F348607

General Info

Members Datasets Scaffolds Average Seq Length
235 180 204 354

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501939600|2501943817
Length 415
Sequence RMTDATATGSRTADAGRLPGRWPVWWLPRGLHPGAWWLWALGLATAASHTTNPLPLALLVAVAGLVVVRRRGDAPWALAFRMYVWLGAVIVTMRVVFRIVFGGGQGEHILVRLPEIPLPEWAAGIRLFGPVAVEQILGGFYDGLRLATMLVCLGAANALANPKRLLKAVPGALYAVGTAVVVALSVAPQLVESVLRVRRARRLRGASGRGMRALRGVALPVLADALDRSLALAAAMDSRGYGRTAAVPAGQRTVTGALVLGGLVGVCAGTYGLLDTAAPGYLGLPMLLAGLTAAVTGMLLAGRRVRRSRYRPDRWRPAELLVAGCGVAAAALTMLAGSVDPELLYPPVSPLTWPQLTPLMLLAVGVAAAPAWLAPPPPPTARAGRPPAVDRPFPVTDVPADGERAATATTPGDRP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221604 Nocardioides sp. Root190 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
11 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
14 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
15 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
16 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
17 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
18 2867369537 Streptomyces sp. Z26 Isolate Unclassified
19 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
20 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
21 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
22 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
23 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
24 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 649633069 Micromonospora sp. L5 Isolate Unclassified
175 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
176 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
177 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
178 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
179 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
180 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.38
Metatranscriptomes 0.43
Isolates 13.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 14.89
Rhizosphere 71.49
Stem 0
Stem Tuber 0
Unclassified 11.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10244258 3300003323 Bacteria 1563
2 Ga0070658_10215815 3300005327 Bacteria 1621
3 Ga0070683_100061418 3300005329 Bacteria 3494
4 Ga0070683_100090987 3300005329 Bacteria 2865
5 Ga0070682_100001809 3300005337 Bacteria 11939
6 Ga0068868_100007792 3300005338 Bacteria 7644
7 Ga0070687_100011162 3300005343 Bacteria 3919
8 Ga0070692_10005128 3300005345 Bacteria 5544
9 Ga0070692_10008578 3300005345 Bacteria 4564
10 Ga0070675_100004399 3300005354 Bacteria 10751
11 Ga0070675_100272698 3300005354 Bacteria 1485
12 Ga0070671_100016063 3300005355 Bacteria 6050
13 Ga0070674_100007677 3300005356 Bacteria 6372
14 Ga0070688_100138775 3300005365 Bacteria 1649
15 Ga0070713_100003281 3300005436 Bacteria 10661
16 Ga0070711_100006037 3300005439 Bacteria 7271
17 Ga0070700_100005607 3300005441 Bacteria 6654
18 Ga0070700_100260854 3300005441 Bacteria 1248
19 Ga0070678_100001112 3300005456 Bacteria 14099
20 Ga0070678_100230571 3300005456 Bacteria 1544
21 Ga0070681_10230030 3300005458 Bacteria 1768
22 Ga0068867_100004733 3300005459 Bacteria 9580
23 Ga0070685_10152386 3300005466 Unclassified 1466
24 Ga0070679_100042183 3300005530 Bacteria 4543
25 Ga0070684_100304908 3300005535 Bacteria 1462
26 Ga0068853_100140213 3300005539 Bacteria 2170
27 Ga0070672_100024532 3300005543 Bacteria 4459
28 Ga0070686_100225139 3300005544 Bacteria 1357
29 Ga0070693_100000533 3300005547 Bacteria 17080
30 Ga0070665_100196691 3300005548 Bacteria 2017
31 Ga0070704_100090677 3300005549 Bacteria 2277
32 Ga0070704_100098791 3300005549 Bacteria 2194
33 Ga0068856_100171571 3300005614 Bacteria 2181
34 Ga0068852_100000497 3300005616 Bacteria 25765
35 Ga0068852_100486594 3300005616 Bacteria 1227
36 Ga0068859_100063854 3300005617 Bacteria 3714
37 Ga0068864_100014980 3300005618 Bacteria 6444
38 Ga0068851_10004786 3300005834 Bacteria 6127
39 Ga0068851_10170124 3300005834 Bacteria 1202
40 Ga0068870_10001637 3300005840 Bacteria 9140
41 Ga0068870_10001919 3300005840 Bacteria 8572
42 Ga0068863_100002119 3300005841 Bacteria 19675
43 Ga0068858_100095521 3300005842 Bacteria 2770
44 Ga0068858_100117302 3300005842 Bacteria 2488
45 Ga0068862_100143884 3300005844 Bacteria 2118
46 Ga0075365_10022347 3300006038 Bacteria 3962
47 Ga0075370_10091118 3300006353 Bacteria 1758
48 Ga0075428_100108172 3300006844 Bacteria 3030
49 Ga0075431_100242685 3300006847 Bacteria 1832
50 Ga0075433_10005558 3300006852 Bacteria 9899
51 Ga0068865_100122428 3300006881 Bacteria 1936
52 Ga0068865_100262146 3300006881 Unclassified 1369
53 Ga0097620_100063856 3300006931 Bacteria 3714
54 Ga0075435_100008617 3300007076 Bacteria 7329
55 Ga0105251_10017590 3300009011 Bacteria 3826
56 Ga0105240_10132973 3300009093 Bacteria 2981
57 Ga0111539_10469317 3300009094 Bacteria 1465
58 Ga0105245_10189870 3300009098 Bacteria 1967
59 Ga0114129_10064593 3300009147 Bacteria 5109
60 Ga0114129_10636294 3300009147 Bacteria 1378
61 Ga0105243_10006089 3300009148 Bacteria 9326
62 Ga0105243_10006770 3300009148 Bacteria 8841
63 Ga0105243_10069012 3300009148 Bacteria 2850
64 Ga0105241_10018923 3300009174 Bacteria 5076
65 Ga0105237_10152014 3300009545 Bacteria 2311
66 Ga0105249_10024172 3300009553 Bacteria 5460
67 Ga0105239_10041033 3300010375 Bacteria 5072
68 Ga0157373_10009981 3300013100 Bacteria 6998
69 Ga0157370_10322674 3300013104 Bacteria 1424
70 Ga0157369_10127749 3300013105 Bacteria 2694
71 Ga0157374_10039529 3300013296 Bacteria 4341
72 Ga0157378_10060175 3300013297 Bacteria 3389
73 Ga0157372_10267038 3300013307 Bacteria 1987
74 Ga0157372_10326061 3300013307 Bacteria 1788
75 Ga0157375_10091014 3300013308 Bacteria 3111
76 Ga0157375_10134977 3300013308 Bacteria 2590
77 Ga0157375_10254377 3300013308 Bacteria 1918
78 Ga0157377_10010083 3300014745 Bacteria 4663
79 Ga0157379_10100332 3300014968 Bacteria 2598
80 Ga0157379_10291421 3300014968 Bacteria 1486
81 Ga0157376_10042886 3300014969 Bacteria 3710
82 Ga0206353_11497251 3300020082 Bacteria 4374
83 Ga0207666_1003763 3300025271 Bacteria 1876
84 Ga0207688_10011777 3300025901 Bacteria 4758
85 Ga0207643_10000602 3300025908 Bacteria 22762
86 Ga0207643_10002401 3300025908 Bacteria 10137
87 Ga0207705_10147434 3300025909 Bacteria 1761
88 Ga0207707_10070348 3300025912 Bacteria 3049
89 Ga0207693_10035195 3300025915 Bacteria 3948
90 Ga0207663_10017904 3300025916 Bacteria 3957
91 Ga0207660_10013594 3300025917 Bacteria 5337
92 Ga0207662_10020252 3300025918 Bacteria 3794
93 Ga0207649_10002620 3300025920 Bacteria 9986
94 Ga0207652_10007689 3300025921 Bacteria 8666
95 Ga0207650_10003326 3300025925 Bacteria 11070
96 Ga0207659_10277401 3300025926 Bacteria 1369
97 Ga0207687_10009399 3300025927 Bacteria 6395
98 Ga0207700_10045979 3300025928 Bacteria 3225
99 Ga0207644_10004541 3300025931 Bacteria 9021
100 Ga0207690_10008968 3300025932 Bacteria 5937
101 Ga0207706_10288567 3300025933 Bacteria 1430
102 Ga0207686_10229398 3300025934 Unclassified 1345
103 Ga0207670_10171288 3300025936 Bacteria 1628
104 Ga0207669_10128767 3300025937 Bacteria 1735
105 Ga0207691_10013460 3300025940 Bacteria 7829
106 Ga0207711_10153193 3300025941 Bacteria 2082
107 Ga0207689_10009070 3300025942 Bacteria 8613
108 Ga0207679_10001354 3300025945 Bacteria 15442
109 Ga0207712_10104035 3300025961 Bacteria 2116
110 Ga0207712_10292152 3300025961 Bacteria 1334
111 Ga0207658_10204782 3300025986 Bacteria 1650
112 Ga0207703_10311660 3300026035 Bacteria 1439
113 Ga0207678_10001106 3300026067 Bacteria 24706
114 Ga0207708_10006138 3300026075 Bacteria 8909
115 Ga0207708_10007818 3300026075 Bacteria 7919
116 Ga0207702_10002580 3300026078 Bacteria 17037
117 Ga0207702_10011788 3300026078 Bacteria 7280
118 Ga0207641_10002106 3300026088 Bacteria 18816
119 Ga0207648_10017780 3300026089 Bacteria 6455
120 Ga0207648_10024312 3300026089 Bacteria 5410
121 Ga0207674_10304662 3300026116 Bacteria 1542
122 Ga0207683_10002769 3300026121 Bacteria 15320
123 Ga0207683_10265544 3300026121 Bacteria 1567
124 Ga0207698_10001685 3300026142 Bacteria 12879
125 Ga0207698_10304986 3300026142 Bacteria 1484
126 Ga0207698_10319239 3300026142 Bacteria 1454
127 Ga0207428_10028333 3300027907 Bacteria 4654
128 Ga0207428_10071027 3300027907 Bacteria 2735
129 Ga0265334_10025508 3300028573 Bacteria 2392
130 Ga0307515_10059455 3300028794 Bacteria 5475
131 Ga0265338_10005080 3300028800 Bacteria 17364
132 Ga0265325_10001949 3300031241 Bacteria 14229
133 Ga0265313_10002215 3300031595 Bacteria 17128
134 Ga0316576_10010529 3300031727 Bacteria 6014
135 Ga0307507_10105656 3300033179 Bacteria 2330
136 Ga0373942_0009734 3300035207 Bacteria 2252
137 Ga0395900_0143273 3300037418 Bacteria 2446
138 Ga0395900_0348358 3300037418 Bacteria 1455
139 Ga0436364_1298760 3300037853 Bacteria 1959
140 Ga0395901_0234585 3300038443 Bacteria 1915
141 Ga0400485_21496 3300038735 Bacteria 3771
142 Ga0466972_0073818 3300044658 Bacteria 1626
143 Ga0466965_0055848 3300044683 Bacteria 1965
144 Ga0466961_0063585 3300044693 Bacteria 2345
145 Ga0466968_0009149 3300044735 Bacteria 3807
146 Ga0466970_0010811 3300044765 Bacteria 4641
147 Ga0466970_0118516 3300044765 Bacteria 1449
148 Ga0466960_0030555 3300044901 Bacteria 2480
149 Ga0466967_0081098 3300045976 Bacteria 2930
150 Ga0466967_0132656 3300045976 Bacteria 2314
151 Ga0466967_0190607 3300045976 Bacteria 1937
152 Ga0496100_0051427 3300048903 Bacteria 2675
153 Ga0496100_0114160 3300048903 Bacteria 1881
154 Ga0496101_0201391 3300048904 Bacteria 1539
155 Ga0496102_0107404 3300048905 Bacteria 2599
156 Ga0496104_0000452 3300048907 Bacteria 35593
157 Ga0496104_0046114 3300048907 Bacteria 4103
158 Ga0496104_0198830 3300048907 Bacteria 1916
159 Ga0496105_0001018 3300048908 Bacteria 19349
160 Ga0496105_0070723 3300048908 Bacteria 2885
161 Ga0496105_0164867 3300048908 Bacteria 1818
162 Ga0496106_0004884 3300048909 Bacteria 9928
163 Ga0496106_0110991 3300048909 Bacteria 2135
164 Ga0496107_0016697 3300048910 Bacteria 5160
165 Ga0496107_0056759 3300048910 Bacteria 2830
166 Ga0496108_0023135 3300048911 Bacteria 5110
167 Ga0496108_0032475 3300048911 Bacteria 4336
168 Ga0496108_0126550 3300048911 Bacteria 2194
169 Ga0496108_0210042 3300048911 Bacteria 1690
170 Ga0496109_0129957 3300048912 Bacteria 2350
171 Ga0496109_0188976 3300048912 Bacteria 1935
172 Ga0496109_0208971 3300048912 Bacteria 1835
173 Ga0496110_0001817 3300048913 Bacteria 15727
174 Ga0496110_0028170 3300048913 Bacteria 4822
175 Ga0496110_0173464 3300048913 Unclassified 1957
176 Ga0496110_0424954 3300048913 Bacteria 1211
177 Ga0496111_0004317 3300048914 Bacteria 8965
178 Ga0496111_0015560 3300048914 Bacteria 5226
179 Ga0496111_0051523 3300048914 Bacteria 2971
180 Ga0496112_0024807 3300048915 Bacteria 5750
181 Ga0496112_0240881 3300048915 Bacteria 1762
182 Ga0496114_0009338 3300048917 Bacteria 7785
183 Ga0496114_0014240 3300048917 Bacteria 6380
184 Ga0496114_0200827 3300048917 Bacteria 1746
185 Ga0496115_0044454 3300048918 Bacteria 3542
186 Ga0496115_0084866 3300048918 Bacteria 2582
187 Ga0501031_0073195 3300049568 Bacteria 2231
188 Ga0501041_0027155 3300049577 Bacteria 3449
189 Ga0501067_0102602 3300049583 Bacteria 1589
190 Ga0501070_0154768 3300049586 Bacteria 1891
191 Ga0501071_0099558 3300049587 Bacteria 2142
192 Ga0501074_0064974 3300049590 Bacteria 2627
193 Ga0501075_0134002 3300049591 Bacteria 1887
194 Ga0501077_0146284 3300049593 Bacteria 1499
195 Ga0501035_0179277 3300049822 Bacteria 1826
196 nmdc:mga05p37_116244_c1 3300050507 Bacteria 3287
197 nmdc:mga05p37_531009_c1 3300050507 Bacteria 1344
198 nmdc:mga06r32_36_c3 3300050510 Bacteria 7885
199 nmdc:mga06r32_491_c3 3300050510 Bacteria 3689
200 nmdc:mga08y16_33414_c1 3300050511 Bacteria 5402
201 nmdc:mga08y16_8273_c1 3300050511 Bacteria 10888
202 nmdc:mga0n895_9136_c1 3300050512 Bacteria 8655
203 nmdc:mga0a205_5123_c1 3300050515 Bacteria 7847
204 Ga0530510_0008275 3300061734 Bacteria 7252

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0073195 Ga0501031_0073195_44_1009 262
2 3300061734 Ga0530510_0008275 Ga0530510_0008275_4186_5280 285
3 3300044901 Ga0466960_0030555 Ga0466960_0030555_337_1374 287
4 3300026035 Ga0207703_10311660 Ga0207703_103116602 296
5 3300049577 Ga0501041_0027155 Ga0501041_0027155_662_1810 298
6 3300049587 Ga0501071_0099558 Ga0501071_0099558_981_2129 298
7 3300049590 Ga0501074_0064974 Ga0501074_0064974_1332_2480 298
8 3300049591 Ga0501075_0134002 Ga0501075_0134002_673_1821 298
9 3300049822 Ga0501035_0179277 Ga0501035_0179277_205_1299 299
10 3300048913 Ga0496110_0424954 Ga0496110_0424954_20_946 304
11 3300048917 Ga0496114_0200827 Ga0496114_0200827_766_1692 304
12 3300037418 Ga0395900_0143273 Ga0395900_0143273_169_1269 312
13 3300049593 Ga0501077_0146284 Ga0501077_0146284_51_1199 312
14 3300050510 nmdc:mga06r32_491_c3 nmdc:mga06r32_491_c3_1697_2950 312
15 3300009147 Ga0114129_10636294 Ga0114129_106362942 313
16 3300013296 Ga0157374_10039529 Ga0157374_100395293 313
17 3300048907 Ga0496104_0000452 Ga0496104_0000452_14397_15497 313
18 3300050507 nmdc:mga05p37_116244_c1 nmdc:mga05p37_116244_c1_2115_3215 313
19 3300005842 Ga0068858_100117302 Ga0068858_1001173022 314
20 3300028794 Ga0307515_10059455 Ga0307515_100594552 314
21 3300038735 Ga0400485_21496 Ga0400485_21496_649_1665 314
22 3300044735 Ga0466968_0009149 Ga0466968_0009149_1586_2722 315
23 3300033179 Ga0307507_10105656 Ga0307507_101056562 316
24 3300048907 Ga0496104_0046114 Ga0496104_0046114_1827_2975 316
25 3300048908 Ga0496105_0070723 Ga0496105_0070723_806_1954 316
26 3300048915 Ga0496112_0240881 Ga0496112_0240881_544_1602 316
27 iso_pu_bacteria 2643221567 2643853425 317
28 iso_pu_bacteria 2643221624 2644137385 317
29 3300006847 Ga0075431_100242685 Ga0075431_1002426852 318
30 3300050510 nmdc:mga06r32_36_c3 nmdc:mga06r32_36_c3_808_1908 318
31 3300009147 Ga0114129_10064593 Ga0114129_100645934 319
32 3300009148 Ga0105243_10006089 Ga0105243_100060897 319
33 3300013297 Ga0157378_10060175 Ga0157378_100601752 319
34 3300013308 Ga0157375_10134977 Ga0157375_101349773 319
35 3300013308 Ga0157375_10254377 Ga0157375_102543772 319
36 3300014968 Ga0157379_10100332 Ga0157379_101003322 319
37 3300048905 Ga0496102_0107404 Ga0496102_0107404_223_1278 319
38 3300048908 Ga0496105_0164867 Ga0496105_0164867_226_1281 319
39 3300048909 Ga0496106_0110991 Ga0496106_0110991_310_1365 319
40 3300048910 Ga0496107_0056759 Ga0496107_0056759_726_1781 319
41 3300048913 Ga0496110_0173464 Ga0496110_0173464_717_1772 319
42 3300048914 Ga0496111_0015560 Ga0496111_0015560_3820_4875 319
43 3300050507 nmdc:mga05p37_531009_c1 nmdc:mga05p37_531009_c1_183_1277 319
44 3300005549 Ga0070704_100098791 Ga0070704_1000987912 322
45 3300044693 Ga0466961_0063585 Ga0466961_0063585_551_1633 322
46 3300044765 Ga0466970_0010811 Ga0466970_0010811_324_1406 322
47 3300045976 Ga0466967_0132656 Ga0466967_0132656_422_1504 322
48 3300048903 Ga0496100_0114160 Ga0496100_0114160_769_1869 322
49 3300048904 Ga0496101_0201391 Ga0496101_0201391_373_1473 322
50 3300048907 Ga0496104_0198830 Ga0496104_0198830_227_1327 322
51 3300048910 Ga0496107_0016697 Ga0496107_0016697_3241_4341 322
52 3300048911 Ga0496108_0210042 Ga0496108_0210042_384_1484 322
53 3300048917 Ga0496114_0014240 Ga0496114_0014240_3507_4607 322
54 3300048918 Ga0496115_0044454 Ga0496115_0044454_2069_3169 322
55 3300025986 Ga0207658_10204782 Ga0207658_102047821 324
56 3300031727 Ga0316576_10010529 Ga0316576_100105295 324
57 3300049583 Ga0501067_0102602 Ga0501067_0102602_175_1308 324
58 3300005327 Ga0070658_10215815 Ga0070658_102158152 325
59 3300005337 Ga0070682_100001809 Ga0070682_1000018093 325
60 3300005338 Ga0068868_100007792 Ga0068868_1000077922 325
61 3300005345 Ga0070692_10008578 Ga0070692_100085783 325
62 3300005354 Ga0070675_100004399 Ga0070675_10000439910 325
63 3300005355 Ga0070671_100016063 Ga0070671_1000160635 325
64 3300005436 Ga0070713_100003281 Ga0070713_1000032813 325
65 3300005439 Ga0070711_100006037 Ga0070711_1000060376 325
66 3300005441 Ga0070700_100260854 Ga0070700_1002608541 325
67 3300005456 Ga0070678_100001112 Ga0070678_1000011125 325
68 3300005458 Ga0070681_10230030 Ga0070681_102300302 325
69 3300005530 Ga0070679_100042183 Ga0070679_1000421832 325
70 3300005547 Ga0070693_100000533 Ga0070693_1000005338 325
71 3300005549 Ga0070704_100090677 Ga0070704_1000906772 325
72 3300005614 Ga0068856_100171571 Ga0068856_1001715712 325
73 3300005616 Ga0068852_100000497 Ga0068852_1000004972 325
74 3300005617 Ga0068859_100063854 Ga0068859_1000638541 325
75 3300005618 Ga0068864_100014980 Ga0068864_1000149805 325
76 3300005834 Ga0068851_10004786 Ga0068851_100047862 325
77 3300005840 Ga0068870_10001637 Ga0068870_100016374 325
78 3300005841 Ga0068863_100002119 Ga0068863_10000211914 325
79 3300005842 Ga0068858_100095521 Ga0068858_1000955212 325
80 3300006844 Ga0075428_100108172 Ga0075428_1001081722 325
81 3300006852 Ga0075433_10005558 Ga0075433_100055586 325
82 3300006931 Ga0097620_100063856 Ga0097620_1000638561 325
83 3300007076 Ga0075435_100008617 Ga0075435_1000086175 325
84 3300009011 Ga0105251_10017590 Ga0105251_100175902 325
85 3300009093 Ga0105240_10132973 Ga0105240_101329733 325
86 3300009094 Ga0111539_10469317 Ga0111539_104693172 325
87 3300009174 Ga0105241_10018923 Ga0105241_100189232 325
88 3300009545 Ga0105237_10152014 Ga0105237_101520142 325
89 3300010375 Ga0105239_10041033 Ga0105239_100410333 325
90 3300013100 Ga0157373_10009981 Ga0157373_100099812 325
91 3300013104 Ga0157370_10322674 Ga0157370_103226741 325
92 3300013308 Ga0157375_10091014 Ga0157375_100910142 325
93 3300014969 Ga0157376_10042886 Ga0157376_100428862 325
94 3300025901 Ga0207688_10011777 Ga0207688_100117771 325
95 3300025908 Ga0207643_10000602 Ga0207643_100006026 325
96 3300025909 Ga0207705_10147434 Ga0207705_101474342 325
97 3300025912 Ga0207707_10070348 Ga0207707_100703483 325
98 3300025915 Ga0207693_10035195 Ga0207693_100351953 325
99 3300025916 Ga0207663_10017904 Ga0207663_100179041 325
100 3300025917 Ga0207660_10013594 Ga0207660_100135942 325
101 3300025920 Ga0207649_10002620 Ga0207649_100026204 325
102 3300025921 Ga0207652_10007689 Ga0207652_100076896 325
103 3300025925 Ga0207650_10003326 Ga0207650_100033265 325
104 3300025926 Ga0207659_10277401 Ga0207659_102774011 325
105 3300025927 Ga0207687_10009399 Ga0207687_100093994 325
106 3300025928 Ga0207700_10045979 Ga0207700_100459792 325
107 3300025931 Ga0207644_10004541 Ga0207644_100045412 325
108 3300025932 Ga0207690_10008968 Ga0207690_100089683 325
109 3300025933 Ga0207706_10288567 Ga0207706_102885671 325
110 3300025941 Ga0207711_10153193 Ga0207711_101531932 325
111 3300025942 Ga0207689_10009070 Ga0207689_100090705 325
112 3300025945 Ga0207679_10001354 Ga0207679_100013545 325
113 3300025961 Ga0207712_10292152 Ga0207712_102921522 325
114 3300026067 Ga0207678_10001106 Ga0207678_1000110623 325
115 3300026075 Ga0207708_10007818 Ga0207708_100078185 325
116 3300026078 Ga0207702_10002580 Ga0207702_100025805 325
117 3300026088 Ga0207641_10002106 Ga0207641_100021064 325
118 3300026121 Ga0207683_10002769 Ga0207683_100027694 325
119 3300026142 Ga0207698_10001685 Ga0207698_1000168513 325
120 3300027907 Ga0207428_10028333 Ga0207428_100283334 325
121 3300048903 Ga0496100_0051427 Ga0496100_0051427_94_1194 325
122 3300048908 Ga0496105_0001018 Ga0496105_0001018_9117_10217 325
123 3300048909 Ga0496106_0004884 Ga0496106_0004884_8719_9819 325
124 3300048911 Ga0496108_0023135 Ga0496108_0023135_3521_4621 325
125 3300048912 Ga0496109_0208971 Ga0496109_0208971_571_1671 325
126 3300048913 Ga0496110_0001817 Ga0496110_0001817_2572_3672 325
127 3300048914 Ga0496111_0004317 Ga0496111_0004317_1179_2279 325
128 3300048915 Ga0496112_0024807 Ga0496112_0024807_4622_5722 325
129 3300050511 nmdc:mga08y16_8273_c1 nmdc:mga08y16_8273_c1_2601_3701 325
130 3300050512 nmdc:mga0n895_9136_c1 nmdc:mga0n895_9136_c1_4280_5380 325
131 3300050515 nmdc:mga0a205_5123_c1 nmdc:mga0a205_5123_c1_97_1197 325
132 3300037853 Ga0436364_1298760 Ga0436364_1298760_194_1393 326
133 3300009148 Ga0105243_10069012 Ga0105243_100690122 329
134 3300013105 Ga0157369_10127749 Ga0157369_101277492 329
135 3300013307 Ga0157372_10326061 Ga0157372_103260611 329
136 3300048911 Ga0496108_0032475 Ga0496108_0032475_2864_3931 329
137 3300048911 Ga0496108_0126550 Ga0496108_0126550_479_1537 329
138 3300048912 Ga0496109_0129957 Ga0496109_0129957_553_1620 329
139 3300048914 Ga0496111_0051523 Ga0496111_0051523_1574_2641 329
140 3300048917 Ga0496114_0009338 Ga0496114_0009338_2933_4081 332
141 3300005548 Ga0070665_100196691 Ga0070665_1001966912 333
142 3300045976 Ga0466967_0081098 Ga0466967_0081098_66_1268 333
143 3300048918 Ga0496115_0084866 Ga0496115_0084866_691_1884 333
144 iso_pu_bacteria 2866612099 2866616321 333
145 iso_pu_bacteria 2917736166 2917743998 333
146 3300044765 Ga0466970_0118516 Ga0466970_0118516_20_1105 334
147 iso_pu_bacteria 2862705112 2862709095 334
148 iso_pu_bacteria 8008485437 8008488034 334
149 iso_pu_bacteria 8025524527 8025527111 334
150 3300005329 Ga0070683_100061418 Ga0070683_1000614182 335
151 3300005329 Ga0070683_100090987 Ga0070683_1000909872 335
152 3300005343 Ga0070687_100011162 Ga0070687_1000111623 335
153 3300005345 Ga0070692_10005128 Ga0070692_100051282 335
154 3300005356 Ga0070674_100007677 Ga0070674_1000076775 335
155 3300005365 Ga0070688_100138775 Ga0070688_1001387752 335
156 3300005441 Ga0070700_100005607 Ga0070700_1000056073 335
157 3300005459 Ga0068867_100004733 Ga0068867_1000047333 335
158 3300005535 Ga0070684_100304908 Ga0070684_1003049081 335
159 3300005539 Ga0068853_100140213 Ga0068853_1001402131 335
160 3300005543 Ga0070672_100024532 Ga0070672_1000245323 335
161 3300005544 Ga0070686_100225139 Ga0070686_1002251391 335
162 3300005616 Ga0068852_100486594 Ga0068852_1004865942 335
163 3300005834 Ga0068851_10170124 Ga0068851_101701241 335
164 3300005840 Ga0068870_10001919 Ga0068870_100019194 335
165 3300006881 Ga0068865_100122428 Ga0068865_1001224282 335
166 3300009098 Ga0105245_10189870 Ga0105245_101898702 335
167 3300009148 Ga0105243_10006770 Ga0105243_100067704 335
168 3300009553 Ga0105249_10024172 Ga0105249_100241726 335
169 3300014745 Ga0157377_10010083 Ga0157377_100100832 335
170 3300020082 Ga0206353_11497251 Ga0206353_114972513 335
171 3300025908 Ga0207643_10002401 Ga0207643_100024016 335
172 3300025918 Ga0207662_10020252 Ga0207662_100202522 335
173 3300025937 Ga0207669_10128767 Ga0207669_101287672 335
174 3300025940 Ga0207691_10013460 Ga0207691_100134606 335
175 3300026075 Ga0207708_10006138 Ga0207708_100061387 335
176 3300026089 Ga0207648_10017780 Ga0207648_100177803 335
177 3300026116 Ga0207674_10304662 Ga0207674_103046622 335
178 3300026142 Ga0207698_10304986 Ga0207698_103049862 335
179 3300028573 Ga0265334_10025508 Ga0265334_100255082 335
180 3300028800 Ga0265338_10005080 Ga0265338_100050808 335
181 3300031241 Ga0265325_10001949 Ga0265325_100019495 335
182 3300031595 Ga0265313_10002215 Ga0265313_100022158 335
183 3300037418 Ga0395900_0348358 Ga0395900_0348358_135_1241 335
184 3300038443 Ga0395901_0234585 Ga0395901_0234585_370_1476 335
185 3300048912 Ga0496109_0188976 Ga0496109_0188976_383_1459 335
186 3300048913 Ga0496110_0028170 Ga0496110_0028170_2647_3723 335
187 iso_pu_bacteria 8057568493 8057573891 335
188 3300006038 Ga0075365_10022347 Ga0075365_100223473 336
189 3300025961 Ga0207712_10104035 Ga0207712_101040353 336
190 3300027907 Ga0207428_10071027 Ga0207428_100710272 336
191 3300050511 nmdc:mga08y16_33414_c1 nmdc:mga08y16_33414_c1_1187_2266 336
192 iso_pu_bacteria 2919446982 2919447194 336
193 iso_pu_bacteria 8047710418 8047710666 336
194 3300005354 Ga0070675_100272698 Ga0070675_1002726981 338
195 3300005456 Ga0070678_100230571 Ga0070678_1002305712 338
196 3300005466 Ga0070685_10152386 Ga0070685_101523862 338
197 3300005844 Ga0068862_100143884 Ga0068862_1001438842 338
198 3300006881 Ga0068865_100262146 Ga0068865_1002621462 338
199 3300025271 Ga0207666_1003763 Ga0207666_10037632 338
200 3300025934 Ga0207686_10229398 Ga0207686_102293982 338
201 3300025936 Ga0207670_10171288 Ga0207670_101712881 338
202 3300026089 Ga0207648_10024312 Ga0207648_100243122 338
203 3300026121 Ga0207683_10265544 Ga0207683_102655442 338
204 iso_pu_bacteria 2643221604 2644034004 338
205 iso_pu_bacteria 2643221617 2644099570 338
206 iso_pu_bacteria 2643221620 2644116236 338
207 iso_pu_bacteria 2738541305 2738871605 338
208 iso_pu_bacteria 2867346516 2867346747 338
209 iso_pu_bacteria 8003314358 8003320224 338
210 3300026142 Ga0207698_10319239 Ga0207698_103192392 339
211 3300044658 Ga0466972_0073818 Ga0466972_0073818_106_1203 339
212 iso_pu_bacteria 2990044586 2990049792 339
213 3300013307 Ga0157372_10267038 Ga0157372_102670382 340
214 iso_pu_bacteria 2515154129 2515722913 340
215 iso_pu_bacteria 2515154202 2516085058 340
216 3300014968 Ga0157379_10291421 Ga0157379_102914212 341
217 3300035207 Ga0373942_0009734 Ga0373942_0009734_365_1585 341
218 3300044683 Ga0466965_0055848 Ga0466965_0055848_271_1368 341
219 iso_pu_bacteria 2811994874 2812333945 341
220 iso_pu_bacteria 8003856774 8003857935 341
221 3300049586 Ga0501070_0154768 Ga0501070_0154768_417_1568 342
222 iso_pu_bacteria 2984576629 2984580360 342
223 iso_pu_bacteria 2990256926 2990258053 342
224 3300006353 Ga0075370_10091118 Ga0075370_100911182 343
225 3300045976 Ga0466967_0190607 Ga0466967_0190607_153_1262 343
226 3300026078 Ga0207702_10011788 Ga0207702_100117883 344
227 iso_pu_bacteria 2832004796 2832010698 345
228 iso_pu_bacteria 2866065130 2866069462 345
229 iso_pu_bacteria 2767802112 2768645725 346
230 iso_pu_bacteria 2861520306 2861526258 346
231 iso_pu_bacteria 2867369537 2867374819 346
232 iso_pu_bacteria 2867507094 2867512351 346
233 iso_pu_bacteria 2501939600 2501943817 348
234 iso_pu_bacteria 649633069 649814623 348
235 3300003323 rootH1_10244258 rootH1_102442582 349

Structural Annotation

Top 5 Hits

ID Description Score Start End
4de6-assembly1.cif.gz_A horse spleen apo-ferritin complex with arachidonic acid 0.4267 202 301
5gou-assembly1.cif.gz_A structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.3844 205 330
2za8-assembly1.cif.gz_A recombinant horse l-chain apoferritin n-terminal deletion mutant (residues 1-8) 0.3618 204 322
3af8-assembly1.cif.gz_X crystal structure of pd(ally)/apo-c126afr 0.3618 202 322
5x3x-assembly2.cif.gz_q 2.8a resolution structure of a cobalt energy-coupling factor transporter-cbimqo 0.3476 5 254
ID Description Score Start End Superfamily
af_O01578_26_133_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4194 187 278 1.10.10.1740
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3998 200 328 1.20.120.1770
5gouA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3844 205 330 1.20.1260.10
5gouA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3446 205 330 1.20.1260.10
af_Q4DEV8_1_176_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3425 163 328 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A6I3H9P4-F1-model_v4 Energy-coupling factor transporter transmembrane protein EcfT 0.8004 8 127 GO:0016020
AF-A0A0M8WQA0-F1-model_v4 Cobalt ABC transporter permease 0.7335 17 333 GO:0005886
AF-A0A1C9WN10-F1-model_v4 ECF transporter S component 0.7251 37 205 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A0M8WQA0-F1-model_v4 Cobalt ABC transporter permease 0.7238 17 333 GO:0005886
AF-A0A7K1ASP0-F1-model_v4 Uncharacterized protein 0.7233 8 150 GO:0016020

Feature Viewer

pLDDT pTM Quality
67.71 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map