F350263

General Info

Members Datasets Scaffolds Average Seq Length
237 199 118 292

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0157814|Ga0451576_0157814_175_1188
Length 337
Sequence VALSGDARQSGLAPFPEQAWSFRIKRVQARADRDTQTSHFLCPFNGRRAMSDTGSDYILTISCPDAVGIVFAVSGFLAERSCNIIDSAQFGDRISGLFFLRVHFSAGSGGPSQASLEADFAAHVAERFAMTWKLHDAGRRQRVLIMVSKFGHCLNDLLYRYRTGYLPIEIPAIVSNHRDFYQLAAWHNIPFHHIPVGPDNKAQQEERLLEIVETEKVDLVVLARYMQVLSGRLCERMAGRVINIHHSFLPSFKGAKPYHQAHTRGVKLIGATAHYVTSNLDEGPIIEQEAERVDHTMTPDDLVAIGRDIENVVLARAVRYHVEHRVLLNGNKTVVFR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
14 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
19 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
20 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
21 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
22 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
23 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
24 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
25 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
26 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
27 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
28 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
29 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
30 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
31 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
32 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
33 2643221734 Bosea sp. Root670 Isolate Unclassified
34 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
35 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
36 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
37 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
38 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
39 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
40 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
41 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
42 2791355267 Rhizobium sp. L18 Isolate Nodule
43 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
44 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
45 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
46 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
47 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
48 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
49 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
50 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
51 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
52 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
53 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
54 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
55 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
56 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
57 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
58 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
59 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
60 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
61 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
62 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
63 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
64 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
65 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
66 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
67 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
68 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
69 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
70 2936381700 Rhizobium chutanense C16 Isolate Unclassified
71 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
72 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
73 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
74 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
75 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
76 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
77 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
78 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
79 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
80 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
81 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
82 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
83 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
84 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
85 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
86 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
87 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
88 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
89 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
90 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
91 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
92 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
93 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
94 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
95 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
96 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
117 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
122 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
159 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
160 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
188 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
189 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
191 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
192 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
193 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
194 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
195 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
196 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
197 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
198 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
199 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.37
Metatranscriptomes 0.42
Isolates 50.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 11.39
Nodule 35.44
Rhizoplane 0
Rhizosphere 33.33
Stem 0
Stem Tuber 0
Unclassified 19.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1019541 3300002773 Bacteria 1230
2 JGI25151J46595_10037440 3300003187 Bacteria 1819
3 JGI25153J46596_10048955 3300003215 Bacteria 1230
4 Ga0055528_1007979 3300003790 Bacteria 4606
5 Ga0055528_1016184 3300003790 Bacteria 2651
6 Ga0055531_10004993 3300003794 Bacteria 7871
7 Ga0070667_100065661 3300005367 Bacteria 3081
8 Ga0068853_100057562 3300005539 Bacteria 3355
9 Ga0070665_100147258 3300005548 Bacteria 2357
10 Ga0070665_100161959 3300005548 Bacteria 2239
11 Ga0068855_100355579 3300005563 Bacteria 1612
12 Ga0068854_100044602 3300005578 Bacteria 3148
13 Ga0068852_100075313 3300005616 Bacteria 2977
14 Ga0068851_10031030 3300005834 Bacteria 2652
15 Ga0075363_100071184 3300006048 Bacteria 1889
16 Ga0079104_1003775 3300006946 Bacteria 6819
17 Ga0105251_10082457 3300009011 Bacteria 1485
18 Ga0105240_10036083 3300009093 Bacteria 6365
19 Ga0105241_10471416 3300009174 Bacteria 1114
20 Ga0105248_10113477 3300009177 Bacteria 3056
21 Ga0105237_10002086 3300009545 Bacteria 25280
22 Ga0105238_10012125 3300009551 Bacteria 8688
23 Ga0123341_1011174 3300009765 Bacteria 8176
24 Ga0123342_1027450 3300009766 Bacteria 3182
25 Ga0123342_1028976 3300009766 Bacteria 2925
26 Ga0105239_10001046 3300010375 Bacteria 38548
27 Ga0182005_1000435 3300015265 Bacteria 22162
28 Ga0163161_10000267 3300017792 Bacteria 45913
29 Ga0228711_1018171 3300022739 Bacteria 6758
30 Ga0228710_1015174 3300022740 Bacteria 8554
31 Ga0209437_100050 3300025233 Bacteria 394010
32 Ga0209437_100312 3300025233 Bacteria 65593
33 Ga0207425_1028045 3300025245 Bacteria 1144
34 Ga0209677_100223 3300025253 Bacteria 40538
35 Ga0209129_1000251 3300025258 Bacteria 56210
36 Ga0209233_1000037 3300025261 Bacteria 554620
37 Ga0209673_1002281 3300025273 Bacteria 13713
38 Ga0209673_1003409 3300025273 Bacteria 9420
39 Ga0209676_1012836 3300025292 Bacteria 3257
40 Ga0209025_1000042 3300025294 Bacteria 370577
41 Ga0209025_1018708 3300025294 Bacteria 3903
42 Ga0209564_1000112 3300025295 Bacteria 211939
43 Ga0209758_1000460 3300025297 Bacteria 67486
44 Ga0209050_1007829 3300025298 Bacteria 5872
45 Ga0209050_1044407 3300025298 Bacteria 1189
46 Ga0209256_1000715 3300025299 Bacteria 44055
47 Ga0209256_1005030 3300025299 Bacteria 7889
48 Ga0207656_10017746 3300025321 Bacteria 2792
49 Ga0207713_1009301 3300025735 Bacteria 5555
50 Ga0207654_10359573 3300025911 Bacteria 1004
51 Ga0207695_10000036 3300025913 Bacteria 477897
52 Ga0207695_10089164 3300025913 Bacteria 3102
53 Ga0207671_10000345 3300025914 Bacteria 68112
54 Ga0207671_10019951 3300025914 Bacteria 5114
55 Ga0207694_10046717 3300025924 Bacteria 3347
56 Ga0207711_10148500 3300025941 Bacteria 2114
57 Ga0207667_10273057 3300025949 Bacteria 1728
58 Ga0207640_10039611 3300025981 Bacteria 2984
59 Ga0207639_10240114 3300026041 Bacteria 1575
60 Ga0207702_10120478 3300026078 Bacteria 2347
61 Ga0207698_10048900 3300026142 Bacteria 3214
62 Ga0209281_1000102 3300027111 Bacteria 221665
63 Ga0209281_1001303 3300027111 Bacteria 15920
64 Ga0209282_1000615 3300027666 Bacteria 17495
65 Ga0207428_10020952 3300027907 Bacteria 5542
66 Ga0207428_10133819 3300027907 Bacteria 1896
67 Ga0268266_10149621 3300028379 Bacteria 2103
68 Ga0307515_10078429 3300028794 Bacteria 4343
69 Ga0307512_10079577 3300030522 Bacteria 2366
70 Ga0265327_10002851 3300031251 Bacteria 17423
71 Ga0307410_10235839 3300031852 Bacteria 1415
72 Ga0307407_10146427 3300031903 Bacteria 1530
73 Ga0315914_1000004 3300031967 Bacteria 288534
74 Ga0315914_1005970 3300031967 Bacteria 17494
75 Ga0315914_1011098 3300031967 Bacteria 10939
76 Ga0307416_100173643 3300032002 Bacteria 2010
77 Ga0315913_1014093 3300033430 Bacteria 8589
78 Ga0315915_1000003 3300033464 Bacteria 407996
79 Ga0315915_1001412 3300033464 Bacteria 28995
80 Ga0400489_61760 3300039093 Bacteria 1260
81 Ga0453684_0407438 3300044712 Bacteria 1521
82 Ga0466968_0018642 3300044735 Bacteria 2785
83 Ga0451576_0157814 3300045051 Bacteria 2367
84 Ga0495591_048903 3300046458 Bacteria 1164
85 Ga0495650_0003553 3300046471 Bacteria 11284
86 Ga0495584_0000990 3300046491 Bacteria 17819
87 Ga0495596_0000409 3300046500 Bacteria 27456
88 Ga0495606_0014217 3300046507 Bacteria 6228
89 Ga0495632_0009050 3300046519 Bacteria 6036
90 Ga0495597_0000130 3300046542 Bacteria 68087
91 Ga0495633_0175999 3300046558 Bacteria 985
92 Ga0495625_0009024 3300046660 Bacteria 8420
93 Ga0495661_0002606 3300046665 Bacteria 13823
94 Ga0495661_0021624 3300046665 Bacteria 4191
95 Ga0495671_0091562 3300046692 Bacteria 1488
96 Ga0495649_0005734 3300046694 Bacteria 7831
97 Ga0495660_0000730 3300046810 Bacteria 24993
98 Ga0495687_040182 3300047443 Bacteria 2063
99 Ga0495673_0001652 3300047469 Bacteria 17220
100 Ga0495681_0009609 3300047470 Bacteria 5940
101 Ga0496116_0001731 3300048919 Bacteria 23842
102 Ga0496117_0001691 3300048920 Bacteria 30611
103 Ga0496117_0155845 3300048920 Bacteria 1344
104 Ga0496122_0000072 3300048925 Bacteria 222436
105 Ga0496122_0003068 3300048925 Bacteria 22527
106 Ga0496122_0006632 3300048925 Bacteria 13201
107 Ga0496123_0000035 3300048926 Bacteria 267288
108 Ga0496123_0000066 3300048926 Bacteria 210327
109 Ga0496123_0002430 3300048926 Bacteria 23169
110 Ga0496123_0004195 3300048926 Bacteria 15396
111 Ga0496124_0005244 3300048927 Bacteria 14684
112 Ga0496124_0182769 3300048927 Bacteria 1612
113 Ga0496125_0000468 3300048928 Bacteria 72148
114 Ga0496125_0070739 3300048928 Bacteria 2730
115 nmdc:mga03n38_37606_c1 3300050490 Bacteria 2089
116 Ga0500560_000048 3300053107 Bacteria 11954
117 Ga0500633_0044888 3300053160 Bacteria 1502
118 Ga0587111_0004291 3300060346 Bacteria 2109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009765 Ga0123341_1011174 Ga0123341_10111744 232
2 3300009766 Ga0123342_1027450 Ga0123342_10274502 232
3 3300048920 Ga0496117_0001691 Ga0496117_0001691_26636_27430 259
4 iso_pu_bacteria 2529292951 2530650142 264
5 3300032002 Ga0307416_100173643 Ga0307416_1001736432 269
6 iso_pu_bacteria 2513237156 2513987235 269
7 3300025298 Ga0209050_1007829 Ga0209050_10078293 271
8 iso_pu_bacteria 2585427608 2585900353 274
9 3300046491 Ga0495584_0000990 Ga0495584_0000990_7089_7916 275
10 3300046558 Ga0495633_0175999 Ga0495633_0175999_10_837 275
11 3300046665 Ga0495661_0021624 Ga0495661_0021624_1074_1901 275
12 3300053107 Ga0500560_000048 Ga0500560_000048_11114_11941 275
13 3300005539 Ga0068853_100057562 Ga0068853_1000575623 282
14 3300009093 Ga0105240_10036083 Ga0105240_100360836 282
15 3300009545 Ga0105237_10002086 Ga0105237_1000208619 282
16 3300009551 Ga0105238_10012125 Ga0105238_100121257 282
17 3300010375 Ga0105239_10001046 Ga0105239_1000104616 282
18 3300025913 Ga0207695_10089164 Ga0207695_100891643 282
19 3300025914 Ga0207671_10019951 Ga0207671_100199513 282
20 3300025924 Ga0207694_10046717 Ga0207694_100467172 282
21 3300026041 Ga0207639_10240114 Ga0207639_102401141 282
22 3300030522 Ga0307512_10079577 Ga0307512_100795772 282
23 3300031251 Ga0265327_10002851 Ga0265327_100028518 282
24 3300031852 Ga0307410_10235839 Ga0307410_102358392 282
25 3300031903 Ga0307407_10146427 Ga0307407_101464272 282
26 3300039093 Ga0400489_61760 Ga0400489_61760_300_1178 282
27 3300044712 Ga0453684_0407438 Ga0453684_0407438_218_1090 282
28 3300045051 Ga0451576_0157814 Ga0451576_0157814_175_1188 282
29 3300060346 Ga0587111_0004291 Ga0587111_0004291_212_1078 282
30 iso_pu_bacteria 2508501050 2508730485 282
31 iso_pu_bacteria 2511231221 2512036174 282
32 iso_pu_bacteria 2522572158 2523103654 282
33 iso_pu_bacteria 2597490356 2599102157 282
34 iso_pu_bacteria 2846952575 2846956352 282
35 iso_pu_bacteria 2848858292 2848861988 282
36 iso_pu_bacteria 2882456835 2882461819 282
37 iso_pu_bacteria 2897803580 2897805823 282
38 iso_pu_bacteria 3006493962 3006494974 282
39 iso_pu_bacteria 8054002106 8054008518 282
40 3300044735 Ga0466968_0018642 Ga0466968_0018642_397_1254 283
41 iso_pu_bacteria 2585427530 2585553585 286
42 iso_pu_bacteria 2585427530 2585557366 286
43 3300046694 Ga0495649_0005734 Ga0495649_0005734_3078_3959 289
44 iso_pu_bacteria 2512875026 2512975629 289
45 iso_pu_bacteria 2513237089 2513607292 289
46 iso_pu_bacteria 2513237156 2513989066 289
47 iso_pu_bacteria 2513237160 2514009142 289
48 iso_pu_bacteria 2517487022 2517565065 289
49 iso_pu_bacteria 2802428858 2802722000 289
50 iso_pu_bacteria 2802428860 2802735070 289
51 iso_pu_bacteria 2802428862 2802747633 289
52 iso_pu_bacteria 2915980308 2915985968 289
53 iso_pu_bacteria 2916061851 2916062781 289
54 iso_pu_bacteria 2937029754 2937035512 289
55 iso_pu_bacteria 2937078374 2937084084 289
56 iso_pu_bacteria 2937084907 2937087527 289
57 iso_pu_bacteria 2957375807 2957381667 289
58 iso_pu_bacteria 2960631154 2960636956 289
59 iso_pu_bacteria 2960680706 2960687049 289
60 iso_pu_bacteria 2960693952 2960695519 289
61 iso_pu_bacteria 2970026789 2970027428 289
62 iso_pu_bacteria 2970122695 2970123101 289
63 iso_pu_bacteria 2970143518 2970143938 289
64 iso_pu_bacteria 2977544691 2977545701 289
65 iso_pu_bacteria 8003999396 8004005813 289
66 iso_pu_bacteria 2508501122 2509112577 290
67 iso_pu_bacteria 2509276019 2509378681 290
68 iso_pu_bacteria 2510065059 2510320217 290
69 iso_pu_bacteria 2510461069 2510839742 290
70 iso_pu_bacteria 2512875026 2512973338 290
71 iso_pu_bacteria 2513237085 2513580963 290
72 iso_pu_bacteria 2513237088 2513599364 290
73 iso_pu_bacteria 2513237305 2514422775 290
74 iso_pu_bacteria 2516143018 2516210124 290
75 iso_pu_bacteria 2517487022 2517571659 290
76 iso_pu_bacteria 2558860100 2558866975 290
77 iso_pu_bacteria 2582581304 2585258848 290
78 iso_pu_bacteria 2582581307 2585273493 290
79 iso_pu_bacteria 2582581316 2585335346 290
80 iso_pu_bacteria 2585427530 2585557913 290
81 iso_pu_bacteria 2585427531 2585564234 290
82 iso_pu_bacteria 2585427608 2585902350 290
83 iso_pu_bacteria 2585427634 2586003843 290
84 iso_pu_bacteria 2615840626 2616310914 290
85 iso_pu_bacteria 2617270742 2617382395 290
86 iso_pu_bacteria 2617270742 2617386106 290
87 iso_pu_bacteria 2643221734 2644737149 290
88 iso_pu_bacteria 2657244999 2657685659 290
89 iso_pu_bacteria 2693429783 2694632872 290
90 iso_pu_bacteria 2693429784 2694639022 290
91 iso_pu_bacteria 2721755686 2723572412 290
92 iso_pu_bacteria 2751185821 2753460293 290
93 iso_pu_bacteria 2791355082 2792580490 290
94 iso_pu_bacteria 2791355082 2792580898 290
95 iso_pu_bacteria 2791355092 2792627575 290
96 iso_pu_bacteria 2802428859 2802724583 290
97 iso_pu_bacteria 2802428863 2802751713 290
98 iso_pu_bacteria 2802429268 2804755682 290
99 iso_pu_bacteria 2837651117 2837653522 290
100 iso_pu_bacteria 2838686498 2838690957 290
101 iso_pu_bacteria 2842110456 2842117213 290
102 iso_pu_bacteria 2842271015 2842275432 290
103 iso_pu_bacteria 2844454524 2844462184 290
104 iso_pu_bacteria 2850079185 2850083390 290
105 iso_pu_bacteria 2854896431 2854896545 290
106 iso_pu_bacteria 2854916844 2854917885 290
107 iso_pu_bacteria 2891373044 2891377889 290
108 iso_pu_bacteria 2896384573 2896385700 290
109 iso_pu_bacteria 2896384573 2896388867 290
110 iso_pu_bacteria 2896384573 2896389465 290
111 iso_pu_bacteria 2899275550 2899276132 290
112 iso_pu_bacteria 2919100787 2919102850 290
113 iso_pu_bacteria 2919408235 2919408363 290
114 iso_pu_bacteria 2919408235 2919413785 290
115 iso_pu_bacteria 2936381700 2936388039 290
116 iso_pu_bacteria 2937029754 2937032528 290
117 iso_pu_bacteria 2958092219 2958097395 290
118 iso_pu_bacteria 2965062239 2965066353 290
119 iso_pu_bacteria 2967728569 2967733954 290
120 iso_pu_bacteria 2970143518 2970145442 290
121 iso_pu_bacteria 2984587000 2984588877 290
122 iso_pu_bacteria 2989776772 2989781012 290
123 iso_pu_bacteria 3004211236 3004217540 290
124 iso_pu_bacteria 3004218560 3004219887 290
125 iso_pu_bacteria 3005445848 3005451880 290
126 iso_pu_bacteria 643692032 643825645 290
127 iso_pu_bacteria 8003999396 8004003328 290
128 iso_pu_bacteria 8005246636 8005251489 290
129 iso_pu_bacteria 8049293176 8049297631 290
130 iso_pu_bacteria 8055431914 8055436168 290
131 iso_pu_bacteria 8057132660 8057133177 290
132 iso_pu_bacteria 2515154107 2515613378 292
133 iso_pu_bacteria 2582581866 2585398260 292
134 iso_pu_bacteria 2936996657 2936998870 292
135 iso_pu_bacteria 2937113482 2937115928 292
136 iso_pu_bacteria 2957415311 2957417125 292
137 iso_pu_bacteria 2977523885 2977525700 292
138 iso_pu_bacteria 8005430974 8005437343 292
139 3300006946 Ga0079104_1003775 Ga0079104_10037753 293
140 3300022739 Ga0228711_1018171 Ga0228711_10181712 293
141 3300022740 Ga0228710_1015174 Ga0228710_10151747 293
142 3300027111 Ga0209281_1001303 Ga0209281_100130320 293
143 3300027666 Ga0209282_1000615 Ga0209282_100061523 293
144 3300031967 Ga0315914_1005970 Ga0315914_100597023 293
145 3300031967 Ga0315914_1011098 Ga0315914_10110984 293
146 3300033430 Ga0315913_1014093 Ga0315913_10140937 293
147 3300033464 Ga0315915_1001412 Ga0315915_10014124 293
148 3300046458 Ga0495591_048903 Ga0495591_048903_244_1137 293
149 3300046471 Ga0495650_0003553 Ga0495650_0003553_2211_3104 293
150 3300046500 Ga0495596_0000409 Ga0495596_0000409_17882_18775 293
151 3300046507 Ga0495606_0014217 Ga0495606_0014217_416_1309 293
152 3300046519 Ga0495632_0009050 Ga0495632_0009050_1454_2347 293
153 3300046660 Ga0495625_0009024 Ga0495625_0009024_3776_4669 293
154 3300046665 Ga0495661_0002606 Ga0495661_0002606_7359_8252 293
155 3300046810 Ga0495660_0000730 Ga0495660_0000730_19181_20074 293
156 iso_pu_bacteria 2937848649 2937854239 293
157 3300002773 JGI25152J39213_1019541 JGI25152J39213_10195412 294
158 3300003187 JGI25151J46595_10037440 JGI25151J46595_100374402 294
159 3300003215 JGI25153J46596_10048955 JGI25153J46596_100489552 294
160 3300003790 Ga0055528_1007979 Ga0055528_10079793 294
161 3300003790 Ga0055528_1016184 Ga0055528_10161843 294
162 3300003794 Ga0055531_10004993 Ga0055531_100049932 294
163 3300005367 Ga0070667_100065661 Ga0070667_1000656612 294
164 3300005548 Ga0070665_100147258 Ga0070665_1001472581 294
165 3300005548 Ga0070665_100161959 Ga0070665_1001619592 294
166 3300005563 Ga0068855_100355579 Ga0068855_1003555792 294
167 3300005578 Ga0068854_100044602 Ga0068854_1000446022 294
168 3300005616 Ga0068852_100075313 Ga0068852_1000753133 294
169 3300005834 Ga0068851_10031030 Ga0068851_100310302 294
170 3300006048 Ga0075363_100071184 Ga0075363_1000711842 294
171 3300009011 Ga0105251_10082457 Ga0105251_100824572 294
172 3300009174 Ga0105241_10471416 Ga0105241_104714161 294
173 3300009177 Ga0105248_10113477 Ga0105248_101134772 294
174 3300009766 Ga0123342_1028976 Ga0123342_10289762 294
175 3300015265 Ga0182005_1000435 Ga0182005_100043516 294
176 3300017792 Ga0163161_10000267 Ga0163161_1000026743 294
177 3300025233 Ga0209437_100050 Ga0209437_100050113 294
178 3300025233 Ga0209437_100312 Ga0209437_10031267 294
179 3300025245 Ga0207425_1028045 Ga0207425_10280451 294
180 3300025253 Ga0209677_100223 Ga0209677_10022335 294
181 3300025258 Ga0209129_1000251 Ga0209129_100025163 294
182 3300025261 Ga0209233_1000037 Ga0209233_1000037155 294
183 3300025273 Ga0209673_1002281 Ga0209673_100228110 294
184 3300025273 Ga0209673_1003409 Ga0209673_10034092 294
185 3300025292 Ga0209676_1012836 Ga0209676_10128366 294
186 3300025294 Ga0209025_1000042 Ga0209025_1000042197 294
187 3300025294 Ga0209025_1018708 Ga0209025_10187083 294
188 3300025295 Ga0209564_1000112 Ga0209564_100011219 294
189 3300025297 Ga0209758_1000460 Ga0209758_100046063 294
190 3300025298 Ga0209050_1044407 Ga0209050_10444072 294
191 3300025299 Ga0209256_1000715 Ga0209256_100071533 294
192 3300025299 Ga0209256_1005030 Ga0209256_10050304 294
193 3300025321 Ga0207656_10017746 Ga0207656_100177462 294
194 3300025735 Ga0207713_1009301 Ga0207713_10093012 294
195 3300025911 Ga0207654_10359573 Ga0207654_103595731 294
196 3300025913 Ga0207695_10000036 Ga0207695_10000036458 294
197 3300025914 Ga0207671_10000345 Ga0207671_1000034557 294
198 3300025941 Ga0207711_10148500 Ga0207711_101485001 294
199 3300025949 Ga0207667_10273057 Ga0207667_102730572 294
200 3300025981 Ga0207640_10039611 Ga0207640_100396112 294
201 3300026078 Ga0207702_10120478 Ga0207702_101204782 294
202 3300026142 Ga0207698_10048900 Ga0207698_100489003 294
203 3300027111 Ga0209281_1000102 Ga0209281_1000102179 294
204 3300027907 Ga0207428_10020952 Ga0207428_100209523 294
205 3300027907 Ga0207428_10133819 Ga0207428_101338192 294
206 3300028379 Ga0268266_10149621 Ga0268266_101496211 294
207 3300028794 Ga0307515_10078429 Ga0307515_100784292 294
208 3300031967 Ga0315914_1000004 Ga0315914_1000004249 294
209 3300033464 Ga0315915_1000003 Ga0315915_1000003356 294
210 3300046542 Ga0495597_0000130 Ga0495597_0000130_57848_58744 294
211 3300046692 Ga0495671_0091562 Ga0495671_0091562_192_1088 294
212 3300047443 Ga0495687_040182 Ga0495687_040182_759_1643 294
213 3300047469 Ga0495673_0001652 Ga0495673_0001652_2885_3781 294
214 3300047470 Ga0495681_0009609 Ga0495681_0009609_1389_2285 294
215 3300048919 Ga0496116_0001731 Ga0496116_0001731_9371_10255 294
216 3300048920 Ga0496117_0155845 Ga0496117_0155845_216_1100 294
217 3300048925 Ga0496122_0000072 Ga0496122_0000072_220419_221303 294
218 3300048925 Ga0496122_0003068 Ga0496122_0003068_13103_13987 294
219 3300048925 Ga0496122_0006632 Ga0496122_0006632_11517_12401 294
220 3300048926 Ga0496123_0000035 Ga0496123_0000035_265271_266155 294
221 3300048926 Ga0496123_0000066 Ga0496123_0000066_163171_164070 294
222 3300048926 Ga0496123_0002430 Ga0496123_0002430_9310_10194 294
223 3300048926 Ga0496123_0004195 Ga0496123_0004195_2778_3662 294
224 3300048927 Ga0496124_0005244 Ga0496124_0005244_9217_10101 294
225 3300048927 Ga0496124_0182769 Ga0496124_0182769_223_1107 294
226 3300048928 Ga0496125_0000468 Ga0496125_0000468_51912_52877 294
227 3300048928 Ga0496125_0070739 Ga0496125_0070739_744_1628 294
228 3300050490 nmdc:mga03n38_37606_c1 nmdc:mga03n38_37606_c1_800_1696 294
229 3300053160 Ga0500633_0044888 Ga0500633_0044888_218_1102 294
230 iso_pu_bacteria 2513237084 2513572958 294
231 iso_pu_bacteria 2515154113 2515637922 294
232 iso_pu_bacteria 2724679232 2725949083 294
233 iso_pu_bacteria 2791355267 2793366445 294
234 iso_pu_bacteria 2933586486 2933590106 294
235 iso_pu_bacteria 2936367885 2936373830 294
236 iso_pu_bacteria 8005695170 8005696136 294
237 iso_pu_bacteria 8056375014 8056380157 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

141

318

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9615 1 282
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9592 3 282
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9582 1 282
3n0v-assembly1.cif.gz_D crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9578 3 281
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9564 3 281
ID Description Score Start End Superfamily
3n0vB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9453 3 85 3.30.70.260
3nrbA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9392 2 85 3.30.70.260
3louD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9341 3 85 3.30.70.260
af_A0A1D6PML4_87_165_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9277 6 78 3.30.70.260
3n0vB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9236 3 85 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A3D5IJP2-F1-model_v4 deleted 0.9944 1 65
AF-A0A7X8Y2C9-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.989 1 190 GO:0006189
GO:0006730
GO:0008864
AF-A0A7X8Y2C9-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9839 1 190 GO:0006189
GO:0006730
GO:0008864
AF-Q0PRM6-F1-model_v4 4B1 0.9836 1 146 GO:0006189
GO:0008864
AF-A0A839X4G7-F1-model_v4 deleted 0.9805 1 70

Feature Viewer

pLDDT pTM Quality
90.55 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map