F349163

General Info

Members Datasets Scaffolds Average Seq Length
236 113 236 260

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10476184|Ga0207679_104761842
Length 294
Sequence LVVIRLTAIASYNHSLCIMRAMPIQVFTGTKGAKEMKSAFRKNKKHYLQEGLGLALFMFSACFFSAMIFSANGSWNHAIPSVLIKNVAMGLIMGLTALFIFYSPWTAPGGSHINPAVTLTFLRLDKMCRYDAMFYVIFQLIGGTIAVYIMQAIMGAVLTDPPVSSVVTIPGRAGQWWALITEFAISFFTMTMVLFTSHHKWMKQYTRIFSAILVCCWVIVASPVSGFGMNPARSFASALASGIWKSFWIYLFIPMAGMLSAAEFFLFIQRRAWLKNDTTYNQVMNDKIYLASRI

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 97.88
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000247 3300003203 Bacteria 24051
2 rootH1_10172603 3300003316 Bacteria 1437
3 rootL2_10064184 3300003322 Bacteria 1908
4 rootH1_10365625 3300003323 Unclassified 1628
5 Ga0065712_10069485 3300005290 Bacteria 7198
6 Ga0065712_10211996 3300005290 Bacteria 1069
7 Ga0065715_10166129 3300005293 Bacteria 1585
8 Ga0065707_10087544 3300005295 Bacteria 4986
9 Ga0070676_10045290 3300005328 Bacteria 2562
10 Ga0070676_10412743 3300005328 Bacteria 942
11 Ga0070683_100015405 3300005329 Bacteria 6715
12 Ga0070690_100484780 3300005330 Bacteria 922
13 Ga0070670_100013715 3300005331 Bacteria 6944
14 Ga0070670_100039032 3300005331 Bacteria 4082
15 Ga0070670_100055849 3300005331 Bacteria 3389
16 Ga0070670_100060998 3300005331 Bacteria 3238
17 Ga0070670_100127652 3300005331 Unclassified 2195
18 Ga0070670_100402739 3300005331 Bacteria 1208
19 Ga0070670_100495445 3300005331 Bacteria 1086
20 Ga0070677_10004769 3300005333 Unclassified 4442
21 Ga0068869_100004629 3300005334 Bacteria 8578
22 Ga0068869_100029729 3300005334 Bacteria 3831
23 Ga0068869_100125140 3300005334 Bacteria 1970
24 Ga0068869_100397794 3300005334 Bacteria 1132
25 Ga0070666_10000045 3300005335 Bacteria 110131
26 Ga0070666_10075454 3300005335 Bacteria 2299
27 Ga0070666_10086574 3300005335 Bacteria 2147
28 Ga0068868_100037955 3300005338 Bacteria 3737
29 Ga0068868_100053064 3300005338 Bacteria 3193
30 Ga0068868_100180811 3300005338 Bacteria 1749
31 Ga0070689_100052001 3300005340 Bacteria 3168
32 Ga0070661_100022882 3300005344 Bacteria 4476
33 Ga0070668_100035002 3300005347 Bacteria 3828
34 Ga0070668_100096085 3300005347 Bacteria 2341
35 Ga0070669_100064908 3300005353 Bacteria 2689
36 Ga0070669_100092484 3300005353 Bacteria 2270
37 Ga0070675_100084821 3300005354 Bacteria 2645
38 Ga0070675_100095917 3300005354 Bacteria 2491
39 Ga0070675_100304190 3300005354 Bacteria 1405
40 Ga0070673_100018853 3300005364 Bacteria 4944
41 Ga0070673_100033359 3300005364 Unclassified 3887
42 Ga0070673_100050908 3300005364 Bacteria 3241
43 Ga0070673_100129444 3300005364 Unclassified 2115
44 Ga0070688_100082647 3300005365 Bacteria 2082
45 Ga0070688_100271322 3300005365 Bacteria 1215
46 Ga0070667_100043568 3300005367 Unclassified 3767
47 Ga0070667_100060696 3300005367 Bacteria 3200
48 Ga0070667_100626776 3300005367 Bacteria 992
49 Ga0070663_100388095 3300005455 Unclassified 1139
50 Ga0070662_100015482 3300005457 Bacteria 5110
51 Ga0070662_100026397 3300005457 Bacteria 4023
52 Ga0068867_100101943 3300005459 Bacteria 2193
53 Ga0070685_10027611 3300005466 Bacteria 3139
54 Ga0070685_10192160 3300005466 Bacteria 1321
55 Ga0070698_100011917 3300005471 Bacteria 9224
56 Ga0070684_100005569 3300005535 Bacteria 9668
57 Ga0068853_100024374 3300005539 Bacteria 5071
58 Ga0070672_100014802 3300005543 Bacteria 5534
59 Ga0070665_100017921 3300005548 Bacteria 7110
60 Ga0068855_100275164 3300005563 Bacteria 1871
61 Ga0070664_100008815 3300005564 Bacteria 8174
62 Ga0070664_100393000 3300005564 Bacteria 1267
63 Ga0068857_100008420 3300005577 Bacteria 8912
64 Ga0068857_100075229 3300005577 Bacteria 3011
65 Ga0068857_100311297 3300005577 Bacteria 1453
66 Ga0068857_100422102 3300005577 Bacteria 1244
67 Ga0068854_100013540 3300005578 Bacteria 5357
68 Ga0068859_100000007 3300005617 Bacteria 390070
69 Ga0068859_100006787 3300005617 Bacteria 11631
70 Ga0068859_100011289 3300005617 Bacteria 8989
71 Ga0068859_100023075 3300005617 Bacteria 6240
72 Ga0068859_100027241 3300005617 Bacteria 5733
73 Ga0068859_100047571 3300005617 Bacteria 4310
74 Ga0068864_100002527 3300005618 Bacteria 15109
75 Ga0068864_100014757 3300005618 Bacteria 6491
76 Ga0068864_100424605 3300005618 Bacteria 1267
77 Ga0068866_10092838 3300005718 Unclassified 1648
78 Ga0068861_100024716 3300005719 Bacteria 4347
79 Ga0068861_100053089 3300005719 Bacteria 3082
80 Ga0068861_100521589 3300005719 Unclassified 1078
81 Ga0068870_10013193 3300005840 Bacteria 3879
82 Ga0068863_100010692 3300005841 Bacteria 8912
83 Ga0068863_100225300 3300005841 Bacteria 1807
84 Ga0068860_100001457 3300005843 Bacteria 25578
85 Ga0068860_100006294 3300005843 Bacteria 11924
86 Ga0068860_100006676 3300005843 Bacteria 11591
87 Ga0068860_100051976 3300005843 Bacteria 3898
88 Ga0068860_100087961 3300005843 Bacteria 2957
89 Ga0068862_100016832 3300005844 Bacteria 6087
90 Ga0068862_100107349 3300005844 Bacteria 2448
91 Ga0068862_100166838 3300005844 Bacteria 1969
92 Ga0081539_10000042 3300005985 Bacteria 289955
93 Ga0081539_10100614 3300005985 Bacteria 1474
94 Ga0097621_100154530 3300006237 Bacteria 1969
95 Ga0097621_100242455 3300006237 Bacteria 1576
96 Ga0068871_100006923 3300006358 Bacteria 8078
97 Ga0068871_100011634 3300006358 Bacteria 6460
98 Ga0068865_100006180 3300006881 Bacteria 7302
99 Ga0097620_100000007 3300006931 Bacteria 390070
100 Ga0097620_100006787 3300006931 Bacteria 11631
101 Ga0097620_100011289 3300006931 Bacteria 8989
102 Ga0097620_100023073 3300006931 Bacteria 6240
103 Ga0097620_100027241 3300006931 Bacteria 5733
104 Ga0097620_100047571 3300006931 Bacteria 4310
105 Ga0105240_10003804 3300009093 Bacteria 23321
106 Ga0105240_10006777 3300009093 Bacteria 16758
107 Ga0105247_10002534 3300009101 Bacteria 12403
108 Ga0105247_10046791 3300009101 Bacteria 2656
109 Ga0105241_10000277 3300009174 Bacteria 38322
110 Ga0105241_10260662 3300009174 Unclassified 1473
111 Ga0105242_10024276 3300009176 Unclassified 4787
112 Ga0105242_10305785 3300009176 Bacteria 1453
113 Ga0105242_10473536 3300009176 Bacteria 1185
114 Ga0105237_10001795 3300009545 Bacteria 27714
115 Ga0105237_10076416 3300009545 Bacteria 3339
116 Ga0105238_10308786 3300009551 Bacteria 1566
117 Ga0105249_10018313 3300009553 Bacteria 6227
118 Ga0105249_10018951 3300009553 Bacteria 6134
119 Ga0105249_10046318 3300009553 Bacteria 3958
120 Ga0105249_10308822 3300009553 Unclassified 1589
121 Ga0105239_10108012 3300010375 Bacteria 3083
122 Ga0105239_10288139 3300010375 Bacteria 1849
123 Ga0105246_10006818 3300011119 Bacteria 6980
124 Ga0105246_10076995 3300011119 Bacteria 2365
125 Ga0157369_10117183 3300013105 Bacteria 2827
126 Ga0157374_10001174 3300013296 Bacteria 22340
127 Ga0157374_10047823 3300013296 Bacteria 3967
128 Ga0157374_10067394 3300013296 Bacteria 3365
129 Ga0157374_10097032 3300013296 Bacteria 2820
130 Ga0157378_10010165 3300013297 Bacteria 8208
131 Ga0157378_10024846 3300013297 Bacteria 5277
132 Ga0157378_10047415 3300013297 Bacteria 3821
133 Ga0157378_10085922 3300013297 Bacteria 2851
134 Ga0157378_10357849 3300013297 Unclassified 1428
135 Ga0163162_10000667 3300013306 Bacteria 31830
136 Ga0163162_10005451 3300013306 Bacteria 12289
137 Ga0163162_10012412 3300013306 Bacteria 8321
138 Ga0163162_10062374 3300013306 Bacteria 3768
139 Ga0163162_10203275 3300013306 Bacteria 2110
140 Ga0163162_10307964 3300013306 Bacteria 1716
141 Ga0163162_10529082 3300013306 Bacteria 1308
142 Ga0157372_10281788 3300013307 Bacteria 1932
143 Ga0157375_10002186 3300013308 Bacteria 16910
144 Ga0157375_10043649 3300013308 Bacteria 4350
145 Ga0157375_10123291 3300013308 Bacteria 2704
146 Ga0157375_10173165 3300013308 Bacteria 2307
147 Ga0157375_10420517 3300013308 Bacteria 1502
148 Ga0157375_10513250 3300013308 Bacteria 1362
149 Ga0157375_10568323 3300013308 Bacteria 1295
150 Ga0163163_10000697 3300014325 Bacteria 28555
151 Ga0163163_10049073 3300014325 Bacteria 4153
152 Ga0163163_10102869 3300014325 Bacteria 2881
153 Ga0163163_10254166 3300014325 Bacteria 1808
154 Ga0157380_10011254 3300014326 Bacteria 6459
155 Ga0157380_10132889 3300014326 Bacteria 2126
156 Ga0157377_10010230 3300014745 Bacteria 4633
157 Ga0157379_10023387 3300014968 Bacteria 5484
158 Ga0157379_10100487 3300014968 Bacteria 2596
159 Ga0157379_10450369 3300014968 Bacteria 1188
160 Ga0157376_10000609 3300014969 Bacteria 23132
161 Ga0157376_10002997 3300014969 Bacteria 11584
162 Ga0157376_10239229 3300014969 Bacteria 1691
163 Ga0157376_10645327 3300014969 Bacteria 1058
164 Ga0207642_10007458 3300025899 Unclassified 3698
165 Ga0207710_10012939 3300025900 Bacteria 3514
166 Ga0207680_10000043 3300025903 Bacteria 64325
167 Ga0207680_10172708 3300025903 Bacteria 1457
168 Ga0207645_10000958 3300025907 Bacteria 23890
169 Ga0207654_10000590 3300025911 Bacteria 20481
170 Ga0207695_10022770 3300025913 Bacteria 7099
171 Ga0207671_10007140 3300025914 Bacteria 9745
172 Ga0207649_10182326 3300025920 Bacteria 1470
173 Ga0207681_10018229 3300025923 Bacteria 4422
174 Ga0207681_10050468 3300025923 Bacteria 2815
175 Ga0207694_10220910 3300025924 Bacteria 1546
176 Ga0207650_10026252 3300025925 Bacteria 4154
177 Ga0207650_10120180 3300025925 Bacteria 2044
178 Ga0207659_10138347 3300025926 Bacteria 1888
179 Ga0207644_10028882 3300025931 Bacteria 3844
180 Ga0207706_10031736 3300025933 Bacteria 4704
181 Ga0207706_10077522 3300025933 Bacteria 2923
182 Ga0207686_10039963 3300025934 Unclassified 2849
183 Ga0207670_10210943 3300025936 Bacteria 1481
184 Ga0207704_10107714 3300025938 Bacteria 1875
185 Ga0207691_10245642 3300025940 Bacteria 1546
186 Ga0207689_10000603 3300025942 Bacteria 34426
187 Ga0207689_10004687 3300025942 Bacteria 12337
188 Ga0207689_10010512 3300025942 Bacteria 7969
189 Ga0207689_10012437 3300025942 Bacteria 7274
190 Ga0207689_10016830 3300025942 Bacteria 6188
191 Ga0207689_10126742 3300025942 Bacteria 2100
192 Ga0207661_10115870 3300025944 Bacteria 2274
193 Ga0207679_10091102 3300025945 Bacteria 2359
194 Ga0207679_10476184 3300025945 Bacteria 1111
195 Ga0207667_10193028 3300025949 Bacteria 2089
196 Ga0207651_10054427 3300025960 Bacteria 2742
197 Ga0207651_10555107 3300025960 Bacteria 999
198 Ga0207712_10007629 3300025961 Bacteria 6839
199 Ga0207712_10096136 3300025961 Bacteria 2192
200 Ga0207668_10169337 3300025972 Bacteria 1711
201 Ga0207668_10221839 3300025972 Bacteria 1519
202 Ga0207658_10023834 3300025986 Bacteria 4276
203 Ga0207677_10045466 3300026023 Bacteria 2932
204 Ga0207703_10007090 3300026035 Bacteria 8916
205 Ga0207708_10192390 3300026075 Bacteria 1624
206 Ga0207641_10000234 3300026088 Bacteria 71612
207 Ga0207641_10065091 3300026088 Bacteria 3117
208 Ga0207641_10206506 3300026088 Bacteria 1814
209 Ga0207648_10008827 3300026089 Bacteria 9708
210 Ga0207648_10028383 3300026089 Bacteria 4961
211 Ga0207676_10019722 3300026095 Bacteria 4924
212 Ga0207676_10060867 3300026095 Bacteria 2988
213 Ga0207676_10065133 3300026095 Bacteria 2901
214 Ga0207674_10006299 3300026116 Bacteria 13987
215 Ga0207674_10335851 3300026116 Bacteria 1461
216 Ga0207675_100004950 3300026118 Bacteria 12839
217 Ga0207675_100010718 3300026118 Bacteria 8586
218 Ga0207675_100192801 3300026118 Bacteria 1955
219 Ga0207675_100292233 3300026118 Bacteria 1585
220 Ga0207683_10025430 3300026121 Bacteria 5108
221 Ga0268266_10105621 3300028379 Bacteria 2488
222 Ga0268265_10066235 3300028380 Bacteria 2792
223 Ga0268265_10170246 3300028380 Bacteria 1861
224 Ga0268265_10248435 3300028380 Bacteria 1574
225 Ga0268264_10001537 3300028381 Bacteria 21489
226 Ga0268264_10001898 3300028381 Bacteria 18956
227 Ga0268264_10023019 3300028381 Bacteria 5084
228 Ga0268264_10035796 3300028381 Bacteria 4088
229 Ga0307515_10000039 3300028794 Bacteria 323229
230 Ga0265327_10000013 3300031251 Bacteria 519549
231 Ga0265327_10018360 3300031251 Bacteria 4341
232 Ga0265327_10021369 3300031251 Bacteria 3908
233 Ga0395905_0087612 3300037471 Unclassified 2919
234 Ga0495672_0038658 3300047320 Unclassified 2909
235 nmdc:mga08y16_132414_c1 3300050511 Bacteria 2592
236 Ga0500616_0006748 3300053153 Bacteria 7443

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10045290 Ga0070676_100452903 215
2 3300005333 Ga0070677_10004769 Ga0070677_100047691 215
3 3300005334 Ga0068869_100125140 Ga0068869_1001251401 215
4 3300005335 Ga0070666_10075454 Ga0070666_100754543 215
5 3300005338 Ga0068868_100037955 Ga0068868_1000379553 215
6 3300005347 Ga0070668_100035002 Ga0070668_1000350023 215
7 3300005353 Ga0070669_100092484 Ga0070669_1000924843 215
8 3300005354 Ga0070675_100084821 Ga0070675_1000848213 215
9 3300005364 Ga0070673_100033359 Ga0070673_1000333592 215
10 3300005459 Ga0068867_100101943 Ga0068867_1001019432 215
11 3300005539 Ga0068853_100024374 Ga0068853_1000243743 215
12 3300005543 Ga0070672_100014802 Ga0070672_1000148022 215
13 3300005548 Ga0070665_100017921 Ga0070665_1000179216 215
14 3300005578 Ga0068854_100013540 Ga0068854_1000135402 215
15 3300005618 Ga0068864_100424605 Ga0068864_1004246052 215
16 3300005718 Ga0068866_10092838 Ga0068866_100928382 215
17 3300005840 Ga0068870_10013193 Ga0068870_100131935 215
18 3300005844 Ga0068862_100107349 Ga0068862_1001073493 215
19 3300006881 Ga0068865_100006180 Ga0068865_1000061805 215
20 3300025899 Ga0207642_10007458 Ga0207642_100074583 215
21 3300025907 Ga0207645_10000958 Ga0207645_1000095819 215
22 3300025934 Ga0207686_10039963 Ga0207686_100399633 215
23 3300025938 Ga0207704_10107714 Ga0207704_101077142 215
24 3300025942 Ga0207689_10004687 Ga0207689_100046875 215
25 3300026089 Ga0207648_10008827 Ga0207648_100088276 215
26 3300026118 Ga0207675_100192801 Ga0207675_1001928012 215
27 3300026121 Ga0207683_10025430 Ga0207683_100254306 215
28 3300028379 Ga0268266_10105621 Ga0268266_101056212 215
29 3300028380 Ga0268265_10170246 Ga0268265_101702462 215
30 3300005617 Ga0068859_100023075 Ga0068859_1000230755 227
31 3300006931 Ga0097620_100023073 Ga0097620_1000230734 227
32 3300031251 Ga0265327_10000013 Ga0265327_10000013253 238
33 3300005719 Ga0068861_100521589 Ga0068861_1005215891 241
34 3300025960 Ga0207651_10555107 Ga0207651_105551071 241
35 3300025972 Ga0207668_10169337 Ga0207668_101693372 241
36 3300009176 Ga0105242_10024276 Ga0105242_100242766 244
37 3300010375 Ga0105239_10288139 Ga0105239_102881393 244
38 3300011119 Ga0105246_10076995 Ga0105246_100769953 244
39 3300013297 Ga0157378_10085922 Ga0157378_100859222 244
40 3300013306 Ga0163162_10307964 Ga0163162_103079643 244
41 3300005843 Ga0068860_100087961 Ga0068860_1000879612 246
42 3300005466 Ga0070685_10192160 Ga0070685_101921602 247
43 3300005841 Ga0068863_100225300 Ga0068863_1002253002 247
44 3300026088 Ga0207641_10206506 Ga0207641_102065063 247
45 3300005577 Ga0068857_100422102 Ga0068857_1004221022 248
46 3300003316 rootH1_10172603 rootH1_101726032 249
47 3300003322 rootL2_10064184 rootL2_100641841 249
48 3300003323 rootH1_10365625 rootH1_103656252 249
49 3300005563 Ga0068855_100275164 Ga0068855_1002751642 249
50 3300025961 Ga0207712_10007629 Ga0207712_100076292 250
51 3300009093 Ga0105240_10006777 Ga0105240_1000677715 252
52 3300009174 Ga0105241_10260662 Ga0105241_102606622 252
53 3300009551 Ga0105238_10308786 Ga0105238_103087861 252
54 3300025913 Ga0207695_10022770 Ga0207695_100227701 252
55 3300025949 Ga0207667_10193028 Ga0207667_101930282 252
56 3300005290 Ga0065712_10211996 Ga0065712_102119962 253
57 3300025942 Ga0207689_10126742 Ga0207689_101267422 253
58 3300025961 Ga0207712_10096136 Ga0207712_100961363 253
59 3300005843 Ga0068860_100051976 Ga0068860_1000519763 255
60 3300009093 Ga0105240_10003804 Ga0105240_1000380413 255
61 3300009545 Ga0105237_10001795 Ga0105237_1000179511 255
62 3300025924 Ga0207694_10220910 Ga0207694_102209101 255
63 3300028381 Ga0268264_10035796 Ga0268264_100357963 255
64 3300037471 Ga0395905_0087612 Ga0395905_0087612_1146_1916 256
65 3300006237 Ga0097621_100154530 Ga0097621_1001545302 257
66 3300006358 Ga0068871_100006923 Ga0068871_1000069236 257
67 3300014969 Ga0157376_10002997 Ga0157376_100029976 257
68 3300031251 Ga0265327_10018360 Ga0265327_100183603 257
69 3300005331 Ga0070670_100039032 Ga0070670_1000390323 259
70 3300005331 Ga0070670_100060998 Ga0070670_1000609982 259
71 3300005577 Ga0068857_100075229 Ga0068857_1000752293 259
72 3300025925 Ga0207650_10120180 Ga0207650_101201802 259
73 3300005334 Ga0068869_100029729 Ga0068869_1000297293 260
74 3300005367 Ga0070667_100060696 Ga0070667_1000606963 260
75 3300005457 Ga0070662_100015482 Ga0070662_1000154823 260
76 3300025925 Ga0207650_10026252 Ga0207650_100262522 260
77 3300025933 Ga0207706_10077522 Ga0207706_100775222 260
78 3300026089 Ga0207648_10028383 Ga0207648_100283834 260
79 3300053153 Ga0500616_0006748 Ga0500616_0006748_2660_3454 260
80 3300005334 Ga0068869_100397794 Ga0068869_1003977941 261
81 3300013306 Ga0163162_10529082 Ga0163162_105290822 261
82 3300028380 Ga0268265_10248435 Ga0268265_102484352 261
83 3300006358 Ga0068871_100011634 Ga0068871_1000116349 262
84 3300014969 Ga0157376_10000609 Ga0157376_1000060918 262
85 3300031251 Ga0265327_10021369 Ga0265327_100213692 262
86 3300005329 Ga0070683_100015405 Ga0070683_1000154053 263
87 3300005331 Ga0070670_100013715 Ga0070670_1000137155 263
88 3300005331 Ga0070670_100055849 Ga0070670_1000558493 263
89 3300005338 Ga0068868_100053064 Ga0068868_1000530641 263
90 3300005340 Ga0070689_100052001 Ga0070689_1000520012 263
91 3300005344 Ga0070661_100022882 Ga0070661_1000228824 263
92 3300005354 Ga0070675_100095917 Ga0070675_1000959173 263
93 3300005364 Ga0070673_100129444 Ga0070673_1001294442 263
94 3300005365 Ga0070688_100082647 Ga0070688_1000826471 263
95 3300005367 Ga0070667_100043568 Ga0070667_1000435683 263
96 3300005455 Ga0070663_100388095 Ga0070663_1003880951 263
97 3300005457 Ga0070662_100026397 Ga0070662_1000263971 263
98 3300005466 Ga0070685_10027611 Ga0070685_100276114 263
99 3300005535 Ga0070684_100005569 Ga0070684_1000055695 263
100 3300005564 Ga0070664_100008815 Ga0070664_1000088152 263
101 3300005577 Ga0068857_100008420 Ga0068857_1000084202 263
102 3300005617 Ga0068859_100006787 Ga0068859_1000067873 263
103 3300005617 Ga0068859_100011289 Ga0068859_10001128911 263
104 3300005618 Ga0068864_100002527 Ga0068864_10000252710 263
105 3300005841 Ga0068863_100010692 Ga0068863_1000106923 263
106 3300006931 Ga0097620_100006787 Ga0097620_10000678711 263
107 3300006931 Ga0097620_100011289 Ga0097620_10001128911 263
108 3300009101 Ga0105247_10046791 Ga0105247_100467913 263
109 3300009176 Ga0105242_10305785 Ga0105242_103057852 263
110 3300009545 Ga0105237_10076416 Ga0105237_100764162 263
111 3300009553 Ga0105249_10046318 Ga0105249_100463184 263
112 3300013296 Ga0157374_10001174 Ga0157374_1000117411 263
113 3300013296 Ga0157374_10047823 Ga0157374_100478233 263
114 3300013297 Ga0157378_10010165 Ga0157378_100101656 263
115 3300013297 Ga0157378_10047415 Ga0157378_100474153 263
116 3300013297 Ga0157378_10357849 Ga0157378_103578493 263
117 3300013306 Ga0163162_10012412 Ga0163162_100124127 263
118 3300013306 Ga0163162_10203275 Ga0163162_102032752 263
119 3300013308 Ga0157375_10002186 Ga0157375_1000218617 263
120 3300013308 Ga0157375_10173165 Ga0157375_101731652 263
121 3300013308 Ga0157375_10568323 Ga0157375_105683232 263
122 3300014325 Ga0163163_10000697 Ga0163163_1000069718 263
123 3300014325 Ga0163163_10102869 Ga0163163_101028693 263
124 3300014325 Ga0163163_10254166 Ga0163163_102541662 263
125 3300014745 Ga0157377_10010230 Ga0157377_100102306 263
126 3300014968 Ga0157379_10023387 Ga0157379_100233876 263
127 3300014968 Ga0157379_10100487 Ga0157379_101004872 263
128 3300025920 Ga0207649_10182326 Ga0207649_101823262 263
129 3300025926 Ga0207659_10138347 Ga0207659_101383472 263
130 3300025933 Ga0207706_10031736 Ga0207706_100317363 263
131 3300025936 Ga0207670_10210943 Ga0207670_102109432 263
132 3300025940 Ga0207691_10245642 Ga0207691_102456422 263
133 3300025942 Ga0207689_10010512 Ga0207689_100105124 263
134 3300025942 Ga0207689_10016830 Ga0207689_100168302 263
135 3300025945 Ga0207679_10091102 Ga0207679_100911022 263
136 3300025986 Ga0207658_10023834 Ga0207658_100238342 263
137 3300026023 Ga0207677_10045466 Ga0207677_100454664 263
138 3300026088 Ga0207641_10065091 Ga0207641_100650912 263
139 3300026095 Ga0207676_10019722 Ga0207676_100197223 263
140 3300026095 Ga0207676_10060867 Ga0207676_100608673 263
141 3300026116 Ga0207674_10006299 Ga0207674_1000629911 263
142 3300028794 Ga0307515_10000039 Ga0307515_10000039230 263
143 3300005334 Ga0068869_100004629 Ga0068869_1000046296 264
144 3300005335 Ga0070666_10000045 Ga0070666_1000004519 264
145 3300005338 Ga0068868_100180811 Ga0068868_1001808112 264
146 3300005364 Ga0070673_100050908 Ga0070673_1000509083 264
147 3300005617 Ga0068859_100000007 Ga0068859_100000007311 264
148 3300005617 Ga0068859_100047571 Ga0068859_1000475712 264
149 3300005618 Ga0068864_100014757 Ga0068864_1000147573 264
150 3300005843 Ga0068860_100006294 Ga0068860_1000062942 264
151 3300005843 Ga0068860_100006676 Ga0068860_1000066767 264
152 3300006931 Ga0097620_100000007 Ga0097620_100000007312 264
153 3300006931 Ga0097620_100047571 Ga0097620_1000475712 264
154 3300009101 Ga0105247_10002534 Ga0105247_100025348 264
155 3300009174 Ga0105241_10000277 Ga0105241_1000027728 264
156 3300009176 Ga0105242_10473536 Ga0105242_104735362 264
157 3300009553 Ga0105249_10018313 Ga0105249_100183134 264
158 3300009553 Ga0105249_10018951 Ga0105249_100189517 264
159 3300011119 Ga0105246_10006818 Ga0105246_100068182 264
160 3300013306 Ga0163162_10005451 Ga0163162_100054512 264
161 3300013308 Ga0157375_10123291 Ga0157375_101232913 264
162 3300014325 Ga0163163_10049073 Ga0163163_100490734 264
163 3300014968 Ga0157379_10450369 Ga0157379_104503692 264
164 3300014969 Ga0157376_10239229 Ga0157376_102392292 264
165 3300025900 Ga0207710_10012939 Ga0207710_100129392 264
166 3300025903 Ga0207680_10000043 Ga0207680_1000004337 264
167 3300025911 Ga0207654_10000590 Ga0207654_100005904 264
168 3300025914 Ga0207671_10007140 Ga0207671_1000714011 264
169 3300025931 Ga0207644_10028882 Ga0207644_100288823 264
170 3300025942 Ga0207689_10000603 Ga0207689_1000060325 264
171 3300026035 Ga0207703_10007090 Ga0207703_100070903 264
172 3300026088 Ga0207641_10000234 Ga0207641_1000023421 264
173 3300028381 Ga0268264_10001537 Ga0268264_100015376 264
174 3300028381 Ga0268264_10023019 Ga0268264_100230193 264
175 3300005331 Ga0070670_100402739 Ga0070670_1004027392 266
176 3300005335 Ga0070666_10086574 Ga0070666_100865741 266
177 3300005843 Ga0068860_100001457 Ga0068860_10000145718 266
178 3300010375 Ga0105239_10108012 Ga0105239_101080122 266
179 3300013306 Ga0163162_10000667 Ga0163162_1000066710 266
180 3300013308 Ga0157375_10420517 Ga0157375_104205172 266
181 3300025903 Ga0207680_10172708 Ga0207680_101727082 266
182 3300028381 Ga0268264_10001898 Ga0268264_1000189817 266
183 3300005367 Ga0070667_100626776 Ga0070667_1006267761 267
184 3300005471 Ga0070698_100011917 Ga0070698_1000119171 268
185 3300005719 Ga0068861_100053089 Ga0068861_1000530893 268
186 3300014326 Ga0157380_10132889 Ga0157380_101328893 268
187 3300025923 Ga0207681_10018229 Ga0207681_100182293 268
188 3300026118 Ga0207675_100292233 Ga0207675_1002922332 268
189 3300005365 Ga0070688_100271322 Ga0070688_1002713222 269
190 3300013306 Ga0163162_10062374 Ga0163162_100623742 269
191 3300005844 Ga0068862_100166838 Ga0068862_1001668382 270
192 3300009553 Ga0105249_10308822 Ga0105249_103088221 270
193 3300025972 Ga0207668_10221839 Ga0207668_102218392 270
194 3300026118 Ga0207675_100010718 Ga0207675_1000107182 270
195 3300028380 Ga0268265_10066235 Ga0268265_100662352 270
196 3300005331 Ga0070670_100127652 Ga0070670_1001276522 271
197 3300006237 Ga0097621_100242455 Ga0097621_1002424552 271
198 3300005293 Ga0065715_10166129 Ga0065715_101661292 272
199 3300005295 Ga0065707_10087544 Ga0065707_100875446 272
200 3300005330 Ga0070690_100484780 Ga0070690_1004847801 272
201 3300005347 Ga0070668_100096085 Ga0070668_1000960851 272
202 3300005564 Ga0070664_100393000 Ga0070664_1003930001 272
203 3300013297 Ga0157378_10024846 Ga0157378_100248464 272
204 3300013307 Ga0157372_10281788 Ga0157372_102817882 272
205 3300025945 Ga0207679_10476184 Ga0207679_104761842 272
206 3300025960 Ga0207651_10054427 Ga0207651_100544273 272
207 3300026075 Ga0207708_10192390 Ga0207708_101923902 272
208 3300026118 Ga0207675_100004950 Ga0207675_1000049509 272
209 3300005290 Ga0065712_10069485 Ga0065712_100694857 273
210 3300005328 Ga0070676_10412743 Ga0070676_104127431 273
211 3300005331 Ga0070670_100495445 Ga0070670_1004954452 273
212 3300005353 Ga0070669_100064908 Ga0070669_1000649083 273
213 3300005354 Ga0070675_100304190 Ga0070675_1003041902 273
214 3300005364 Ga0070673_100018853 Ga0070673_1000188536 273
215 3300005577 Ga0068857_100311297 Ga0068857_1003112972 273
216 3300005617 Ga0068859_100027241 Ga0068859_1000272417 273
217 3300005719 Ga0068861_100024716 Ga0068861_1000247166 273
218 3300005844 Ga0068862_100016832 Ga0068862_1000168328 273
219 3300006931 Ga0097620_100027241 Ga0097620_1000272417 273
220 3300013308 Ga0157375_10043649 Ga0157375_100436496 273
221 3300014326 Ga0157380_10011254 Ga0157380_100112546 273
222 3300025923 Ga0207681_10050468 Ga0207681_100504683 273
223 3300025942 Ga0207689_10012437 Ga0207689_100124375 273
224 3300026095 Ga0207676_10065133 Ga0207676_100651334 273
225 3300026116 Ga0207674_10335851 Ga0207674_103358512 273
226 3300047320 Ga0495672_0038658 Ga0495672_0038658_879_1703 273
227 3300050511 nmdc:mga08y16_132414_c1 nmdc:mga08y16_132414_c1_1608_2444 273
228 3300013296 Ga0157374_10097032 Ga0157374_100970321 275
229 3300025944 Ga0207661_10115870 Ga0207661_101158702 275
230 3300003203 JGI25406J46586_10000247 JGI25406J46586_1000024728 276
231 3300005985 Ga0081539_10000042 Ga0081539_1000004258 276
232 3300005985 Ga0081539_10100614 Ga0081539_101006142 276
233 3300013105 Ga0157369_10117183 Ga0157369_101171833 276
234 3300013296 Ga0157374_10067394 Ga0157374_100673943 276
235 3300013308 Ga0157375_10513250 Ga0157375_105132502 276
236 3300014969 Ga0157376_10645327 Ga0157376_106453272 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

36

265

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d57-assembly1.cif.gz_A double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography 0.8868 23 250
7cjs-assembly2.cif.gz_E structure of aquaporin 0.8704 22 250
3m9i-assembly1.cif.gz_A electron crystallographic structure of lens aquaporin-0 (aqp0) (lens mip) in e. coli polar lipids 0.8684 26 247
2d57-assembly1.cif.gz_A double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography 0.8682 23 250
3gd8-assembly1.cif.gz_A crystal structure of human aquaporin 4 at 1.8 and its mechanism of conductance 0.8666 26 247
ID Description Score Start End Superfamily
af_K7N2M1_110_243_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9126 156 247 1.20.1080.10
af_Q9SAI4_73_301_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8947 26 250 1.20.1080.10
af_K7KZB2_21_183_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8898 96 259 1.20.1080.10
2d57A00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8868 23 250 1.20.1080.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8854 27 250 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A832FC10-F1-model_v4 Aquaporin family protein 0.977 1 257 GO:0005886
GO:0015250
AF-A0A2V6LAP5-F1-model_v4 Aquaporin 0.9761 102 252 GO:0015267
GO:0016020
AF-A0A7G5XDD2-F1-model_v4 Aquaporin 0.9739 1 257 GO:0005886
GO:0015250
AF-A0A5B8UYH3-F1-model_v4 VOC domain-containing protein 0.9718 25 259 GO:0004462
GO:0004493
GO:0015267
GO:0016020
GO:0046491
GO:0046872
AF-A0A7M2Y7C9-F1-model_v4 Aquaporin family protein 0.9699 19 252 GO:0015267
GO:0016020

Feature Viewer

pLDDT pTM Quality
86.78 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map