F349163
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 236 | 113 | 236 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300025945|Ga0207679_10476184|Ga0207679_104761842 |
| Length | 294 |
| Sequence | LVVIRLTAIASYNHSLCIMRAMPIQVFTGTKGAKEMKSAFRKNKKHYLQEGLGLALFMFSACFFSAMIFSANGSWNHAIPSVLIKNVAMGLIMGLTALFIFYSPWTAPGGSHINPAVTLTFLRLDKMCRYDAMFYVIFQLIGGTIAVYIMQAIMGAVLTDPPVSSVVTIPGRAGQWWALITEFAISFFTMTMVLFTSHHKWMKQYTRIFSAILVCCWVIVASPVSGFGMNPARSFASALASGIWKSFWIYLFIPMAGMLSAAEFFLFIQRRAWLKNDTTYNQVMNDKIYLASRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 97.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000247 | 3300003203 | Bacteria | 24051 |
| 2 | rootH1_10172603 | 3300003316 | Bacteria | 1437 |
| 3 | rootL2_10064184 | 3300003322 | Bacteria | 1908 |
| 4 | rootH1_10365625 | 3300003323 | Unclassified | 1628 |
| 5 | Ga0065712_10069485 | 3300005290 | Bacteria | 7198 |
| 6 | Ga0065712_10211996 | 3300005290 | Bacteria | 1069 |
| 7 | Ga0065715_10166129 | 3300005293 | Bacteria | 1585 |
| 8 | Ga0065707_10087544 | 3300005295 | Bacteria | 4986 |
| 9 | Ga0070676_10045290 | 3300005328 | Bacteria | 2562 |
| 10 | Ga0070676_10412743 | 3300005328 | Bacteria | 942 |
| 11 | Ga0070683_100015405 | 3300005329 | Bacteria | 6715 |
| 12 | Ga0070690_100484780 | 3300005330 | Bacteria | 922 |
| 13 | Ga0070670_100013715 | 3300005331 | Bacteria | 6944 |
| 14 | Ga0070670_100039032 | 3300005331 | Bacteria | 4082 |
| 15 | Ga0070670_100055849 | 3300005331 | Bacteria | 3389 |
| 16 | Ga0070670_100060998 | 3300005331 | Bacteria | 3238 |
| 17 | Ga0070670_100127652 | 3300005331 | Unclassified | 2195 |
| 18 | Ga0070670_100402739 | 3300005331 | Bacteria | 1208 |
| 19 | Ga0070670_100495445 | 3300005331 | Bacteria | 1086 |
| 20 | Ga0070677_10004769 | 3300005333 | Unclassified | 4442 |
| 21 | Ga0068869_100004629 | 3300005334 | Bacteria | 8578 |
| 22 | Ga0068869_100029729 | 3300005334 | Bacteria | 3831 |
| 23 | Ga0068869_100125140 | 3300005334 | Bacteria | 1970 |
| 24 | Ga0068869_100397794 | 3300005334 | Bacteria | 1132 |
| 25 | Ga0070666_10000045 | 3300005335 | Bacteria | 110131 |
| 26 | Ga0070666_10075454 | 3300005335 | Bacteria | 2299 |
| 27 | Ga0070666_10086574 | 3300005335 | Bacteria | 2147 |
| 28 | Ga0068868_100037955 | 3300005338 | Bacteria | 3737 |
| 29 | Ga0068868_100053064 | 3300005338 | Bacteria | 3193 |
| 30 | Ga0068868_100180811 | 3300005338 | Bacteria | 1749 |
| 31 | Ga0070689_100052001 | 3300005340 | Bacteria | 3168 |
| 32 | Ga0070661_100022882 | 3300005344 | Bacteria | 4476 |
| 33 | Ga0070668_100035002 | 3300005347 | Bacteria | 3828 |
| 34 | Ga0070668_100096085 | 3300005347 | Bacteria | 2341 |
| 35 | Ga0070669_100064908 | 3300005353 | Bacteria | 2689 |
| 36 | Ga0070669_100092484 | 3300005353 | Bacteria | 2270 |
| 37 | Ga0070675_100084821 | 3300005354 | Bacteria | 2645 |
| 38 | Ga0070675_100095917 | 3300005354 | Bacteria | 2491 |
| 39 | Ga0070675_100304190 | 3300005354 | Bacteria | 1405 |
| 40 | Ga0070673_100018853 | 3300005364 | Bacteria | 4944 |
| 41 | Ga0070673_100033359 | 3300005364 | Unclassified | 3887 |
| 42 | Ga0070673_100050908 | 3300005364 | Bacteria | 3241 |
| 43 | Ga0070673_100129444 | 3300005364 | Unclassified | 2115 |
| 44 | Ga0070688_100082647 | 3300005365 | Bacteria | 2082 |
| 45 | Ga0070688_100271322 | 3300005365 | Bacteria | 1215 |
| 46 | Ga0070667_100043568 | 3300005367 | Unclassified | 3767 |
| 47 | Ga0070667_100060696 | 3300005367 | Bacteria | 3200 |
| 48 | Ga0070667_100626776 | 3300005367 | Bacteria | 992 |
| 49 | Ga0070663_100388095 | 3300005455 | Unclassified | 1139 |
| 50 | Ga0070662_100015482 | 3300005457 | Bacteria | 5110 |
| 51 | Ga0070662_100026397 | 3300005457 | Bacteria | 4023 |
| 52 | Ga0068867_100101943 | 3300005459 | Bacteria | 2193 |
| 53 | Ga0070685_10027611 | 3300005466 | Bacteria | 3139 |
| 54 | Ga0070685_10192160 | 3300005466 | Bacteria | 1321 |
| 55 | Ga0070698_100011917 | 3300005471 | Bacteria | 9224 |
| 56 | Ga0070684_100005569 | 3300005535 | Bacteria | 9668 |
| 57 | Ga0068853_100024374 | 3300005539 | Bacteria | 5071 |
| 58 | Ga0070672_100014802 | 3300005543 | Bacteria | 5534 |
| 59 | Ga0070665_100017921 | 3300005548 | Bacteria | 7110 |
| 60 | Ga0068855_100275164 | 3300005563 | Bacteria | 1871 |
| 61 | Ga0070664_100008815 | 3300005564 | Bacteria | 8174 |
| 62 | Ga0070664_100393000 | 3300005564 | Bacteria | 1267 |
| 63 | Ga0068857_100008420 | 3300005577 | Bacteria | 8912 |
| 64 | Ga0068857_100075229 | 3300005577 | Bacteria | 3011 |
| 65 | Ga0068857_100311297 | 3300005577 | Bacteria | 1453 |
| 66 | Ga0068857_100422102 | 3300005577 | Bacteria | 1244 |
| 67 | Ga0068854_100013540 | 3300005578 | Bacteria | 5357 |
| 68 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 69 | Ga0068859_100006787 | 3300005617 | Bacteria | 11631 |
| 70 | Ga0068859_100011289 | 3300005617 | Bacteria | 8989 |
| 71 | Ga0068859_100023075 | 3300005617 | Bacteria | 6240 |
| 72 | Ga0068859_100027241 | 3300005617 | Bacteria | 5733 |
| 73 | Ga0068859_100047571 | 3300005617 | Bacteria | 4310 |
| 74 | Ga0068864_100002527 | 3300005618 | Bacteria | 15109 |
| 75 | Ga0068864_100014757 | 3300005618 | Bacteria | 6491 |
| 76 | Ga0068864_100424605 | 3300005618 | Bacteria | 1267 |
| 77 | Ga0068866_10092838 | 3300005718 | Unclassified | 1648 |
| 78 | Ga0068861_100024716 | 3300005719 | Bacteria | 4347 |
| 79 | Ga0068861_100053089 | 3300005719 | Bacteria | 3082 |
| 80 | Ga0068861_100521589 | 3300005719 | Unclassified | 1078 |
| 81 | Ga0068870_10013193 | 3300005840 | Bacteria | 3879 |
| 82 | Ga0068863_100010692 | 3300005841 | Bacteria | 8912 |
| 83 | Ga0068863_100225300 | 3300005841 | Bacteria | 1807 |
| 84 | Ga0068860_100001457 | 3300005843 | Bacteria | 25578 |
| 85 | Ga0068860_100006294 | 3300005843 | Bacteria | 11924 |
| 86 | Ga0068860_100006676 | 3300005843 | Bacteria | 11591 |
| 87 | Ga0068860_100051976 | 3300005843 | Bacteria | 3898 |
| 88 | Ga0068860_100087961 | 3300005843 | Bacteria | 2957 |
| 89 | Ga0068862_100016832 | 3300005844 | Bacteria | 6087 |
| 90 | Ga0068862_100107349 | 3300005844 | Bacteria | 2448 |
| 91 | Ga0068862_100166838 | 3300005844 | Bacteria | 1969 |
| 92 | Ga0081539_10000042 | 3300005985 | Bacteria | 289955 |
| 93 | Ga0081539_10100614 | 3300005985 | Bacteria | 1474 |
| 94 | Ga0097621_100154530 | 3300006237 | Bacteria | 1969 |
| 95 | Ga0097621_100242455 | 3300006237 | Bacteria | 1576 |
| 96 | Ga0068871_100006923 | 3300006358 | Bacteria | 8078 |
| 97 | Ga0068871_100011634 | 3300006358 | Bacteria | 6460 |
| 98 | Ga0068865_100006180 | 3300006881 | Bacteria | 7302 |
| 99 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 100 | Ga0097620_100006787 | 3300006931 | Bacteria | 11631 |
| 101 | Ga0097620_100011289 | 3300006931 | Bacteria | 8989 |
| 102 | Ga0097620_100023073 | 3300006931 | Bacteria | 6240 |
| 103 | Ga0097620_100027241 | 3300006931 | Bacteria | 5733 |
| 104 | Ga0097620_100047571 | 3300006931 | Bacteria | 4310 |
| 105 | Ga0105240_10003804 | 3300009093 | Bacteria | 23321 |
| 106 | Ga0105240_10006777 | 3300009093 | Bacteria | 16758 |
| 107 | Ga0105247_10002534 | 3300009101 | Bacteria | 12403 |
| 108 | Ga0105247_10046791 | 3300009101 | Bacteria | 2656 |
| 109 | Ga0105241_10000277 | 3300009174 | Bacteria | 38322 |
| 110 | Ga0105241_10260662 | 3300009174 | Unclassified | 1473 |
| 111 | Ga0105242_10024276 | 3300009176 | Unclassified | 4787 |
| 112 | Ga0105242_10305785 | 3300009176 | Bacteria | 1453 |
| 113 | Ga0105242_10473536 | 3300009176 | Bacteria | 1185 |
| 114 | Ga0105237_10001795 | 3300009545 | Bacteria | 27714 |
| 115 | Ga0105237_10076416 | 3300009545 | Bacteria | 3339 |
| 116 | Ga0105238_10308786 | 3300009551 | Bacteria | 1566 |
| 117 | Ga0105249_10018313 | 3300009553 | Bacteria | 6227 |
| 118 | Ga0105249_10018951 | 3300009553 | Bacteria | 6134 |
| 119 | Ga0105249_10046318 | 3300009553 | Bacteria | 3958 |
| 120 | Ga0105249_10308822 | 3300009553 | Unclassified | 1589 |
| 121 | Ga0105239_10108012 | 3300010375 | Bacteria | 3083 |
| 122 | Ga0105239_10288139 | 3300010375 | Bacteria | 1849 |
| 123 | Ga0105246_10006818 | 3300011119 | Bacteria | 6980 |
| 124 | Ga0105246_10076995 | 3300011119 | Bacteria | 2365 |
| 125 | Ga0157369_10117183 | 3300013105 | Bacteria | 2827 |
| 126 | Ga0157374_10001174 | 3300013296 | Bacteria | 22340 |
| 127 | Ga0157374_10047823 | 3300013296 | Bacteria | 3967 |
| 128 | Ga0157374_10067394 | 3300013296 | Bacteria | 3365 |
| 129 | Ga0157374_10097032 | 3300013296 | Bacteria | 2820 |
| 130 | Ga0157378_10010165 | 3300013297 | Bacteria | 8208 |
| 131 | Ga0157378_10024846 | 3300013297 | Bacteria | 5277 |
| 132 | Ga0157378_10047415 | 3300013297 | Bacteria | 3821 |
| 133 | Ga0157378_10085922 | 3300013297 | Bacteria | 2851 |
| 134 | Ga0157378_10357849 | 3300013297 | Unclassified | 1428 |
| 135 | Ga0163162_10000667 | 3300013306 | Bacteria | 31830 |
| 136 | Ga0163162_10005451 | 3300013306 | Bacteria | 12289 |
| 137 | Ga0163162_10012412 | 3300013306 | Bacteria | 8321 |
| 138 | Ga0163162_10062374 | 3300013306 | Bacteria | 3768 |
| 139 | Ga0163162_10203275 | 3300013306 | Bacteria | 2110 |
| 140 | Ga0163162_10307964 | 3300013306 | Bacteria | 1716 |
| 141 | Ga0163162_10529082 | 3300013306 | Bacteria | 1308 |
| 142 | Ga0157372_10281788 | 3300013307 | Bacteria | 1932 |
| 143 | Ga0157375_10002186 | 3300013308 | Bacteria | 16910 |
| 144 | Ga0157375_10043649 | 3300013308 | Bacteria | 4350 |
| 145 | Ga0157375_10123291 | 3300013308 | Bacteria | 2704 |
| 146 | Ga0157375_10173165 | 3300013308 | Bacteria | 2307 |
| 147 | Ga0157375_10420517 | 3300013308 | Bacteria | 1502 |
| 148 | Ga0157375_10513250 | 3300013308 | Bacteria | 1362 |
| 149 | Ga0157375_10568323 | 3300013308 | Bacteria | 1295 |
| 150 | Ga0163163_10000697 | 3300014325 | Bacteria | 28555 |
| 151 | Ga0163163_10049073 | 3300014325 | Bacteria | 4153 |
| 152 | Ga0163163_10102869 | 3300014325 | Bacteria | 2881 |
| 153 | Ga0163163_10254166 | 3300014325 | Bacteria | 1808 |
| 154 | Ga0157380_10011254 | 3300014326 | Bacteria | 6459 |
| 155 | Ga0157380_10132889 | 3300014326 | Bacteria | 2126 |
| 156 | Ga0157377_10010230 | 3300014745 | Bacteria | 4633 |
| 157 | Ga0157379_10023387 | 3300014968 | Bacteria | 5484 |
| 158 | Ga0157379_10100487 | 3300014968 | Bacteria | 2596 |
| 159 | Ga0157379_10450369 | 3300014968 | Bacteria | 1188 |
| 160 | Ga0157376_10000609 | 3300014969 | Bacteria | 23132 |
| 161 | Ga0157376_10002997 | 3300014969 | Bacteria | 11584 |
| 162 | Ga0157376_10239229 | 3300014969 | Bacteria | 1691 |
| 163 | Ga0157376_10645327 | 3300014969 | Bacteria | 1058 |
| 164 | Ga0207642_10007458 | 3300025899 | Unclassified | 3698 |
| 165 | Ga0207710_10012939 | 3300025900 | Bacteria | 3514 |
| 166 | Ga0207680_10000043 | 3300025903 | Bacteria | 64325 |
| 167 | Ga0207680_10172708 | 3300025903 | Bacteria | 1457 |
| 168 | Ga0207645_10000958 | 3300025907 | Bacteria | 23890 |
| 169 | Ga0207654_10000590 | 3300025911 | Bacteria | 20481 |
| 170 | Ga0207695_10022770 | 3300025913 | Bacteria | 7099 |
| 171 | Ga0207671_10007140 | 3300025914 | Bacteria | 9745 |
| 172 | Ga0207649_10182326 | 3300025920 | Bacteria | 1470 |
| 173 | Ga0207681_10018229 | 3300025923 | Bacteria | 4422 |
| 174 | Ga0207681_10050468 | 3300025923 | Bacteria | 2815 |
| 175 | Ga0207694_10220910 | 3300025924 | Bacteria | 1546 |
| 176 | Ga0207650_10026252 | 3300025925 | Bacteria | 4154 |
| 177 | Ga0207650_10120180 | 3300025925 | Bacteria | 2044 |
| 178 | Ga0207659_10138347 | 3300025926 | Bacteria | 1888 |
| 179 | Ga0207644_10028882 | 3300025931 | Bacteria | 3844 |
| 180 | Ga0207706_10031736 | 3300025933 | Bacteria | 4704 |
| 181 | Ga0207706_10077522 | 3300025933 | Bacteria | 2923 |
| 182 | Ga0207686_10039963 | 3300025934 | Unclassified | 2849 |
| 183 | Ga0207670_10210943 | 3300025936 | Bacteria | 1481 |
| 184 | Ga0207704_10107714 | 3300025938 | Bacteria | 1875 |
| 185 | Ga0207691_10245642 | 3300025940 | Bacteria | 1546 |
| 186 | Ga0207689_10000603 | 3300025942 | Bacteria | 34426 |
| 187 | Ga0207689_10004687 | 3300025942 | Bacteria | 12337 |
| 188 | Ga0207689_10010512 | 3300025942 | Bacteria | 7969 |
| 189 | Ga0207689_10012437 | 3300025942 | Bacteria | 7274 |
| 190 | Ga0207689_10016830 | 3300025942 | Bacteria | 6188 |
| 191 | Ga0207689_10126742 | 3300025942 | Bacteria | 2100 |
| 192 | Ga0207661_10115870 | 3300025944 | Bacteria | 2274 |
| 193 | Ga0207679_10091102 | 3300025945 | Bacteria | 2359 |
| 194 | Ga0207679_10476184 | 3300025945 | Bacteria | 1111 |
| 195 | Ga0207667_10193028 | 3300025949 | Bacteria | 2089 |
| 196 | Ga0207651_10054427 | 3300025960 | Bacteria | 2742 |
| 197 | Ga0207651_10555107 | 3300025960 | Bacteria | 999 |
| 198 | Ga0207712_10007629 | 3300025961 | Bacteria | 6839 |
| 199 | Ga0207712_10096136 | 3300025961 | Bacteria | 2192 |
| 200 | Ga0207668_10169337 | 3300025972 | Bacteria | 1711 |
| 201 | Ga0207668_10221839 | 3300025972 | Bacteria | 1519 |
| 202 | Ga0207658_10023834 | 3300025986 | Bacteria | 4276 |
| 203 | Ga0207677_10045466 | 3300026023 | Bacteria | 2932 |
| 204 | Ga0207703_10007090 | 3300026035 | Bacteria | 8916 |
| 205 | Ga0207708_10192390 | 3300026075 | Bacteria | 1624 |
| 206 | Ga0207641_10000234 | 3300026088 | Bacteria | 71612 |
| 207 | Ga0207641_10065091 | 3300026088 | Bacteria | 3117 |
| 208 | Ga0207641_10206506 | 3300026088 | Bacteria | 1814 |
| 209 | Ga0207648_10008827 | 3300026089 | Bacteria | 9708 |
| 210 | Ga0207648_10028383 | 3300026089 | Bacteria | 4961 |
| 211 | Ga0207676_10019722 | 3300026095 | Bacteria | 4924 |
| 212 | Ga0207676_10060867 | 3300026095 | Bacteria | 2988 |
| 213 | Ga0207676_10065133 | 3300026095 | Bacteria | 2901 |
| 214 | Ga0207674_10006299 | 3300026116 | Bacteria | 13987 |
| 215 | Ga0207674_10335851 | 3300026116 | Bacteria | 1461 |
| 216 | Ga0207675_100004950 | 3300026118 | Bacteria | 12839 |
| 217 | Ga0207675_100010718 | 3300026118 | Bacteria | 8586 |
| 218 | Ga0207675_100192801 | 3300026118 | Bacteria | 1955 |
| 219 | Ga0207675_100292233 | 3300026118 | Bacteria | 1585 |
| 220 | Ga0207683_10025430 | 3300026121 | Bacteria | 5108 |
| 221 | Ga0268266_10105621 | 3300028379 | Bacteria | 2488 |
| 222 | Ga0268265_10066235 | 3300028380 | Bacteria | 2792 |
| 223 | Ga0268265_10170246 | 3300028380 | Bacteria | 1861 |
| 224 | Ga0268265_10248435 | 3300028380 | Bacteria | 1574 |
| 225 | Ga0268264_10001537 | 3300028381 | Bacteria | 21489 |
| 226 | Ga0268264_10001898 | 3300028381 | Bacteria | 18956 |
| 227 | Ga0268264_10023019 | 3300028381 | Bacteria | 5084 |
| 228 | Ga0268264_10035796 | 3300028381 | Bacteria | 4088 |
| 229 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 230 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 231 | Ga0265327_10018360 | 3300031251 | Bacteria | 4341 |
| 232 | Ga0265327_10021369 | 3300031251 | Bacteria | 3908 |
| 233 | Ga0395905_0087612 | 3300037471 | Unclassified | 2919 |
| 234 | Ga0495672_0038658 | 3300047320 | Unclassified | 2909 |
| 235 | nmdc:mga08y16_132414_c1 | 3300050511 | Bacteria | 2592 |
| 236 | Ga0500616_0006748 | 3300053153 | Bacteria | 7443 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10045290 | Ga0070676_100452903 | 215 |
| 2 | 3300005333 | Ga0070677_10004769 | Ga0070677_100047691 | 215 |
| 3 | 3300005334 | Ga0068869_100125140 | Ga0068869_1001251401 | 215 |
| 4 | 3300005335 | Ga0070666_10075454 | Ga0070666_100754543 | 215 |
| 5 | 3300005338 | Ga0068868_100037955 | Ga0068868_1000379553 | 215 |
| 6 | 3300005347 | Ga0070668_100035002 | Ga0070668_1000350023 | 215 |
| 7 | 3300005353 | Ga0070669_100092484 | Ga0070669_1000924843 | 215 |
| 8 | 3300005354 | Ga0070675_100084821 | Ga0070675_1000848213 | 215 |
| 9 | 3300005364 | Ga0070673_100033359 | Ga0070673_1000333592 | 215 |
| 10 | 3300005459 | Ga0068867_100101943 | Ga0068867_1001019432 | 215 |
| 11 | 3300005539 | Ga0068853_100024374 | Ga0068853_1000243743 | 215 |
| 12 | 3300005543 | Ga0070672_100014802 | Ga0070672_1000148022 | 215 |
| 13 | 3300005548 | Ga0070665_100017921 | Ga0070665_1000179216 | 215 |
| 14 | 3300005578 | Ga0068854_100013540 | Ga0068854_1000135402 | 215 |
| 15 | 3300005618 | Ga0068864_100424605 | Ga0068864_1004246052 | 215 |
| 16 | 3300005718 | Ga0068866_10092838 | Ga0068866_100928382 | 215 |
| 17 | 3300005840 | Ga0068870_10013193 | Ga0068870_100131935 | 215 |
| 18 | 3300005844 | Ga0068862_100107349 | Ga0068862_1001073493 | 215 |
| 19 | 3300006881 | Ga0068865_100006180 | Ga0068865_1000061805 | 215 |
| 20 | 3300025899 | Ga0207642_10007458 | Ga0207642_100074583 | 215 |
| 21 | 3300025907 | Ga0207645_10000958 | Ga0207645_1000095819 | 215 |
| 22 | 3300025934 | Ga0207686_10039963 | Ga0207686_100399633 | 215 |
| 23 | 3300025938 | Ga0207704_10107714 | Ga0207704_101077142 | 215 |
| 24 | 3300025942 | Ga0207689_10004687 | Ga0207689_100046875 | 215 |
| 25 | 3300026089 | Ga0207648_10008827 | Ga0207648_100088276 | 215 |
| 26 | 3300026118 | Ga0207675_100192801 | Ga0207675_1001928012 | 215 |
| 27 | 3300026121 | Ga0207683_10025430 | Ga0207683_100254306 | 215 |
| 28 | 3300028379 | Ga0268266_10105621 | Ga0268266_101056212 | 215 |
| 29 | 3300028380 | Ga0268265_10170246 | Ga0268265_101702462 | 215 |
| 30 | 3300005617 | Ga0068859_100023075 | Ga0068859_1000230755 | 227 |
| 31 | 3300006931 | Ga0097620_100023073 | Ga0097620_1000230734 | 227 |
| 32 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013253 | 238 |
| 33 | 3300005719 | Ga0068861_100521589 | Ga0068861_1005215891 | 241 |
| 34 | 3300025960 | Ga0207651_10555107 | Ga0207651_105551071 | 241 |
| 35 | 3300025972 | Ga0207668_10169337 | Ga0207668_101693372 | 241 |
| 36 | 3300009176 | Ga0105242_10024276 | Ga0105242_100242766 | 244 |
| 37 | 3300010375 | Ga0105239_10288139 | Ga0105239_102881393 | 244 |
| 38 | 3300011119 | Ga0105246_10076995 | Ga0105246_100769953 | 244 |
| 39 | 3300013297 | Ga0157378_10085922 | Ga0157378_100859222 | 244 |
| 40 | 3300013306 | Ga0163162_10307964 | Ga0163162_103079643 | 244 |
| 41 | 3300005843 | Ga0068860_100087961 | Ga0068860_1000879612 | 246 |
| 42 | 3300005466 | Ga0070685_10192160 | Ga0070685_101921602 | 247 |
| 43 | 3300005841 | Ga0068863_100225300 | Ga0068863_1002253002 | 247 |
| 44 | 3300026088 | Ga0207641_10206506 | Ga0207641_102065063 | 247 |
| 45 | 3300005577 | Ga0068857_100422102 | Ga0068857_1004221022 | 248 |
| 46 | 3300003316 | rootH1_10172603 | rootH1_101726032 | 249 |
| 47 | 3300003322 | rootL2_10064184 | rootL2_100641841 | 249 |
| 48 | 3300003323 | rootH1_10365625 | rootH1_103656252 | 249 |
| 49 | 3300005563 | Ga0068855_100275164 | Ga0068855_1002751642 | 249 |
| 50 | 3300025961 | Ga0207712_10007629 | Ga0207712_100076292 | 250 |
| 51 | 3300009093 | Ga0105240_10006777 | Ga0105240_1000677715 | 252 |
| 52 | 3300009174 | Ga0105241_10260662 | Ga0105241_102606622 | 252 |
| 53 | 3300009551 | Ga0105238_10308786 | Ga0105238_103087861 | 252 |
| 54 | 3300025913 | Ga0207695_10022770 | Ga0207695_100227701 | 252 |
| 55 | 3300025949 | Ga0207667_10193028 | Ga0207667_101930282 | 252 |
| 56 | 3300005290 | Ga0065712_10211996 | Ga0065712_102119962 | 253 |
| 57 | 3300025942 | Ga0207689_10126742 | Ga0207689_101267422 | 253 |
| 58 | 3300025961 | Ga0207712_10096136 | Ga0207712_100961363 | 253 |
| 59 | 3300005843 | Ga0068860_100051976 | Ga0068860_1000519763 | 255 |
| 60 | 3300009093 | Ga0105240_10003804 | Ga0105240_1000380413 | 255 |
| 61 | 3300009545 | Ga0105237_10001795 | Ga0105237_1000179511 | 255 |
| 62 | 3300025924 | Ga0207694_10220910 | Ga0207694_102209101 | 255 |
| 63 | 3300028381 | Ga0268264_10035796 | Ga0268264_100357963 | 255 |
| 64 | 3300037471 | Ga0395905_0087612 | Ga0395905_0087612_1146_1916 | 256 |
| 65 | 3300006237 | Ga0097621_100154530 | Ga0097621_1001545302 | 257 |
| 66 | 3300006358 | Ga0068871_100006923 | Ga0068871_1000069236 | 257 |
| 67 | 3300014969 | Ga0157376_10002997 | Ga0157376_100029976 | 257 |
| 68 | 3300031251 | Ga0265327_10018360 | Ga0265327_100183603 | 257 |
| 69 | 3300005331 | Ga0070670_100039032 | Ga0070670_1000390323 | 259 |
| 70 | 3300005331 | Ga0070670_100060998 | Ga0070670_1000609982 | 259 |
| 71 | 3300005577 | Ga0068857_100075229 | Ga0068857_1000752293 | 259 |
| 72 | 3300025925 | Ga0207650_10120180 | Ga0207650_101201802 | 259 |
| 73 | 3300005334 | Ga0068869_100029729 | Ga0068869_1000297293 | 260 |
| 74 | 3300005367 | Ga0070667_100060696 | Ga0070667_1000606963 | 260 |
| 75 | 3300005457 | Ga0070662_100015482 | Ga0070662_1000154823 | 260 |
| 76 | 3300025925 | Ga0207650_10026252 | Ga0207650_100262522 | 260 |
| 77 | 3300025933 | Ga0207706_10077522 | Ga0207706_100775222 | 260 |
| 78 | 3300026089 | Ga0207648_10028383 | Ga0207648_100283834 | 260 |
| 79 | 3300053153 | Ga0500616_0006748 | Ga0500616_0006748_2660_3454 | 260 |
| 80 | 3300005334 | Ga0068869_100397794 | Ga0068869_1003977941 | 261 |
| 81 | 3300013306 | Ga0163162_10529082 | Ga0163162_105290822 | 261 |
| 82 | 3300028380 | Ga0268265_10248435 | Ga0268265_102484352 | 261 |
| 83 | 3300006358 | Ga0068871_100011634 | Ga0068871_1000116349 | 262 |
| 84 | 3300014969 | Ga0157376_10000609 | Ga0157376_1000060918 | 262 |
| 85 | 3300031251 | Ga0265327_10021369 | Ga0265327_100213692 | 262 |
| 86 | 3300005329 | Ga0070683_100015405 | Ga0070683_1000154053 | 263 |
| 87 | 3300005331 | Ga0070670_100013715 | Ga0070670_1000137155 | 263 |
| 88 | 3300005331 | Ga0070670_100055849 | Ga0070670_1000558493 | 263 |
| 89 | 3300005338 | Ga0068868_100053064 | Ga0068868_1000530641 | 263 |
| 90 | 3300005340 | Ga0070689_100052001 | Ga0070689_1000520012 | 263 |
| 91 | 3300005344 | Ga0070661_100022882 | Ga0070661_1000228824 | 263 |
| 92 | 3300005354 | Ga0070675_100095917 | Ga0070675_1000959173 | 263 |
| 93 | 3300005364 | Ga0070673_100129444 | Ga0070673_1001294442 | 263 |
| 94 | 3300005365 | Ga0070688_100082647 | Ga0070688_1000826471 | 263 |
| 95 | 3300005367 | Ga0070667_100043568 | Ga0070667_1000435683 | 263 |
| 96 | 3300005455 | Ga0070663_100388095 | Ga0070663_1003880951 | 263 |
| 97 | 3300005457 | Ga0070662_100026397 | Ga0070662_1000263971 | 263 |
| 98 | 3300005466 | Ga0070685_10027611 | Ga0070685_100276114 | 263 |
| 99 | 3300005535 | Ga0070684_100005569 | Ga0070684_1000055695 | 263 |
| 100 | 3300005564 | Ga0070664_100008815 | Ga0070664_1000088152 | 263 |
| 101 | 3300005577 | Ga0068857_100008420 | Ga0068857_1000084202 | 263 |
| 102 | 3300005617 | Ga0068859_100006787 | Ga0068859_1000067873 | 263 |
| 103 | 3300005617 | Ga0068859_100011289 | Ga0068859_10001128911 | 263 |
| 104 | 3300005618 | Ga0068864_100002527 | Ga0068864_10000252710 | 263 |
| 105 | 3300005841 | Ga0068863_100010692 | Ga0068863_1000106923 | 263 |
| 106 | 3300006931 | Ga0097620_100006787 | Ga0097620_10000678711 | 263 |
| 107 | 3300006931 | Ga0097620_100011289 | Ga0097620_10001128911 | 263 |
| 108 | 3300009101 | Ga0105247_10046791 | Ga0105247_100467913 | 263 |
| 109 | 3300009176 | Ga0105242_10305785 | Ga0105242_103057852 | 263 |
| 110 | 3300009545 | Ga0105237_10076416 | Ga0105237_100764162 | 263 |
| 111 | 3300009553 | Ga0105249_10046318 | Ga0105249_100463184 | 263 |
| 112 | 3300013296 | Ga0157374_10001174 | Ga0157374_1000117411 | 263 |
| 113 | 3300013296 | Ga0157374_10047823 | Ga0157374_100478233 | 263 |
| 114 | 3300013297 | Ga0157378_10010165 | Ga0157378_100101656 | 263 |
| 115 | 3300013297 | Ga0157378_10047415 | Ga0157378_100474153 | 263 |
| 116 | 3300013297 | Ga0157378_10357849 | Ga0157378_103578493 | 263 |
| 117 | 3300013306 | Ga0163162_10012412 | Ga0163162_100124127 | 263 |
| 118 | 3300013306 | Ga0163162_10203275 | Ga0163162_102032752 | 263 |
| 119 | 3300013308 | Ga0157375_10002186 | Ga0157375_1000218617 | 263 |
| 120 | 3300013308 | Ga0157375_10173165 | Ga0157375_101731652 | 263 |
| 121 | 3300013308 | Ga0157375_10568323 | Ga0157375_105683232 | 263 |
| 122 | 3300014325 | Ga0163163_10000697 | Ga0163163_1000069718 | 263 |
| 123 | 3300014325 | Ga0163163_10102869 | Ga0163163_101028693 | 263 |
| 124 | 3300014325 | Ga0163163_10254166 | Ga0163163_102541662 | 263 |
| 125 | 3300014745 | Ga0157377_10010230 | Ga0157377_100102306 | 263 |
| 126 | 3300014968 | Ga0157379_10023387 | Ga0157379_100233876 | 263 |
| 127 | 3300014968 | Ga0157379_10100487 | Ga0157379_101004872 | 263 |
| 128 | 3300025920 | Ga0207649_10182326 | Ga0207649_101823262 | 263 |
| 129 | 3300025926 | Ga0207659_10138347 | Ga0207659_101383472 | 263 |
| 130 | 3300025933 | Ga0207706_10031736 | Ga0207706_100317363 | 263 |
| 131 | 3300025936 | Ga0207670_10210943 | Ga0207670_102109432 | 263 |
| 132 | 3300025940 | Ga0207691_10245642 | Ga0207691_102456422 | 263 |
| 133 | 3300025942 | Ga0207689_10010512 | Ga0207689_100105124 | 263 |
| 134 | 3300025942 | Ga0207689_10016830 | Ga0207689_100168302 | 263 |
| 135 | 3300025945 | Ga0207679_10091102 | Ga0207679_100911022 | 263 |
| 136 | 3300025986 | Ga0207658_10023834 | Ga0207658_100238342 | 263 |
| 137 | 3300026023 | Ga0207677_10045466 | Ga0207677_100454664 | 263 |
| 138 | 3300026088 | Ga0207641_10065091 | Ga0207641_100650912 | 263 |
| 139 | 3300026095 | Ga0207676_10019722 | Ga0207676_100197223 | 263 |
| 140 | 3300026095 | Ga0207676_10060867 | Ga0207676_100608673 | 263 |
| 141 | 3300026116 | Ga0207674_10006299 | Ga0207674_1000629911 | 263 |
| 142 | 3300028794 | Ga0307515_10000039 | Ga0307515_10000039230 | 263 |
| 143 | 3300005334 | Ga0068869_100004629 | Ga0068869_1000046296 | 264 |
| 144 | 3300005335 | Ga0070666_10000045 | Ga0070666_1000004519 | 264 |
| 145 | 3300005338 | Ga0068868_100180811 | Ga0068868_1001808112 | 264 |
| 146 | 3300005364 | Ga0070673_100050908 | Ga0070673_1000509083 | 264 |
| 147 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007311 | 264 |
| 148 | 3300005617 | Ga0068859_100047571 | Ga0068859_1000475712 | 264 |
| 149 | 3300005618 | Ga0068864_100014757 | Ga0068864_1000147573 | 264 |
| 150 | 3300005843 | Ga0068860_100006294 | Ga0068860_1000062942 | 264 |
| 151 | 3300005843 | Ga0068860_100006676 | Ga0068860_1000066767 | 264 |
| 152 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007312 | 264 |
| 153 | 3300006931 | Ga0097620_100047571 | Ga0097620_1000475712 | 264 |
| 154 | 3300009101 | Ga0105247_10002534 | Ga0105247_100025348 | 264 |
| 155 | 3300009174 | Ga0105241_10000277 | Ga0105241_1000027728 | 264 |
| 156 | 3300009176 | Ga0105242_10473536 | Ga0105242_104735362 | 264 |
| 157 | 3300009553 | Ga0105249_10018313 | Ga0105249_100183134 | 264 |
| 158 | 3300009553 | Ga0105249_10018951 | Ga0105249_100189517 | 264 |
| 159 | 3300011119 | Ga0105246_10006818 | Ga0105246_100068182 | 264 |
| 160 | 3300013306 | Ga0163162_10005451 | Ga0163162_100054512 | 264 |
| 161 | 3300013308 | Ga0157375_10123291 | Ga0157375_101232913 | 264 |
| 162 | 3300014325 | Ga0163163_10049073 | Ga0163163_100490734 | 264 |
| 163 | 3300014968 | Ga0157379_10450369 | Ga0157379_104503692 | 264 |
| 164 | 3300014969 | Ga0157376_10239229 | Ga0157376_102392292 | 264 |
| 165 | 3300025900 | Ga0207710_10012939 | Ga0207710_100129392 | 264 |
| 166 | 3300025903 | Ga0207680_10000043 | Ga0207680_1000004337 | 264 |
| 167 | 3300025911 | Ga0207654_10000590 | Ga0207654_100005904 | 264 |
| 168 | 3300025914 | Ga0207671_10007140 | Ga0207671_1000714011 | 264 |
| 169 | 3300025931 | Ga0207644_10028882 | Ga0207644_100288823 | 264 |
| 170 | 3300025942 | Ga0207689_10000603 | Ga0207689_1000060325 | 264 |
| 171 | 3300026035 | Ga0207703_10007090 | Ga0207703_100070903 | 264 |
| 172 | 3300026088 | Ga0207641_10000234 | Ga0207641_1000023421 | 264 |
| 173 | 3300028381 | Ga0268264_10001537 | Ga0268264_100015376 | 264 |
| 174 | 3300028381 | Ga0268264_10023019 | Ga0268264_100230193 | 264 |
| 175 | 3300005331 | Ga0070670_100402739 | Ga0070670_1004027392 | 266 |
| 176 | 3300005335 | Ga0070666_10086574 | Ga0070666_100865741 | 266 |
| 177 | 3300005843 | Ga0068860_100001457 | Ga0068860_10000145718 | 266 |
| 178 | 3300010375 | Ga0105239_10108012 | Ga0105239_101080122 | 266 |
| 179 | 3300013306 | Ga0163162_10000667 | Ga0163162_1000066710 | 266 |
| 180 | 3300013308 | Ga0157375_10420517 | Ga0157375_104205172 | 266 |
| 181 | 3300025903 | Ga0207680_10172708 | Ga0207680_101727082 | 266 |
| 182 | 3300028381 | Ga0268264_10001898 | Ga0268264_1000189817 | 266 |
| 183 | 3300005367 | Ga0070667_100626776 | Ga0070667_1006267761 | 267 |
| 184 | 3300005471 | Ga0070698_100011917 | Ga0070698_1000119171 | 268 |
| 185 | 3300005719 | Ga0068861_100053089 | Ga0068861_1000530893 | 268 |
| 186 | 3300014326 | Ga0157380_10132889 | Ga0157380_101328893 | 268 |
| 187 | 3300025923 | Ga0207681_10018229 | Ga0207681_100182293 | 268 |
| 188 | 3300026118 | Ga0207675_100292233 | Ga0207675_1002922332 | 268 |
| 189 | 3300005365 | Ga0070688_100271322 | Ga0070688_1002713222 | 269 |
| 190 | 3300013306 | Ga0163162_10062374 | Ga0163162_100623742 | 269 |
| 191 | 3300005844 | Ga0068862_100166838 | Ga0068862_1001668382 | 270 |
| 192 | 3300009553 | Ga0105249_10308822 | Ga0105249_103088221 | 270 |
| 193 | 3300025972 | Ga0207668_10221839 | Ga0207668_102218392 | 270 |
| 194 | 3300026118 | Ga0207675_100010718 | Ga0207675_1000107182 | 270 |
| 195 | 3300028380 | Ga0268265_10066235 | Ga0268265_100662352 | 270 |
| 196 | 3300005331 | Ga0070670_100127652 | Ga0070670_1001276522 | 271 |
| 197 | 3300006237 | Ga0097621_100242455 | Ga0097621_1002424552 | 271 |
| 198 | 3300005293 | Ga0065715_10166129 | Ga0065715_101661292 | 272 |
| 199 | 3300005295 | Ga0065707_10087544 | Ga0065707_100875446 | 272 |
| 200 | 3300005330 | Ga0070690_100484780 | Ga0070690_1004847801 | 272 |
| 201 | 3300005347 | Ga0070668_100096085 | Ga0070668_1000960851 | 272 |
| 202 | 3300005564 | Ga0070664_100393000 | Ga0070664_1003930001 | 272 |
| 203 | 3300013297 | Ga0157378_10024846 | Ga0157378_100248464 | 272 |
| 204 | 3300013307 | Ga0157372_10281788 | Ga0157372_102817882 | 272 |
| 205 | 3300025945 | Ga0207679_10476184 | Ga0207679_104761842 | 272 |
| 206 | 3300025960 | Ga0207651_10054427 | Ga0207651_100544273 | 272 |
| 207 | 3300026075 | Ga0207708_10192390 | Ga0207708_101923902 | 272 |
| 208 | 3300026118 | Ga0207675_100004950 | Ga0207675_1000049509 | 272 |
| 209 | 3300005290 | Ga0065712_10069485 | Ga0065712_100694857 | 273 |
| 210 | 3300005328 | Ga0070676_10412743 | Ga0070676_104127431 | 273 |
| 211 | 3300005331 | Ga0070670_100495445 | Ga0070670_1004954452 | 273 |
| 212 | 3300005353 | Ga0070669_100064908 | Ga0070669_1000649083 | 273 |
| 213 | 3300005354 | Ga0070675_100304190 | Ga0070675_1003041902 | 273 |
| 214 | 3300005364 | Ga0070673_100018853 | Ga0070673_1000188536 | 273 |
| 215 | 3300005577 | Ga0068857_100311297 | Ga0068857_1003112972 | 273 |
| 216 | 3300005617 | Ga0068859_100027241 | Ga0068859_1000272417 | 273 |
| 217 | 3300005719 | Ga0068861_100024716 | Ga0068861_1000247166 | 273 |
| 218 | 3300005844 | Ga0068862_100016832 | Ga0068862_1000168328 | 273 |
| 219 | 3300006931 | Ga0097620_100027241 | Ga0097620_1000272417 | 273 |
| 220 | 3300013308 | Ga0157375_10043649 | Ga0157375_100436496 | 273 |
| 221 | 3300014326 | Ga0157380_10011254 | Ga0157380_100112546 | 273 |
| 222 | 3300025923 | Ga0207681_10050468 | Ga0207681_100504683 | 273 |
| 223 | 3300025942 | Ga0207689_10012437 | Ga0207689_100124375 | 273 |
| 224 | 3300026095 | Ga0207676_10065133 | Ga0207676_100651334 | 273 |
| 225 | 3300026116 | Ga0207674_10335851 | Ga0207674_103358512 | 273 |
| 226 | 3300047320 | Ga0495672_0038658 | Ga0495672_0038658_879_1703 | 273 |
| 227 | 3300050511 | nmdc:mga08y16_132414_c1 | nmdc:mga08y16_132414_c1_1608_2444 | 273 |
| 228 | 3300013296 | Ga0157374_10097032 | Ga0157374_100970321 | 275 |
| 229 | 3300025944 | Ga0207661_10115870 | Ga0207661_101158702 | 275 |
| 230 | 3300003203 | JGI25406J46586_10000247 | JGI25406J46586_1000024728 | 276 |
| 231 | 3300005985 | Ga0081539_10000042 | Ga0081539_1000004258 | 276 |
| 232 | 3300005985 | Ga0081539_10100614 | Ga0081539_101006142 | 276 |
| 233 | 3300013105 | Ga0157369_10117183 | Ga0157369_101171833 | 276 |
| 234 | 3300013296 | Ga0157374_10067394 | Ga0157374_100673943 | 276 |
| 235 | 3300013308 | Ga0157375_10513250 | Ga0157375_105132502 | 276 |
| 236 | 3300014969 | Ga0157376_10645327 | Ga0157376_106453272 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d57-assembly1.cif.gz_A | double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography | 0.8868 | 23 | 250 |
| 7cjs-assembly2.cif.gz_E | structure of aquaporin | 0.8704 | 22 | 250 |
| 3m9i-assembly1.cif.gz_A | electron crystallographic structure of lens aquaporin-0 (aqp0) (lens mip) in e. coli polar lipids | 0.8684 | 26 | 247 |
| 2d57-assembly1.cif.gz_A | double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography | 0.8682 | 23 | 250 |
| 3gd8-assembly1.cif.gz_A | crystal structure of human aquaporin 4 at 1.8 and its mechanism of conductance | 0.8666 | 26 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7N2M1_110_243_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9126 | 156 | 247 | 1.20.1080.10 |
| af_Q9SAI4_73_301_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8947 | 26 | 250 | 1.20.1080.10 |
| af_K7KZB2_21_183_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8898 | 96 | 259 | 1.20.1080.10 |
| 2d57A00 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8868 | 23 | 250 | 1.20.1080.10 |
| af_Q9ATN2_41_273_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8854 | 27 | 250 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832FC10-F1-model_v4 | Aquaporin family protein | 0.977 | 1 | 257 |
GO:0005886
GO:0015250 |
| AF-A0A2V6LAP5-F1-model_v4 | Aquaporin | 0.9761 | 102 | 252 |
GO:0015267
GO:0016020 |
| AF-A0A7G5XDD2-F1-model_v4 | Aquaporin | 0.9739 | 1 | 257 |
GO:0005886
GO:0015250 |
| AF-A0A5B8UYH3-F1-model_v4 | VOC domain-containing protein | 0.9718 | 25 | 259 |
GO:0004462
GO:0004493 GO:0015267 GO:0016020 GO:0046491 GO:0046872 |
| AF-A0A7M2Y7C9-F1-model_v4 | Aquaporin family protein | 0.9699 | 19 | 252 |
GO:0015267
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar