 13201 |
| 107 | Ga0496123_0000035 | 3300048926 | Bacteria | 267288 |
| 108 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 109 | Ga0496123_0002430 | 3300048926 | Bacteria | 23169 |
| 110 | Ga0496123_0004195 | 3300048926 | Bacteria | 15396 |
| 111 | Ga0496124_0005244 | 3300048927 | Bacteria | 14684 |
| 112 | Ga0496124_0182769 | 3300048927 | Bacteria | 1612 |
| 113 | Ga0496125_0000468 | 3300048928 | Bacteria | 72148 |
| 114 | Ga0496125_0070739 | 3300048928 | Bacteria | 2730 |
| 115 | nmdc:mga03n38_37606_c1 | 3300050490 | Bacteria | 2089 |
| 116 | Ga0500560_000048 | 3300053107 | Bacteria | 11954 |
| 117 | Ga0500633_0044888 | 3300053160 | Bacteria | 1502 |
| 118 | Ga0587111_0004291 | 3300060346 | Bacteria | 2109 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009765 | Ga0123341_1011174 | Ga0123341_10111744 | 232 |
| 2 | 3300009766 | Ga0123342_1027450 | Ga0123342_10274502 | 232 |
| 3 | 3300048920 | Ga0496117_0001691 | Ga0496117_0001691_26636_27430 | 259 |
| 4 | iso_pu_bacteria | 2529292951 | 2530650142 | 264 |
| 5 | 3300032002 | Ga0307416_100173643 | Ga0307416_1001736432 | 269 |
| 6 | iso_pu_bacteria | 2513237156 | 2513987235 | 269 |
| 7 | 3300025298 | Ga0209050_1007829 | Ga0209050_10078293 | 271 |
| 8 | iso_pu_bacteria | 2585427608 | 2585900353 | 274 |
| 9 | 3300046491 | Ga0495584_0000990 | Ga0495584_0000990_7089_7916 | 275 |
| 10 | 3300046558 | Ga0495633_0175999 | Ga0495633_0175999_10_837 | 275 |
| 11 | 3300046665 | Ga0495661_0021624 | Ga0495661_0021624_1074_1901 | 275 |
| 12 | 3300053107 | Ga0500560_000048 | Ga0500560_000048_11114_11941 | 275 |
| 13 | 3300005539 | Ga0068853_100057562 | Ga0068853_1000575623 | 282 |
| 14 | 3300009093 | Ga0105240_10036083 | Ga0105240_100360836 | 282 |
| 15 | 3300009545 | Ga0105237_10002086 | Ga0105237_1000208619 | 282 |
| 16 | 3300009551 | Ga0105238_10012125 | Ga0105238_100121257 | 282 |
| 17 | 3300010375 | Ga0105239_10001046 | Ga0105239_1000104616 | 282 |
| 18 | 3300025913 | Ga0207695_10089164 | Ga0207695_100891643 | 282 |
| 19 | 3300025914 | Ga0207671_10019951 | Ga0207671_100199513 | 282 |
| 20 | 3300025924 | Ga0207694_10046717 | Ga0207694_100467172 | 282 |
| 21 | 3300026041 | Ga0207639_10240114 | Ga0207639_102401141 | 282 |
| 22 | 3300030522 | Ga0307512_10079577 | Ga0307512_100795772 | 282 |
| 23 | 3300031251 | Ga0265327_10002851 | Ga0265327_100028518 | 282 |
| 24 | 3300031852 | Ga0307410_10235839 | Ga0307410_102358392 | 282 |
| 25 | 3300031903 | Ga0307407_10146427 | Ga0307407_101464272 | 282 |
| 26 | 3300039093 | Ga0400489_61760 | Ga0400489_61760_300_1178 | 282 |
| 27 | 3300044712 | Ga0453684_0407438 | Ga0453684_0407438_218_1090 | 282 |
| 28 | 3300045051 | Ga0451576_0157814 | Ga0451576_0157814_175_1188 | 282 |
| 29 | 3300060346 | Ga0587111_0004291 | Ga0587111_0004291_212_1078 | 282 |
| 30 | iso_pu_bacteria | 2508501050 | 2508730485 | 282 |
| 31 | iso_pu_bacteria | 2511231221 | 2512036174 | 282 |
| 32 | iso_pu_bacteria | 2522572158 | 2523103654 | 282 |
| 33 | iso_pu_bacteria | 2597490356 | 2599102157 | 282 |
| 34 | iso_pu_bacteria | 2846952575 | 2846956352 | 282 |
| 35 | iso_pu_bacteria | 2848858292 | 2848861988 | 282 |
| 36 | iso_pu_bacteria | 2882456835 | 2882461819 | 282 |
| 37 | iso_pu_bacteria | 2897803580 | 2897805823 | 282 |
| 38 | iso_pu_bacteria | 3006493962 | 3006494974 | 282 |
| 39 | iso_pu_bacteria | 8054002106 | 8054008518 | 282 |
| 40 | 3300044735 | Ga0466968_0018642 | Ga0466968_0018642_397_1254 | 283 |
| 41 | iso_pu_bacteria | 2585427530 | 2585553585 | 286 |
| 42 | iso_pu_bacteria | 2585427530 | 2585557366 | 286 |
| 43 | 3300046694 | Ga0495649_0005734 | Ga0495649_0005734_3078_3959 | 289 |
| 44 | iso_pu_bacteria | 2512875026 | 2512975629 | 289 |
| 45 | iso_pu_bacteria | 2513237089 | 2513607292 | 289 |
| 46 | iso_pu_bacteria | 2513237156 | 2513989066 | 289 |
| 47 | iso_pu_bacteria | 2513237160 | 2514009142 | 289 |
| 48 | iso_pu_bacteria | 2517487022 | 2517565065 | 289 |
| 49 | iso_pu_bacteria | 2802428858 | 2802722000 | 289 |
| 50 | iso_pu_bacteria | 2802428860 | 2802735070 | 289 |
| 51 | iso_pu_bacteria | 2802428862 | 2802747633 | 289 |
| 52 | iso_pu_bacteria | 2915980308 | 2915985968 | 289 |
| 53 | iso_pu_bacteria | 2916061851 | 2916062781 | 289 |
| 54 | iso_pu_bacteria | 2937029754 | 2937035512 | 289 |
| 55 | iso_pu_bacteria | 2937078374 | 2937084084 | 289 |
| 56 | iso_pu_bacteria | 2937084907 | 2937087527 | 289 |
| 57 | iso_pu_bacteria | 2957375807 | 2957381667 | 289 |
| 58 | iso_pu_bacteria | 2960631154 | 2960636956 | 289 |
| 59 | iso_pu_bacteria | 2960680706 | 2960687049 | 289 |
| 60 | iso_pu_bacteria | 2960693952 | 2960695519 | 289 |
| 61 | iso_pu_bacteria | 2970026789 | 2970027428 | 289 |
| 62 | iso_pu_bacteria | 2970122695 | 2970123101 | 289 |
| 63 | iso_pu_bacteria | 2970143518 | 2970143938 | 289 |
| 64 | iso_pu_bacteria | 2977544691 | 2977545701 | 289 |
| 65 | iso_pu_bacteria | 8003999396 | 8004005813 | 289 |
| 66 | iso_pu_bacteria | 2508501122 | 2509112577 | 290 |
| 67 | iso_pu_bacteria | 2509276019 | 2509378681 | 290 |
| 68 | iso_pu_bacteria | 2510065059 | 2510320217 | 290 |
| 69 | iso_pu_bacteria | 2510461069 | 2510839742 | 290 |
| 70 | iso_pu_bacteria | 2512875026 | 2512973338 | 290 |
| 71 | iso_pu_bacteria | 2513237085 | 2513580963 | 290 |
| 72 | iso_pu_bacteria | 2513237088 | 2513599364 | 290 |
| 73 | iso_pu_bacteria | 2513237305 | 2514422775 | 290 |
| 74 | iso_pu_bacteria | 2516143018 | 2516210124 | 290 |
| 75 | iso_pu_bacteria | 2517487022 | 2517571659 | 290 |
| 76 | iso_pu_bacteria | 2558860100 | 2558866975 | 290 |
| 77 | iso_pu_bacteria | 2582581304 | 2585258848 | 290 |
| 78 | iso_pu_bacteria | 2582581307 | 2585273493 | 290 |
| 79 | iso_pu_bacteria | 2582581316 | 2585335346 | 290 |
| 80 | iso_pu_bacteria | 2585427530 | 2585557913 | 290 |
| 81 | iso_pu_bacteria | 2585427531 | 2585564234 | 290 |
| 82 | iso_pu_bacteria | 2585427608 | 2585902350 | 290 |
| 83 | iso_pu_bacteria | 2585427634 | 2586003843 | 290 |
| 84 | iso_pu_bacteria | 2615840626 | 2616310914 | 290 |
| 85 | iso_pu_bacteria | 2617270742 | 2617382395 | 290 |
| 86 | iso_pu_bacteria | 2617270742 | 2617386106 | 290 |
| 87 | iso_pu_bacteria | 2643221734 | 2644737149 | 290 |
| 88 | iso_pu_bacteria | 2657244999 | 2657685659 | 290 |
| 89 | iso_pu_bacteria | 2693429783 | 2694632872 | 290 |
| 90 | iso_pu_bacteria | 2693429784 | 2694639022 | 290 |
| 91 | iso_pu_bacteria | 2721755686 | 2723572412 | 290 |
| 92 | iso_pu_bacteria | 2751185821 | 2753460293 | 290 |
| 93 | iso_pu_bacteria | 2791355082 | 2792580490 | 290 |
| 94 | iso_pu_bacteria | 2791355082 | 2792580898 | 290 |
| 95 | iso_pu_bacteria | 2791355092 | 2792627575 | 290 |
| 96 | iso_pu_bacteria | 2802428859 | 2802724583 | 290 |
| 97 | iso_pu_bacteria | 2802428863 | 2802751713 | 290 |
| 98 | iso_pu_bacteria | 2802429268 | 2804755682 | 290 |
| 99 | iso_pu_bacteria | 2837651117 | 2837653522 | 290 |
| 100 | iso_pu_bacteria | 2838686498 | 2838690957 | 290 |
| 101 | iso_pu_bacteria | 2842110456 | 2842117213 | 290 |
| 102 | iso_pu_bacteria | 2842271015 | 2842275432 | 290 |
| 103 | iso_pu_bacteria | 2844454524 | 2844462184 | 290 |
| 104 | iso_pu_bacteria | 2850079185 | 2850083390 | 290 |
| 105 | iso_pu_bacteria | 2854896431 | 2854896545 | 290 |
| 106 | iso_pu_bacteria | 2854916844 | 2854917885 | 290 |
| 107 | iso_pu_bacteria | 2891373044 | 2891377889 | 290 |
| 108 | iso_pu_bacteria | 2896384573 | 2896385700 | 290 |
| 109 | iso_pu_bacteria | 2896384573 | 2896388867 | 290 |
| 110 | iso_pu_bacteria | 2896384573 | 2896389465 | 290 |
| 111 | iso_pu_bacteria | 2899275550 | 2899276132 | 290 |
| 112 | iso_pu_bacteria | 2919100787 | 2919102850 | 290 |
| 113 | iso_pu_bacteria | 2919408235 | 2919408363 | 290 |
| 114 | iso_pu_bacteria | 2919408235 | 2919413785 | 290 |
| 115 | iso_pu_bacteria | 2936381700 | 2936388039 | 290 |
| 116 | iso_pu_bacteria | 2937029754 | 2937032528 | 290 |
| 117 | iso_pu_bacteria | 2958092219 | 2958097395 | 290 |
| 118 | iso_pu_bacteria | 2965062239 | 2965066353 | 290 |
| 119 | iso_pu_bacteria | 2967728569 | 2967733954 | 290 |
| 120 | iso_pu_bacteria | 2970143518 | 2970145442 | 290 |
| 121 | iso_pu_bacteria | 2984587000 | 2984588877 | 290 |
| 122 | iso_pu_bacteria | 2989776772 | 2989781012 | 290 |
| 123 | iso_pu_bacteria | 3004211236 | 3004217540 | 290 |
| 124 | iso_pu_bacteria | 3004218560 | 3004219887 | 290 |
| 125 | iso_pu_bacteria | 3005445848 | 3005451880 | 290 |
| 126 | iso_pu_bacteria | 643692032 | 643825645 | 290 |
| 127 | iso_pu_bacteria | 8003999396 | 8004003328 | 290 |
| 128 | iso_pu_bacteria | 8005246636 | 8005251489 | 290 |
| 129 | iso_pu_bacteria | 8049293176 | 8049297631 | 290 |
| 130 | iso_pu_bacteria | 8055431914 | 8055436168 | 290 |
| 131 | iso_pu_bacteria | 8057132660 | 8057133177 | 290 |
| 132 | iso_pu_bacteria | 2515154107 | 2515613378 | 292 |
| 133 | iso_pu_bacteria | 2582581866 | 2585398260 | 292 |
| 134 | iso_pu_bacteria | 2936996657 | 2936998870 | 292 |
| 135 | iso_pu_bacteria | 2937113482 | 2937115928 | 292 |
| 136 | iso_pu_bacteria | 2957415311 | 2957417125 | 292 |
| 137 | iso_pu_bacteria | 2977523885 | 2977525700 | 292 |
| 138 | iso_pu_bacteria | 8005430974 | 8005437343 | 292 |
| 139 | 3300006946 | Ga0079104_1003775 | Ga0079104_10037753 | 293 |
| 140 | 3300022739 | Ga0228711_1018171 | Ga0228711_10181712 | 293 |
| 141 | 3300022740 | Ga0228710_1015174 | Ga0228710_10151747 | 293 |
| 142 | 3300027111 | Ga0209281_1001303 | Ga0209281_100130320 | 293 |
| 143 | 3300027666 | Ga0209282_1000615 | Ga0209282_100061523 | 293 |
| 144 | 3300031967 | Ga0315914_1005970 | Ga0315914_100597023 | 293 |
| 145 | 3300031967 | Ga0315914_1011098 | Ga0315914_10110984 | 293 |
| 146 | 3300033430 | Ga0315913_1014093 | Ga0315913_10140937 | 293 |
| 147 | 3300033464 | Ga0315915_1001412 | Ga0315915_10014124 | 293 |
| 148 | 3300046458 | Ga0495591_048903 | Ga0495591_048903_244_1137 | 293 |
| 149 | 3300046471 | Ga0495650_0003553 | Ga0495650_0003553_2211_3104 | 293 |
| 150 | 3300046500 | Ga0495596_0000409 | Ga0495596_0000409_17882_18775 | 293 |
| 151 | 3300046507 | Ga0495606_0014217 | Ga0495606_0014217_416_1309 | 293 |
| 152 | 3300046519 | Ga0495632_0009050 | Ga0495632_0009050_1454_2347 | 293 |
| 153 | 3300046660 | Ga0495625_0009024 | Ga0495625_0009024_3776_4669 | 293 |
| 154 | 3300046665 | Ga0495661_0002606 | Ga0495661_0002606_7359_8252 | 293 |
| 155 | 3300046810 | Ga0495660_0000730 | Ga0495660_0000730_19181_20074 | 293 |
| 156 | iso_pu_bacteria | 2937848649 | 2937854239 | 293 |
| 157 | 3300002773 | JGI25152J39213_1019541 | JGI25152J39213_10195412 | 294 |
| 158 | 3300003187 | JGI25151J46595_10037440 | JGI25151J46595_100374402 | 294 |
| 159 | 3300003215 | JGI25153J46596_10048955 | JGI25153J46596_100489552 | 294 |
| 160 | 3300003790 | Ga0055528_1007979 | Ga0055528_10079793 | 294 |
| 161 | 3300003790 | Ga0055528_1016184 | Ga0055528_10161843 | 294 |
| 162 | 3300003794 | Ga0055531_10004993 | Ga0055531_100049932 | 294 |
| 163 | 3300005367 | Ga0070667_100065661 | Ga0070667_1000656612 | 294 |
| 164 | 3300005548 | Ga0070665_100147258 | Ga0070665_1001472581 | 294 |
| 165 | 3300005548 | Ga0070665_100161959 | Ga0070665_1001619592 | 294 |
| 166 | 3300005563 | Ga0068855_100355579 | Ga0068855_1003555792 | 294 |
| 167 | 3300005578 | Ga0068854_100044602 | Ga0068854_1000446022 | 294 |
| 168 | 3300005616 | Ga0068852_100075313 | Ga0068852_1000753133 | 294 |
| 169 | 3300005834 | Ga0068851_10031030 | Ga0068851_100310302 | 294 |
| 170 | 3300006048 | Ga0075363_100071184 | Ga0075363_1000711842 | 294 |
| 171 | 3300009011 | Ga0105251_10082457 | Ga0105251_100824572 | 294 |
| 172 | 3300009174 | Ga0105241_10471416 | Ga0105241_104714161 | 294 |
| 173 | 3300009177 | Ga0105248_10113477 | Ga0105248_101134772 | 294 |
| 174 | 3300009766 | Ga0123342_1028976 | Ga0123342_10289762 | 294 |
| 175 | 3300015265 | Ga0182005_1000435 | Ga0182005_100043516 | 294 |
| 176 | 3300017792 | Ga0163161_10000267 | Ga0163161_1000026743 | 294 |
| 177 | 3300025233 | Ga0209437_100050 | Ga0209437_100050113 | 294 |
| 178 | 3300025233 | Ga0209437_100312 | Ga0209437_10031267 | 294 |
| 179 | 3300025245 | Ga0207425_1028045 | Ga0207425_10280451 | 294 |
| 180 | 3300025253 | Ga0209677_100223 | Ga0209677_10022335 | 294 |
| 181 | 3300025258 | Ga0209129_1000251 | Ga0209129_100025163 | 294 |
| 182 | 3300025261 | Ga0209233_1000037 | Ga0209233_1000037155 | 294 |
| 183 | 3300025273 | Ga0209673_1002281 | Ga0209673_100228110 | 294 |
| 184 | 3300025273 | Ga0209673_1003409 | Ga0209673_10034092 | 294 |
| 185 | 3300025292 | Ga0209676_1012836 | Ga0209676_10128366 | 294 |
| 186 | 3300025294 | Ga0209025_1000042 | Ga0209025_1000042197 | 294 |
| 187 | 3300025294 | Ga0209025_1018708 | Ga0209025_10187083 | 294 |
| 188 | 3300025295 | Ga0209564_1000112 | Ga0209564_100011219 | 294 |
| 189 | 3300025297 | Ga0209758_1000460 | Ga0209758_100046063 | 294 |
| 190 | 3300025298 | Ga0209050_1044407 | Ga0209050_10444072 | 294 |
| 191 | 3300025299 | Ga0209256_1000715 | Ga0209256_100071533 | 294 |
| 192 | 3300025299 | Ga0209256_1005030 | Ga0209256_10050304 | 294 |
| 193 | 3300025321 | Ga0207656_10017746 | Ga0207656_100177462 | 294 |
| 194 | 3300025735 | Ga0207713_1009301 | Ga0207713_10093012 | 294 |
| 195 | 3300025911 | Ga0207654_10359573 | Ga0207654_103595731 | 294 |
| 196 | 3300025913 | Ga0207695_10000036 | Ga0207695_10000036458 | 294 |
| 197 | 3300025914 | Ga0207671_10000345 | Ga0207671_1000034557 | 294 |
| 198 | 3300025941 | Ga0207711_10148500 | Ga0207711_101485001 | 294 |
| 199 | 3300025949 | Ga0207667_10273057 | Ga0207667_102730572 | 294 |
| 200 | 3300025981 | Ga0207640_10039611 | Ga0207640_100396112 | 294 |
| 201 | 3300026078 | Ga0207702_10120478 | Ga0207702_101204782 | 294 |
| 202 | 3300026142 | Ga0207698_10048900 | Ga0207698_100489003 | 294 |
| 203 | 3300027111 | Ga0209281_1000102 | Ga0209281_1000102179 | 294 |
| 204 | 3300027907 | Ga0207428_10020952 | Ga0207428_100209523 | 294 |
| 205 | 3300027907 | Ga0207428_10133819 | Ga0207428_101338192 | 294 |
| 206 | 3300028379 | Ga0268266_10149621 | Ga0268266_101496211 | 294 |
| 207 | 3300028794 | Ga0307515_10078429 | Ga0307515_100784292 | 294 |
| 208 | 3300031967 | Ga0315914_1000004 | Ga0315914_1000004249 | 294 |
| 209 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003356 | 294 |
| 210 | 3300046542 | Ga0495597_0000130 | Ga0495597_0000130_57848_58744 | 294 |
| 211 | 3300046692 | Ga0495671_0091562 | Ga0495671_0091562_192_1088 | 294 |
| 212 | 3300047443 | Ga0495687_040182 | Ga0495687_040182_759_1643 | 294 |
| 213 | 3300047469 | Ga0495673_0001652 | Ga0495673_0001652_2885_3781 | 294 |
| 214 | 3300047470 | Ga0495681_0009609 | Ga0495681_0009609_1389_2285 | 294 |
| 215 | 3300048919 | Ga0496116_0001731 | Ga0496116_0001731_9371_10255 | 294 |
| 216 | 3300048920 | Ga0496117_0155845 | Ga0496117_0155845_216_1100 | 294 |
| 217 | 3300048925 | Ga0496122_0000072 | Ga0496122_0000072_220419_221303 | 294 |
| 218 | 3300048925 | Ga0496122_0003068 | Ga0496122_0003068_13103_13987 | 294 |
| 219 | 3300048925 | Ga0496122_0006632 | Ga0496122_0006632_11517_12401 | 294 |
| 220 | 3300048926 | Ga0496123_0000035 | Ga0496123_0000035_265271_266155 | 294 |
| 221 | 3300048926 | Ga0496123_0000066 | Ga0496123_0000066_163171_164070 | 294 |
| 222 | 3300048926 | Ga0496123_0002430 | Ga0496123_0002430_9310_10194 | 294 |
| 223 | 3300048926 | Ga0496123_0004195 | Ga0496123_0004195_2778_3662 | 294 |
| 224 | 3300048927 | Ga0496124_0005244 | Ga0496124_0005244_9217_10101 | 294 |
| 225 | 3300048927 | Ga0496124_0182769 | Ga0496124_0182769_223_1107 | 294 |
| 226 | 3300048928 | Ga0496125_0000468 | Ga0496125_0000468_51912_52877 | 294 |
| 227 | 3300048928 | Ga0496125_0070739 | Ga0496125_0070739_744_1628 | 294 |
| 228 | 3300050490 | nmdc:mga03n38_37606_c1 | nmdc:mga03n38_37606_c1_800_1696 | 294 |
| 229 | 3300053160 | Ga0500633_0044888 | Ga0500633_0044888_218_1102 | 294 |
| 230 | iso_pu_bacteria | 2513237084 | 2513572958 | 294 |
| 231 | iso_pu_bacteria | 2515154113 | 2515637922 | 294 |
| 232 | iso_pu_bacteria | 2724679232 | 2725949083 | 294 |
| 233 | iso_pu_bacteria | 2791355267 | 2793366445 | 294 |
| 234 | iso_pu_bacteria | 2933586486 | 2933590106 | 294 |
| 235 | iso_pu_bacteria | 2936367885 | 2936373830 | 294 |
| 236 | iso_pu_bacteria | 8005695170 | 8005696136 | 294 |
| 237 | iso_pu_bacteria | 8056375014 | 8056380157 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lou-assembly1.cif.gz_A | crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9615 | 1 | 282 |
| 3lou-assembly1.cif.gz_B | crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9592 | 3 | 282 |
| 3lou-assembly1.cif.gz_A | crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9582 | 1 | 282 |
| 3n0v-assembly1.cif.gz_D | crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution | 0.9578 | 3 | 281 |
| 3n0v-assembly1.cif.gz_C | crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution | 0.9564 | 3 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n0vB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9453 | 3 | 85 | 3.30.70.260 |
| 3nrbA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9392 | 2 | 85 | 3.30.70.260 |
| 3louD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9341 | 3 | 85 | 3.30.70.260 |
| af_A0A1D6PML4_87_165_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9277 | 6 | 78 | 3.30.70.260 |
| 3n0vB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9236 | 3 | 85 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5IJP2-F1-model_v4 | deleted | 0.9944 | 1 | 65 |
|
| AF-A0A7X8Y2C9-F1-model_v4 | Formyltetrahydrofolate deformylase (EC 3.5.1.10) | 0.989 | 1 | 190 |
GO:0006189
GO:0006730 GO:0008864 |
| AF-A0A7X8Y2C9-F1-model_v4 | Formyltetrahydrofolate deformylase (EC 3.5.1.10) | 0.9839 | 1 | 190 |
GO:0006189
GO:0006730 GO:0008864 |
| AF-Q0PRM6-F1-model_v4 | 4B1 | 0.9836 | 1 | 146 |
GO:0006189
GO:0008864 |
| AF-A0A839X4G7-F1-model_v4 | deleted | 0.9805 | 1 | 70 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar