F349642

General Info

Members Datasets Scaffolds Average Seq Length
237 128 474 287

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10005199|rootH1_1000519926
Length 306
Sequence MRDPSTTSEVPAVVRVIGQWLDSDFRRSDQPDPETLPDRVNWERTLPFIFLHLGCAAVIWVGWSWPAVIAAALLYVIRMFAITGFYHRYFSHRTYRTSRLVQFLFAILGNSSMQRGPLWWAATHRXXXXHADHEQDAHSPAISGFLWSHIGWLTSARNFPTEYRSIPDLSKYPELVFLNRFDQLVPFAYGLVMLGSGRLLEKLMPQSGVTTWQFFVTTVLLHGTLFINSLAHLWGGRRYETTLGEGWHNNHHRYPHSTRQGFRWWEFDPTYAGLRLMSWMGLIWDLRAVPANVLEEGRKSPTPQKA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10005199 3300003323 Bacteria 25881
2 Ga0065712_10068838 3300005290 Bacteria 8836
3 Ga0065715_10089404 3300005293 Bacteria 10495
4 Ga0065715_10206181 3300005293 Bacteria 1336
5 Ga0070683_100000886 3300005329 Bacteria 22228
6 Ga0070683_100003309 3300005329 Bacteria 13036
7 Ga0070683_100084903 3300005329 Bacteria 2967
8 Ga0070690_100057732 3300005330 Bacteria 2491
9 Ga0070670_100040019 3300005331 Bacteria 4032
10 Ga0070660_100017810 3300005339 Bacteria 5182
11 Ga0070660_100405210 3300005339 Bacteria 1128
12 Ga0070675_100110251 3300005354 Unclassified 2327
13 Ga0070674_100117255 3300005356 Bacteria 1965
14 Ga0070673_100050882 3300005364 Bacteria 3241
15 Ga0070667_100503916 3300005367 Bacteria 1110
16 Ga0070713_100131766 3300005436 Bacteria 2205
17 Ga0070713_100248430 3300005436 Bacteria 1622
18 Ga0070662_100052189 3300005457 Bacteria 2955
19 Ga0070681_10000954 3300005458 Bacteria 24356
20 Ga0070681_10002242 3300005458 Bacteria 17633
21 Ga0070681_10149580 3300005458 Bacteria 2262
22 Ga0070679_100000951 3300005530 Bacteria 25171
23 Ga0070684_100004419 3300005535 Bacteria 10698
24 Ga0070684_100063447 3300005535 Bacteria 3239
25 Ga0070684_100086105 3300005535 Bacteria 2788
26 Ga0070672_100027140 3300005543 Bacteria 4269
27 Ga0070696_100030169 3300005546 Bacteria 3711
28 Ga0070665_100013699 3300005548 Bacteria 8159
29 Ga0070704_100306305 3300005549 Bacteria 1325
30 Ga0068855_100002073 3300005563 Bacteria 24833
31 Ga0068857_100000213 3300005577 Bacteria 37993
32 Ga0068857_100022514 3300005577 Bacteria 5545
33 Ga0068856_100000842 3300005614 Bacteria 33106
34 Ga0068856_100003072 3300005614 Bacteria 17044
35 Ga0068856_100155754 3300005614 Bacteria 2295
36 Ga0068856_100581499 3300005614 Bacteria 1141
37 Ga0068859_100523136 3300005617 Bacteria 1281
38 Ga0068859_100541265 3300005617 Bacteria 1259
39 Ga0068864_100012771 3300005618 Bacteria 6942
40 Ga0068866_10053331 3300005718 Bacteria 2067
41 Ga0068862_100202182 3300005844 Bacteria 1792
42 Ga0070715_10125417 3300006163 Bacteria 1229
43 Ga0097621_100128796 3300006237 Bacteria 2152
44 Ga0097621_100183449 3300006237 Bacteria 1809
45 Ga0097621_100454595 3300006237 Bacteria 1154
46 Ga0097621_100515708 3300006237 Bacteria 1084
47 Ga0068871_100024020 3300006358 Bacteria 4724
48 Ga0068871_100040519 3300006358 Bacteria 3731
49 Ga0068871_100043339 3300006358 Bacteria 3614
50 Ga0068871_100135665 3300006358 Bacteria 2090
51 Ga0068865_100034948 3300006881 Bacteria 3376
52 Ga0068865_100073722 3300006881 Bacteria 2428
53 Ga0068865_100444439 3300006881 Bacteria 1071
54 Ga0097620_100191416 3300006931 Bacteria 2130
55 Ga0097620_100523196 3300006931 Bacteria 1281
56 Ga0097620_100541303 3300006931 Bacteria 1259
57 Ga0105240_10000620 3300009093 Bacteria 65714
58 Ga0105240_10002104 3300009093 Bacteria 32575
59 Ga0105240_10007135 3300009093 Bacteria 16275
60 Ga0105240_10029785 3300009093 Bacteria 7103
61 Ga0105240_10043194 3300009093 Bacteria 5738
62 Ga0105240_10277696 3300009093 Bacteria 1926
63 Ga0105245_10034837 3300009098 Bacteria 4466
64 Ga0105245_10165665 3300009098 Bacteria 2101
65 Ga0105245_10281446 3300009098 Bacteria 1625
66 Ga0105241_10004731 3300009174 Bacteria 10034
67 Ga0105242_10352053 3300009176 Bacteria 1360
68 Ga0105242_10508027 3300009176 Bacteria 1147
69 Ga0105248_10007501 3300009177 Bacteria 11966
70 Ga0105248_10030092 3300009177 Bacteria 6059
71 Ga0105237_10003051 3300009545 Bacteria 20204
72 Ga0105237_10026940 3300009545 Bacteria 5872
73 Ga0105237_10028236 3300009545 Bacteria 5718
74 Ga0105237_10322402 3300009545 Bacteria 1549
75 Ga0105238_10001821 3300009551 Bacteria 21366
76 Ga0105238_10003161 3300009551 Bacteria 16429
77 Ga0105238_10085169 3300009551 Bacteria 3149
78 Ga0105238_10157000 3300009551 Bacteria 2250
79 Ga0105249_10003880 3300009553 Bacteria 12913
80 Ga0105239_10003241 3300010375 Bacteria 20096
81 Ga0105239_10099681 3300010375 Bacteria 3212
82 Ga0105239_10833964 3300010375 Bacteria 1057
83 Ga0157370_10000415 3300013104 Bacteria 53917
84 Ga0157370_10000946 3300013104 Bacteria 36859
85 Ga0157370_10014337 3300013104 Bacteria 8110
86 Ga0157370_10030309 3300013104 Bacteria 5301
87 Ga0157370_10420390 3300013104 Bacteria 1230
88 Ga0157369_10006336 3300013105 Bacteria 13731
89 Ga0157369_10462884 3300013105 Bacteria 1313
90 Ga0157369_10553518 3300013105 Bacteria 1189
91 Ga0157374_10027867 3300013296 Bacteria 5100
92 Ga0157378_10125033 3300013297 Unclassified 2375
93 Ga0157372_10041540 3300013307 Bacteria 5086
94 Ga0157372_10273434 3300013307 Bacteria 1963
95 Ga0157375_10003093 3300013308 Bacteria 14447
96 Ga0157375_10102663 3300013308 Bacteria 2945
97 Ga0163163_10183816 3300014325 Bacteria 2138
98 Ga0157379_10115154 3300014968 Bacteria 2417
99 Ga0157379_10163303 3300014968 Bacteria 2010
100 Ga0157376_10233458 3300014969 Bacteria 1710
101 Ga0157376_10248516 3300014969 Bacteria 1660
102 Ga0157376_10333127 3300014969 Bacteria 1447
103 Ga0157376_10465444 3300014969 Bacteria 1236
104 Ga0163161_10032819 3300017792 Bacteria 3709
105 Ga0213876_10028147 3300021384 Bacteria 2963
106 Ga0213876_10084469 3300021384 Unclassified 1680
107 Ga0213876_10091749 3300021384 Bacteria 1609
108 Ga0213875_10007065 3300021388 Bacteria 5837
109 Ga0213875_10025659 3300021388 Bacteria 2806
110 Ga0207645_10089353 3300025907 Bacteria 1981
111 Ga0207654_10169767 3300025911 Bacteria 1415
112 Ga0207707_10002623 3300025912 Bacteria 16099
113 Ga0207707_10120356 3300025912 Bacteria 2295
114 Ga0207707_10256307 3300025912 Unclassified 1519
115 Ga0207695_10003796 3300025913 Bacteria 20951
116 Ga0207695_10007985 3300025913 Bacteria 13338
117 Ga0207695_10008236 3300025913 Bacteria 13086
118 Ga0207695_10013158 3300025913 Bacteria 9877
119 Ga0207695_10015084 3300025913 Bacteria 9115
120 Ga0207695_10248633 3300025913 Bacteria 1678
121 Ga0207695_10400555 3300025913 Bacteria 1257
122 Ga0207671_10003010 3300025914 Bacteria 17286
123 Ga0207671_10009101 3300025914 Bacteria 8343
124 Ga0207671_10020510 3300025914 Bacteria 5030
125 Ga0207671_10031491 3300025914 Bacteria 3952
126 Ga0207657_10018719 3300025919 Bacteria 6600
127 Ga0207652_10031528 3300025921 Bacteria 4453
128 Ga0207681_10382735 3300025923 Bacteria 1133
129 Ga0207694_10022772 3300025924 Bacteria 4752
130 Ga0207694_10294314 3300025924 Bacteria 1335
131 Ga0207650_10039612 3300025925 Bacteria 3444
132 Ga0207650_10362814 3300025925 Bacteria 1194
133 Ga0207687_10004571 3300025927 Bacteria 9207
134 Ga0207687_10012908 3300025927 Bacteria 5458
135 Ga0207687_10029102 3300025927 Bacteria 3715
136 Ga0207700_10150275 3300025928 Bacteria 1924
137 Ga0207700_10249910 3300025928 Bacteria 1514
138 Ga0207644_10099553 3300025931 Bacteria 2182
139 Ga0207686_10078391 3300025934 Bacteria 2148
140 Ga0207670_10134526 3300025936 Bacteria 1816
141 Ga0207669_10022986 3300025937 Bacteria 3321
142 Ga0207704_10012377 3300025938 Bacteria 4237
143 Ga0207704_10053722 3300025938 Bacteria 2451
144 Ga0207704_10240757 3300025938 Bacteria 1352
145 Ga0207665_10150776 3300025939 Bacteria 1665
146 Ga0207691_10040988 3300025940 Bacteria 4278
147 Ga0207711_10000490 3300025941 Bacteria 40819
148 Ga0207661_10088498 3300025944 Bacteria 2574
149 Ga0207661_10135750 3300025944 Bacteria 2112
150 Ga0207667_10000607 3300025949 Bacteria 46284
151 Ga0207667_10003394 3300025949 Bacteria 19653
152 Ga0207667_10011945 3300025949 Bacteria 10053
153 Ga0207667_10104954 3300025949 Unclassified 2915
154 Ga0207651_10030191 3300025960 Bacteria 3447
155 Ga0207712_10060911 3300025961 Bacteria 2677
156 Ga0207677_10057548 3300026023 Bacteria 2670
157 Ga0207639_10073303 3300026041 Bacteria 2684
158 Ga0207639_10140949 3300026041 Bacteria 2008
159 Ga0207678_10335727 3300026067 Bacteria 1302
160 Ga0207708_10091656 3300026075 Bacteria 2344
161 Ga0207702_10022860 3300026078 Bacteria 5188
162 Ga0207702_10039750 3300026078 Bacteria 3943
163 Ga0207648_10019220 3300026089 Bacteria 6166
164 Ga0207648_10110012 3300026089 Bacteria 2419
165 Ga0207648_10168898 3300026089 Bacteria 1933
166 Ga0207648_10600751 3300026089 Bacteria 1014
167 Ga0207674_10000109 3300026116 Bacteria 94920
168 Ga0207674_10002389 3300026116 Bacteria 23729
169 Ga0207683_10029147 3300026121 Bacteria 4778
170 Ga0207683_10078747 3300026121 Bacteria 2921
171 Ga0207683_10173718 3300026121 Bacteria 1952
172 Ga0207698_10027396 3300026142 Bacteria 4045
173 Ga0209971_1007043 3300027682 Bacteria 2667
174 Ga0209974_10030358 3300027876 Bacteria 1791
175 Ga0268266_10009270 3300028379 Bacteria 8683
176 Ga0268266_10048308 3300028379 Bacteria 3648
177 Ga0268266_10186595 3300028379 Bacteria 1891
178 Ga0268264_10361533 3300028381 Bacteria 1385
179 Ga0307408_100263255 3300031548 Bacteria 1428
180 Ga0265313_10003098 3300031595 Bacteria 13768
181 Ga0265314_10004098 3300031711 Bacteria 13729
182 Ga0307405_10103839 3300031731 Bacteria 1912
183 Ga0307407_10072079 3300031903 Bacteria 2059
184 Ga0307409_100132372 3300031995 Bacteria 2134
185 Ga0307409_100336572 3300031995 Bacteria 1418
186 Ga0307416_100513065 3300032002 Bacteria 1265
187 Ga0307415_100053857 3300032126 Bacteria 2744
188 Ga0373953_0031795 3300035117 Bacteria 2055
189 Ga0373955_0185586 3300035172 Bacteria 1235
190 Ga0373955_0253460 3300035172 Bacteria 1055
191 Ga0373935_0045691 3300035692 Bacteria 2764
192 Ga0373933_0030255 3300035724 Bacteria 3135
193 Ga0373933_0095436 3300035724 Bacteria 1840
194 Ga0373933_0110826 3300035724 Bacteria 1712
195 Ga0373937_0008378 3300036401 Bacteria 8981
196 Ga0373937_0022658 3300036401 Bacteria 5649
197 Ga0373937_0067538 3300036401 Bacteria 3294
198 Ga0373937_0439817 3300036401 Bacteria 1238
199 Ga0373937_0475484 3300036401 Bacteria 1187
200 Ga0373925_0190995 3300037068 Bacteria 1625
201 Ga0373925_0206568 3300037068 Bacteria 1563
202 Ga0436364_0039061 3300037853 Bacteria 1716
203 Ga0436364_0058483 3300037853 Bacteria 3227
204 Ga0436364_0383836 3300037853 Unclassified 4796
205 Ga0436364_0526285 3300037853 Bacteria 3456
206 Ga0436364_0834340 3300037853 Bacteria 2462
207 Ga0436364_0932696 3300037853 Bacteria 3952
208 Ga0436364_1059161 3300037853 Bacteria 2798
209 Ga0436364_1071128 3300037853 Bacteria 12136
210 Ga0436365_0548650 3300039437 Bacteria 1266
211 Ga0436365_0682336 3300039437 Bacteria 1324
212 Ga0436365_1891365 3300039437 Bacteria 3657
213 Ga0436360_0034311 3300039438 Bacteria 14961
214 Ga0436362_0300704 3300039453 Bacteria 1456
215 Ga0495580_0011325 3300046472 Bacteria 6902
216 Ga0495580_0081122 3300046472 Bacteria 2261
217 Ga0495652_0005340 3300046529 Bacteria 12111
218 Ga0495665_0087042 3300046531 Bacteria 1642
219 Ga0495587_0001267 3300046536 Bacteria 16797
220 Ga0495587_0087844 3300046536 Bacteria 1799
221 Ga0495645_0124060 3300046543 Bacteria 1816
222 Ga0495667_0165665 3300046559 Bacteria 1421
223 Ga0495599_0009652 3300046678 Bacteria 5908
224 Ga0495674_0212653 3300047319 Bacteria 1601
225 Ga0495680_0095526 3300047322 Bacteria 2222
226 Ga0495684_0030550 3300047471 Bacteria 4136
227 Ga0495684_0118288 3300047471 Bacteria 1997
228 Ga0495602_0023721 3300048088 Bacteria 5970
229 Ga0496102_0099846 3300048905 Bacteria 2695
230 Ga0496104_0017187 3300048907 Bacteria 6580
231 Ga0496109_0000433 3300048912 Bacteria 36449
232 Ga0496110_0021818 3300048913 Bacteria 5429
233 Ga0496112_0000294 3300048915 Bacteria 32431
234 nmdc:mga08x19_9117_c1 3300050514 Bacteria 5924
235 Ga0495601_0012494 3300053077 Bacteria 5093
236 Ga0495595_0060945 3300053084 Bacteria 1766
237 Ga0530510_0177119 3300061734 Bacteria 1581
238 rootH1_10005199
239 Ga0065712_10068838
240 Ga0065715_10089404
241 Ga0065715_10206181
242 Ga0070683_100000886
243 Ga0070683_100003309
244 Ga0070683_100084903
245 Ga0070690_100057732
246 Ga0070670_100040019
247 Ga0070660_100017810
248 Ga0070660_100405210
249 Ga0070675_100110251
250 Ga0070674_100117255
251 Ga0070673_100050882
252 Ga0070667_100503916
253 Ga0070713_100131766
254 Ga0070713_100248430
255 Ga0070662_100052189
256 Ga0070681_10000954
257 Ga0070681_10002242
258 Ga0070681_10149580
259 Ga0070679_100000951
260 Ga0070684_100004419
261 Ga0070684_100063447
262 Ga0070684_100086105
263 Ga0070672_100027140
264 Ga0070696_100030169
265 Ga0070665_100013699
266 Ga0070704_100306305
267 Ga0068855_100002073
268 Ga0068857_100000213
269 Ga0068857_100022514
270 Ga0068856_100000842
271 Ga0068856_100003072
272 Ga0068856_100155754
273 Ga0068856_100581499
274 Ga0068859_100523136
275 Ga0068859_100541265
276 Ga0068864_100012771
277 Ga0068866_10053331
278 Ga0068862_100202182
279 Ga0070715_10125417
280 Ga0097621_100128796
281 Ga0097621_100183449
282 Ga0097621_100454595
283 Ga0097621_100515708
284 Ga0068871_100024020
285 Ga0068871_100040519
286 Ga0068871_100043339
287 Ga0068871_100135665
288 Ga0068865_100034948
289 Ga0068865_100073722
290 Ga0068865_100444439
291 Ga0097620_100191416
292 Ga0097620_100523196
293 Ga0097620_100541303
294 Ga0105240_10000620
295 Ga0105240_10002104
296 Ga0105240_10007135
297 Ga0105240_10029785
298 Ga0105240_10043194
299 Ga0105240_10277696
300 Ga0105245_10034837
301 Ga0105245_10165665
302 Ga0105245_10281446
303 Ga0105241_10004731
304 Ga0105242_10352053
305 Ga0105242_10508027
306 Ga0105248_10007501
307 Ga0105248_10030092
308 Ga0105237_10003051
309 Ga0105237_10026940
310 Ga0105237_10028236
311 Ga0105237_10322402
312 Ga0105238_10001821
313 Ga0105238_10003161
314 Ga0105238_10085169
315 Ga0105238_10157000
316 Ga0105249_10003880
317 Ga0105239_10003241
318 Ga0105239_10099681
319 Ga0105239_10833964
320 Ga0157370_10000415
321 Ga0157370_10000946
322 Ga0157370_10014337
323 Ga0157370_10030309
324 Ga0157370_10420390
325 Ga0157369_10006336
326 Ga0157369_10462884
327 Ga0157369_10553518
328 Ga0157374_10027867
329 Ga0157378_10125033
330 Ga0157372_10041540
331 Ga0157372_10273434
332 Ga0157375_10003093
333 Ga0157375_10102663
334 Ga0163163_10183816
335 Ga0157379_10115154
336 Ga0157379_10163303
337 Ga0157376_10233458
338 Ga0157376_10248516
339 Ga0157376_10333127
340 Ga0157376_10465444
341 Ga0163161_10032819
342 Ga0213876_10028147
343 Ga0213876_10084469
344 Ga0213876_10091749
345 Ga0213875_10007065
346 Ga0213875_10025659
347 Ga0207645_10089353
348 Ga0207654_10169767
349 Ga0207707_10002623
350 Ga0207707_10120356
351 Ga0207707_10256307
352 Ga0207695_10003796
353 Ga0207695_10007985
354 Ga0207695_10008236
355 Ga0207695_10013158
356 Ga0207695_10015084
357 Ga0207695_10248633
358 Ga0207695_10400555
359 Ga0207671_10003010
360 Ga0207671_10009101
361 Ga0207671_10020510
362 Ga0207671_10031491
363 Ga0207657_10018719
364 Ga0207652_10031528
365 Ga0207681_10382735
366 Ga0207694_10022772
367 Ga0207694_10294314
368 Ga0207650_10039612
369 Ga0207650_10362814
370 Ga0207687_10004571
371 Ga0207687_10012908
372 Ga0207687_10029102
373 Ga0207700_10150275
374 Ga0207700_10249910
375 Ga0207644_10099553
376 Ga0207686_10078391
377 Ga0207670_10134526
378 Ga0207669_10022986
379 Ga0207704_10012377
380 Ga0207704_10053722
381 Ga0207704_10240757
382 Ga0207665_10150776
383 Ga0207691_10040988
384 Ga0207711_10000490
385 Ga0207661_10088498
386 Ga0207661_10135750
387 Ga0207667_10000607
388 Ga0207667_10003394
389 Ga0207667_10011945
390 Ga0207667_10104954
391 Ga0207651_10030191
392 Ga0207712_10060911
393 Ga0207677_10057548
394 Ga0207639_10073303
395 Ga0207639_10140949
396 Ga0207678_10335727
397 Ga0207708_10091656
398 Ga0207702_10022860
399 Ga0207702_10039750
400 Ga0207648_10019220
401 Ga0207648_10110012
402 Ga0207648_10168898
403 Ga0207648_10600751
404 Ga0207674_10000109
405 Ga0207674_10002389
406 Ga0207683_10029147
407 Ga0207683_10078747
408 Ga0207683_10173718
409 Ga0207698_10027396
410 Ga0209971_1007043
411 Ga0209974_10030358
412 Ga0268266_10009270
413 Ga0268266_10048308
414 Ga0268266_10186595
415 Ga0268264_10361533
416 Ga0307408_100263255
417 Ga0265313_10003098
418 Ga0265314_10004098
419 Ga0307405_10103839
420 Ga0307407_10072079
421 Ga0307409_100132372
422 Ga0307409_100336572
423 Ga0307416_100513065
424 Ga0307415_100053857
425 Ga0373953_0031795
426 Ga0373955_0185586
427 Ga0373955_0253460
428 Ga0373935_0045691
429 Ga0373933_0030255
430 Ga0373933_0095436
431 Ga0373933_0110826
432 Ga0373937_0008378
433 Ga0373937_0022658
434 Ga0373937_0067538
435 Ga0373937_0439817
436 Ga0373937_0475484
437 Ga0373925_0190995
438 Ga0373925_0206568
439 Ga0436364_0039061
440 Ga0436364_0058483
441 Ga0436364_0383836
442 Ga0436364_0526285
443 Ga0436364_0834340
444 Ga0436364_0932696
445 Ga0436364_1059161
446 Ga0436364_1071128
447 Ga0436365_0548650
448 Ga0436365_0682336
449 Ga0436365_1891365
450 Ga0436360_0034311
451 Ga0436362_0300704
452 Ga0495580_0011325
453 Ga0495580_0081122
454 Ga0495652_0005340
455 Ga0495665_0087042
456 Ga0495587_0001267
457 Ga0495587_0087844
458 Ga0495645_0124060
459 Ga0495667_0165665
460 Ga0495599_0009652
461 Ga0495674_0212653
462 Ga0495680_0095526
463 Ga0495684_0030550
464 Ga0495684_0118288
465 Ga0495602_0023721
466 Ga0496102_0099846
467 Ga0496104_0017187
468 Ga0496109_0000433
469 Ga0496110_0021818
470 Ga0496112_0000294
471 nmdc:mga08x19_9117_c1
472 Ga0495601_0012494
473 Ga0495595_0060945
474 Ga0530510_0177119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.7133 29 296
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7035 26 302
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.6507 26 302
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.6495 29 296
4ry2-assembly1.cif.gz_B crystal structure of the peptidase-containing abc transporter pcat1 0.3087 44 229
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.3383 45 226 3.30.40.10
4uiqB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3162 44 222 1.10.490.10
af_A0A0R4IUC3_81_265_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.311 67 229 1.20.58.70
4uiqB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3103 44 222 1.10.490.10
af_B8JI27_1_175_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3079 62 229 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A2E8I4P3-F1-model_v4 deleted 0.8421 41 295
AF-A0A356R0K8-F1-model_v4 Acyl-CoA desaturase 0.8394 43 295 GO:0006633
GO:0016020
GO:0016717
AF-A0A2E8GEU6-F1-model_v4 Acyl-CoA desaturase 0.8352 41 295 GO:0006633
GO:0016020
GO:0016717
AF-A0A0H4JD27-F1-model_v4 Stearoyl-CoA 9-desaturase 0.8286 38 292 GO:0006633
GO:0016020
GO:0016717
AF-A0A7Z9L2Q2-F1-model_v4 Acyl-CoA desaturase 0.8283 45 295 GO:0006633
GO:0016020
GO:0016717

Map