F348607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 180 | 204 | 354 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501939600|2501943817 |
| Length | 415 |
| Sequence | RMTDATATGSRTADAGRLPGRWPVWWLPRGLHPGAWWLWALGLATAASHTTNPLPLALLVAVAGLVVVRRRGDAPWALAFRMYVWLGAVIVTMRVVFRIVFGGGQGEHILVRLPEIPLPEWAAGIRLFGPVAVEQILGGFYDGLRLATMLVCLGAANALANPKRLLKAVPGALYAVGTAVVVALSVAPQLVESVLRVRRARRLRGASGRGMRALRGVALPVLADALDRSLALAAAMDSRGYGRTAAVPAGQRTVTGALVLGGLVGVCAGTYGLLDTAAPGYLGLPMLLAGLTAAVTGMLLAGRRVRRSRYRPDRWRPAELLVAGCGVAAAALTMLAGSVDPELLYPPVSPLTWPQLTPLMLLAVGVAAAPAWLAPPPPPTARAGRPPAVDRPFPVTDVPADGERAATATTPGDRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 3 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 4 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 5 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 6 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 7 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 8 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 9 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 10 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 11 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 12 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 13 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 14 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 15 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 16 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 17 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 18 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 19 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 20 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 21 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 22 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 23 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 24 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 133 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 152 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 174 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 175 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 176 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 177 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 178 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 179 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 180 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.38 |
| Metatranscriptomes | 0.43 |
| Isolates | 13.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.85 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 14.89 |
| Rhizosphere | 71.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10244258 | 3300003323 | Bacteria | 1563 |
| 2 | Ga0070658_10215815 | 3300005327 | Bacteria | 1621 |
| 3 | Ga0070683_100061418 | 3300005329 | Bacteria | 3494 |
| 4 | Ga0070683_100090987 | 3300005329 | Bacteria | 2865 |
| 5 | Ga0070682_100001809 | 3300005337 | Bacteria | 11939 |
| 6 | Ga0068868_100007792 | 3300005338 | Bacteria | 7644 |
| 7 | Ga0070687_100011162 | 3300005343 | Bacteria | 3919 |
| 8 | Ga0070692_10005128 | 3300005345 | Bacteria | 5544 |
| 9 | Ga0070692_10008578 | 3300005345 | Bacteria | 4564 |
| 10 | Ga0070675_100004399 | 3300005354 | Bacteria | 10751 |
| 11 | Ga0070675_100272698 | 3300005354 | Bacteria | 1485 |
| 12 | Ga0070671_100016063 | 3300005355 | Bacteria | 6050 |
| 13 | Ga0070674_100007677 | 3300005356 | Bacteria | 6372 |
| 14 | Ga0070688_100138775 | 3300005365 | Bacteria | 1649 |
| 15 | Ga0070713_100003281 | 3300005436 | Bacteria | 10661 |
| 16 | Ga0070711_100006037 | 3300005439 | Bacteria | 7271 |
| 17 | Ga0070700_100005607 | 3300005441 | Bacteria | 6654 |
| 18 | Ga0070700_100260854 | 3300005441 | Bacteria | 1248 |
| 19 | Ga0070678_100001112 | 3300005456 | Bacteria | 14099 |
| 20 | Ga0070678_100230571 | 3300005456 | Bacteria | 1544 |
| 21 | Ga0070681_10230030 | 3300005458 | Bacteria | 1768 |
| 22 | Ga0068867_100004733 | 3300005459 | Bacteria | 9580 |
| 23 | Ga0070685_10152386 | 3300005466 | Unclassified | 1466 |
| 24 | Ga0070679_100042183 | 3300005530 | Bacteria | 4543 |
| 25 | Ga0070684_100304908 | 3300005535 | Bacteria | 1462 |
| 26 | Ga0068853_100140213 | 3300005539 | Bacteria | 2170 |
| 27 | Ga0070672_100024532 | 3300005543 | Bacteria | 4459 |
| 28 | Ga0070686_100225139 | 3300005544 | Bacteria | 1357 |
| 29 | Ga0070693_100000533 | 3300005547 | Bacteria | 17080 |
| 30 | Ga0070665_100196691 | 3300005548 | Bacteria | 2017 |
| 31 | Ga0070704_100090677 | 3300005549 | Bacteria | 2277 |
| 32 | Ga0070704_100098791 | 3300005549 | Bacteria | 2194 |
| 33 | Ga0068856_100171571 | 3300005614 | Bacteria | 2181 |
| 34 | Ga0068852_100000497 | 3300005616 | Bacteria | 25765 |
| 35 | Ga0068852_100486594 | 3300005616 | Bacteria | 1227 |
| 36 | Ga0068859_100063854 | 3300005617 | Bacteria | 3714 |
| 37 | Ga0068864_100014980 | 3300005618 | Bacteria | 6444 |
| 38 | Ga0068851_10004786 | 3300005834 | Bacteria | 6127 |
| 39 | Ga0068851_10170124 | 3300005834 | Bacteria | 1202 |
| 40 | Ga0068870_10001637 | 3300005840 | Bacteria | 9140 |
| 41 | Ga0068870_10001919 | 3300005840 | Bacteria | 8572 |
| 42 | Ga0068863_100002119 | 3300005841 | Bacteria | 19675 |
| 43 | Ga0068858_100095521 | 3300005842 | Bacteria | 2770 |
| 44 | Ga0068858_100117302 | 3300005842 | Bacteria | 2488 |
| 45 | Ga0068862_100143884 | 3300005844 | Bacteria | 2118 |
| 46 | Ga0075365_10022347 | 3300006038 | Bacteria | 3962 |
| 47 | Ga0075370_10091118 | 3300006353 | Bacteria | 1758 |
| 48 | Ga0075428_100108172 | 3300006844 | Bacteria | 3030 |
| 49 | Ga0075431_100242685 | 3300006847 | Bacteria | 1832 |
| 50 | Ga0075433_10005558 | 3300006852 | Bacteria | 9899 |
| 51 | Ga0068865_100122428 | 3300006881 | Bacteria | 1936 |
| 52 | Ga0068865_100262146 | 3300006881 | Unclassified | 1369 |
| 53 | Ga0097620_100063856 | 3300006931 | Bacteria | 3714 |
| 54 | Ga0075435_100008617 | 3300007076 | Bacteria | 7329 |
| 55 | Ga0105251_10017590 | 3300009011 | Bacteria | 3826 |
| 56 | Ga0105240_10132973 | 3300009093 | Bacteria | 2981 |
| 57 | Ga0111539_10469317 | 3300009094 | Bacteria | 1465 |
| 58 | Ga0105245_10189870 | 3300009098 | Bacteria | 1967 |
| 59 | Ga0114129_10064593 | 3300009147 | Bacteria | 5109 |
| 60 | Ga0114129_10636294 | 3300009147 | Bacteria | 1378 |
| 61 | Ga0105243_10006089 | 3300009148 | Bacteria | 9326 |
| 62 | Ga0105243_10006770 | 3300009148 | Bacteria | 8841 |
| 63 | Ga0105243_10069012 | 3300009148 | Bacteria | 2850 |
| 64 | Ga0105241_10018923 | 3300009174 | Bacteria | 5076 |
| 65 | Ga0105237_10152014 | 3300009545 | Bacteria | 2311 |
| 66 | Ga0105249_10024172 | 3300009553 | Bacteria | 5460 |
| 67 | Ga0105239_10041033 | 3300010375 | Bacteria | 5072 |
| 68 | Ga0157373_10009981 | 3300013100 | Bacteria | 6998 |
| 69 | Ga0157370_10322674 | 3300013104 | Bacteria | 1424 |
| 70 | Ga0157369_10127749 | 3300013105 | Bacteria | 2694 |
| 71 | Ga0157374_10039529 | 3300013296 | Bacteria | 4341 |
| 72 | Ga0157378_10060175 | 3300013297 | Bacteria | 3389 |
| 73 | Ga0157372_10267038 | 3300013307 | Bacteria | 1987 |
| 74 | Ga0157372_10326061 | 3300013307 | Bacteria | 1788 |
| 75 | Ga0157375_10091014 | 3300013308 | Bacteria | 3111 |
| 76 | Ga0157375_10134977 | 3300013308 | Bacteria | 2590 |
| 77 | Ga0157375_10254377 | 3300013308 | Bacteria | 1918 |
| 78 | Ga0157377_10010083 | 3300014745 | Bacteria | 4663 |
| 79 | Ga0157379_10100332 | 3300014968 | Bacteria | 2598 |
| 80 | Ga0157379_10291421 | 3300014968 | Bacteria | 1486 |
| 81 | Ga0157376_10042886 | 3300014969 | Bacteria | 3710 |
| 82 | Ga0206353_11497251 | 3300020082 | Bacteria | 4374 |
| 83 | Ga0207666_1003763 | 3300025271 | Bacteria | 1876 |
| 84 | Ga0207688_10011777 | 3300025901 | Bacteria | 4758 |
| 85 | Ga0207643_10000602 | 3300025908 | Bacteria | 22762 |
| 86 | Ga0207643_10002401 | 3300025908 | Bacteria | 10137 |
| 87 | Ga0207705_10147434 | 3300025909 | Bacteria | 1761 |
| 88 | Ga0207707_10070348 | 3300025912 | Bacteria | 3049 |
| 89 | Ga0207693_10035195 | 3300025915 | Bacteria | 3948 |
| 90 | Ga0207663_10017904 | 3300025916 | Bacteria | 3957 |
| 91 | Ga0207660_10013594 | 3300025917 | Bacteria | 5337 |
| 92 | Ga0207662_10020252 | 3300025918 | Bacteria | 3794 |
| 93 | Ga0207649_10002620 | 3300025920 | Bacteria | 9986 |
| 94 | Ga0207652_10007689 | 3300025921 | Bacteria | 8666 |
| 95 | Ga0207650_10003326 | 3300025925 | Bacteria | 11070 |
| 96 | Ga0207659_10277401 | 3300025926 | Bacteria | 1369 |
| 97 | Ga0207687_10009399 | 3300025927 | Bacteria | 6395 |
| 98 | Ga0207700_10045979 | 3300025928 | Bacteria | 3225 |
| 99 | Ga0207644_10004541 | 3300025931 | Bacteria | 9021 |
| 100 | Ga0207690_10008968 | 3300025932 | Bacteria | 5937 |
| 101 | Ga0207706_10288567 | 3300025933 | Bacteria | 1430 |
| 102 | Ga0207686_10229398 | 3300025934 | Unclassified | 1345 |
| 103 | Ga0207670_10171288 | 3300025936 | Bacteria | 1628 |
| 104 | Ga0207669_10128767 | 3300025937 | Bacteria | 1735 |
| 105 | Ga0207691_10013460 | 3300025940 | Bacteria | 7829 |
| 106 | Ga0207711_10153193 | 3300025941 | Bacteria | 2082 |
| 107 | Ga0207689_10009070 | 3300025942 | Bacteria | 8613 |
| 108 | Ga0207679_10001354 | 3300025945 | Bacteria | 15442 |
| 109 | Ga0207712_10104035 | 3300025961 | Bacteria | 2116 |
| 110 | Ga0207712_10292152 | 3300025961 | Bacteria | 1334 |
| 111 | Ga0207658_10204782 | 3300025986 | Bacteria | 1650 |
| 112 | Ga0207703_10311660 | 3300026035 | Bacteria | 1439 |
| 113 | Ga0207678_10001106 | 3300026067 | Bacteria | 24706 |
| 114 | Ga0207708_10006138 | 3300026075 | Bacteria | 8909 |
| 115 | Ga0207708_10007818 | 3300026075 | Bacteria | 7919 |
| 116 | Ga0207702_10002580 | 3300026078 | Bacteria | 17037 |
| 117 | Ga0207702_10011788 | 3300026078 | Bacteria | 7280 |
| 118 | Ga0207641_10002106 | 3300026088 | Bacteria | 18816 |
| 119 | Ga0207648_10017780 | 3300026089 | Bacteria | 6455 |
| 120 | Ga0207648_10024312 | 3300026089 | Bacteria | 5410 |
| 121 | Ga0207674_10304662 | 3300026116 | Bacteria | 1542 |
| 122 | Ga0207683_10002769 | 3300026121 | Bacteria | 15320 |
| 123 | Ga0207683_10265544 | 3300026121 | Bacteria | 1567 |
| 124 | Ga0207698_10001685 | 3300026142 | Bacteria | 12879 |
| 125 | Ga0207698_10304986 | 3300026142 | Bacteria | 1484 |
| 126 | Ga0207698_10319239 | 3300026142 | Bacteria | 1454 |
| 127 | Ga0207428_10028333 | 3300027907 | Bacteria | 4654 |
| 128 | Ga0207428_10071027 | 3300027907 | Bacteria | 2735 |
| 129 | Ga0265334_10025508 | 3300028573 | Bacteria | 2392 |
| 130 | Ga0307515_10059455 | 3300028794 | Bacteria | 5475 |
| 131 | Ga0265338_10005080 | 3300028800 | Bacteria | 17364 |
| 132 | Ga0265325_10001949 | 3300031241 | Bacteria | 14229 |
| 133 | Ga0265313_10002215 | 3300031595 | Bacteria | 17128 |
| 134 | Ga0316576_10010529 | 3300031727 | Bacteria | 6014 |
| 135 | Ga0307507_10105656 | 3300033179 | Bacteria | 2330 |
| 136 | Ga0373942_0009734 | 3300035207 | Bacteria | 2252 |
| 137 | Ga0395900_0143273 | 3300037418 | Bacteria | 2446 |
| 138 | Ga0395900_0348358 | 3300037418 | Bacteria | 1455 |
| 139 | Ga0436364_1298760 | 3300037853 | Bacteria | 1959 |
| 140 | Ga0395901_0234585 | 3300038443 | Bacteria | 1915 |
| 141 | Ga0400485_21496 | 3300038735 | Bacteria | 3771 |
| 142 | Ga0466972_0073818 | 3300044658 | Bacteria | 1626 |
| 143 | Ga0466965_0055848 | 3300044683 | Bacteria | 1965 |
| 144 | Ga0466961_0063585 | 3300044693 | Bacteria | 2345 |
| 145 | Ga0466968_0009149 | 3300044735 | Bacteria | 3807 |
| 146 | Ga0466970_0010811 | 3300044765 | Bacteria | 4641 |
| 147 | Ga0466970_0118516 | 3300044765 | Bacteria | 1449 |
| 148 | Ga0466960_0030555 | 3300044901 | Bacteria | 2480 |
| 149 | Ga0466967_0081098 | 3300045976 | Bacteria | 2930 |
| 150 | Ga0466967_0132656 | 3300045976 | Bacteria | 2314 |
| 151 | Ga0466967_0190607 | 3300045976 | Bacteria | 1937 |
| 152 | Ga0496100_0051427 | 3300048903 | Bacteria | 2675 |
| 153 | Ga0496100_0114160 | 3300048903 | Bacteria | 1881 |
| 154 | Ga0496101_0201391 | 3300048904 | Bacteria | 1539 |
| 155 | Ga0496102_0107404 | 3300048905 | Bacteria | 2599 |
| 156 | Ga0496104_0000452 | 3300048907 | Bacteria | 35593 |
| 157 | Ga0496104_0046114 | 3300048907 | Bacteria | 4103 |
| 158 | Ga0496104_0198830 | 3300048907 | Bacteria | 1916 |
| 159 | Ga0496105_0001018 | 3300048908 | Bacteria | 19349 |
| 160 | Ga0496105_0070723 | 3300048908 | Bacteria | 2885 |
| 161 | Ga0496105_0164867 | 3300048908 | Bacteria | 1818 |
| 162 | Ga0496106_0004884 | 3300048909 | Bacteria | 9928 |
| 163 | Ga0496106_0110991 | 3300048909 | Bacteria | 2135 |
| 164 | Ga0496107_0016697 | 3300048910 | Bacteria | 5160 |
| 165 | Ga0496107_0056759 | 3300048910 | Bacteria | 2830 |
| 166 | Ga0496108_0023135 | 3300048911 | Bacteria | 5110 |
| 167 | Ga0496108_0032475 | 3300048911 | Bacteria | 4336 |
| 168 | Ga0496108_0126550 | 3300048911 | Bacteria | 2194 |
| 169 | Ga0496108_0210042 | 3300048911 | Bacteria | 1690 |
| 170 | Ga0496109_0129957 | 3300048912 | Bacteria | 2350 |
| 171 | Ga0496109_0188976 | 3300048912 | Bacteria | 1935 |
| 172 | Ga0496109_0208971 | 3300048912 | Bacteria | 1835 |
| 173 | Ga0496110_0001817 | 3300048913 | Bacteria | 15727 |
| 174 | Ga0496110_0028170 | 3300048913 | Bacteria | 4822 |
| 175 | Ga0496110_0173464 | 3300048913 | Unclassified | 1957 |
| 176 | Ga0496110_0424954 | 3300048913 | Bacteria | 1211 |
| 177 | Ga0496111_0004317 | 3300048914 | Bacteria | 8965 |
| 178 | Ga0496111_0015560 | 3300048914 | Bacteria | 5226 |
| 179 | Ga0496111_0051523 | 3300048914 | Bacteria | 2971 |
| 180 | Ga0496112_0024807 | 3300048915 | Bacteria | 5750 |
| 181 | Ga0496112_0240881 | 3300048915 | Bacteria | 1762 |
| 182 | Ga0496114_0009338 | 3300048917 | Bacteria | 7785 |
| 183 | Ga0496114_0014240 | 3300048917 | Bacteria | 6380 |
| 184 | Ga0496114_0200827 | 3300048917 | Bacteria | 1746 |
| 185 | Ga0496115_0044454 | 3300048918 | Bacteria | 3542 |
| 186 | Ga0496115_0084866 | 3300048918 | Bacteria | 2582 |
| 187 | Ga0501031_0073195 | 3300049568 | Bacteria | 2231 |
| 188 | Ga0501041_0027155 | 3300049577 | Bacteria | 3449 |
| 189 | Ga0501067_0102602 | 3300049583 | Bacteria | 1589 |
| 190 | Ga0501070_0154768 | 3300049586 | Bacteria | 1891 |
| 191 | Ga0501071_0099558 | 3300049587 | Bacteria | 2142 |
| 192 | Ga0501074_0064974 | 3300049590 | Bacteria | 2627 |
| 193 | Ga0501075_0134002 | 3300049591 | Bacteria | 1887 |
| 194 | Ga0501077_0146284 | 3300049593 | Bacteria | 1499 |
| 195 | Ga0501035_0179277 | 3300049822 | Bacteria | 1826 |
| 196 | nmdc:mga05p37_116244_c1 | 3300050507 | Bacteria | 3287 |
| 197 | nmdc:mga05p37_531009_c1 | 3300050507 | Bacteria | 1344 |
| 198 | nmdc:mga06r32_36_c3 | 3300050510 | Bacteria | 7885 |
| 199 | nmdc:mga06r32_491_c3 | 3300050510 | Bacteria | 3689 |
| 200 | nmdc:mga08y16_33414_c1 | 3300050511 | Bacteria | 5402 |
| 201 | nmdc:mga08y16_8273_c1 | 3300050511 | Bacteria | 10888 |
| 202 | nmdc:mga0n895_9136_c1 | 3300050512 | Bacteria | 8655 |
| 203 | nmdc:mga0a205_5123_c1 | 3300050515 | Bacteria | 7847 |
| 204 | Ga0530510_0008275 | 3300061734 | Bacteria | 7252 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0073195 | Ga0501031_0073195_44_1009 | 262 |
| 2 | 3300061734 | Ga0530510_0008275 | Ga0530510_0008275_4186_5280 | 285 |
| 3 | 3300044901 | Ga0466960_0030555 | Ga0466960_0030555_337_1374 | 287 |
| 4 | 3300026035 | Ga0207703_10311660 | Ga0207703_103116602 | 296 |
| 5 | 3300049577 | Ga0501041_0027155 | Ga0501041_0027155_662_1810 | 298 |
| 6 | 3300049587 | Ga0501071_0099558 | Ga0501071_0099558_981_2129 | 298 |
| 7 | 3300049590 | Ga0501074_0064974 | Ga0501074_0064974_1332_2480 | 298 |
| 8 | 3300049591 | Ga0501075_0134002 | Ga0501075_0134002_673_1821 | 298 |
| 9 | 3300049822 | Ga0501035_0179277 | Ga0501035_0179277_205_1299 | 299 |
| 10 | 3300048913 | Ga0496110_0424954 | Ga0496110_0424954_20_946 | 304 |
| 11 | 3300048917 | Ga0496114_0200827 | Ga0496114_0200827_766_1692 | 304 |
| 12 | 3300037418 | Ga0395900_0143273 | Ga0395900_0143273_169_1269 | 312 |
| 13 | 3300049593 | Ga0501077_0146284 | Ga0501077_0146284_51_1199 | 312 |
| 14 | 3300050510 | nmdc:mga06r32_491_c3 | nmdc:mga06r32_491_c3_1697_2950 | 312 |
| 15 | 3300009147 | Ga0114129_10636294 | Ga0114129_106362942 | 313 |
| 16 | 3300013296 | Ga0157374_10039529 | Ga0157374_100395293 | 313 |
| 17 | 3300048907 | Ga0496104_0000452 | Ga0496104_0000452_14397_15497 | 313 |
| 18 | 3300050507 | nmdc:mga05p37_116244_c1 | nmdc:mga05p37_116244_c1_2115_3215 | 313 |
| 19 | 3300005842 | Ga0068858_100117302 | Ga0068858_1001173022 | 314 |
| 20 | 3300028794 | Ga0307515_10059455 | Ga0307515_100594552 | 314 |
| 21 | 3300038735 | Ga0400485_21496 | Ga0400485_21496_649_1665 | 314 |
| 22 | 3300044735 | Ga0466968_0009149 | Ga0466968_0009149_1586_2722 | 315 |
| 23 | 3300033179 | Ga0307507_10105656 | Ga0307507_101056562 | 316 |
| 24 | 3300048907 | Ga0496104_0046114 | Ga0496104_0046114_1827_2975 | 316 |
| 25 | 3300048908 | Ga0496105_0070723 | Ga0496105_0070723_806_1954 | 316 |
| 26 | 3300048915 | Ga0496112_0240881 | Ga0496112_0240881_544_1602 | 316 |
| 27 | iso_pu_bacteria | 2643221567 | 2643853425 | 317 |
| 28 | iso_pu_bacteria | 2643221624 | 2644137385 | 317 |
| 29 | 3300006847 | Ga0075431_100242685 | Ga0075431_1002426852 | 318 |
| 30 | 3300050510 | nmdc:mga06r32_36_c3 | nmdc:mga06r32_36_c3_808_1908 | 318 |
| 31 | 3300009147 | Ga0114129_10064593 | Ga0114129_100645934 | 319 |
| 32 | 3300009148 | Ga0105243_10006089 | Ga0105243_100060897 | 319 |
| 33 | 3300013297 | Ga0157378_10060175 | Ga0157378_100601752 | 319 |
| 34 | 3300013308 | Ga0157375_10134977 | Ga0157375_101349773 | 319 |
| 35 | 3300013308 | Ga0157375_10254377 | Ga0157375_102543772 | 319 |
| 36 | 3300014968 | Ga0157379_10100332 | Ga0157379_101003322 | 319 |
| 37 | 3300048905 | Ga0496102_0107404 | Ga0496102_0107404_223_1278 | 319 |
| 38 | 3300048908 | Ga0496105_0164867 | Ga0496105_0164867_226_1281 | 319 |
| 39 | 3300048909 | Ga0496106_0110991 | Ga0496106_0110991_310_1365 | 319 |
| 40 | 3300048910 | Ga0496107_0056759 | Ga0496107_0056759_726_1781 | 319 |
| 41 | 3300048913 | Ga0496110_0173464 | Ga0496110_0173464_717_1772 | 319 |
| 42 | 3300048914 | Ga0496111_0015560 | Ga0496111_0015560_3820_4875 | 319 |
| 43 | 3300050507 | nmdc:mga05p37_531009_c1 | nmdc:mga05p37_531009_c1_183_1277 | 319 |
| 44 | 3300005549 | Ga0070704_100098791 | Ga0070704_1000987912 | 322 |
| 45 | 3300044693 | Ga0466961_0063585 | Ga0466961_0063585_551_1633 | 322 |
| 46 | 3300044765 | Ga0466970_0010811 | Ga0466970_0010811_324_1406 | 322 |
| 47 | 3300045976 | Ga0466967_0132656 | Ga0466967_0132656_422_1504 | 322 |
| 48 | 3300048903 | Ga0496100_0114160 | Ga0496100_0114160_769_1869 | 322 |
| 49 | 3300048904 | Ga0496101_0201391 | Ga0496101_0201391_373_1473 | 322 |
| 50 | 3300048907 | Ga0496104_0198830 | Ga0496104_0198830_227_1327 | 322 |
| 51 | 3300048910 | Ga0496107_0016697 | Ga0496107_0016697_3241_4341 | 322 |
| 52 | 3300048911 | Ga0496108_0210042 | Ga0496108_0210042_384_1484 | 322 |
| 53 | 3300048917 | Ga0496114_0014240 | Ga0496114_0014240_3507_4607 | 322 |
| 54 | 3300048918 | Ga0496115_0044454 | Ga0496115_0044454_2069_3169 | 322 |
| 55 | 3300025986 | Ga0207658_10204782 | Ga0207658_102047821 | 324 |
| 56 | 3300031727 | Ga0316576_10010529 | Ga0316576_100105295 | 324 |
| 57 | 3300049583 | Ga0501067_0102602 | Ga0501067_0102602_175_1308 | 324 |
| 58 | 3300005327 | Ga0070658_10215815 | Ga0070658_102158152 | 325 |
| 59 | 3300005337 | Ga0070682_100001809 | Ga0070682_1000018093 | 325 |
| 60 | 3300005338 | Ga0068868_100007792 | Ga0068868_1000077922 | 325 |
| 61 | 3300005345 | Ga0070692_10008578 | Ga0070692_100085783 | 325 |
| 62 | 3300005354 | Ga0070675_100004399 | Ga0070675_10000439910 | 325 |
| 63 | 3300005355 | Ga0070671_100016063 | Ga0070671_1000160635 | 325 |
| 64 | 3300005436 | Ga0070713_100003281 | Ga0070713_1000032813 | 325 |
| 65 | 3300005439 | Ga0070711_100006037 | Ga0070711_1000060376 | 325 |
| 66 | 3300005441 | Ga0070700_100260854 | Ga0070700_1002608541 | 325 |
| 67 | 3300005456 | Ga0070678_100001112 | Ga0070678_1000011125 | 325 |
| 68 | 3300005458 | Ga0070681_10230030 | Ga0070681_102300302 | 325 |
| 69 | 3300005530 | Ga0070679_100042183 | Ga0070679_1000421832 | 325 |
| 70 | 3300005547 | Ga0070693_100000533 | Ga0070693_1000005338 | 325 |
| 71 | 3300005549 | Ga0070704_100090677 | Ga0070704_1000906772 | 325 |
| 72 | 3300005614 | Ga0068856_100171571 | Ga0068856_1001715712 | 325 |
| 73 | 3300005616 | Ga0068852_100000497 | Ga0068852_1000004972 | 325 |
| 74 | 3300005617 | Ga0068859_100063854 | Ga0068859_1000638541 | 325 |
| 75 | 3300005618 | Ga0068864_100014980 | Ga0068864_1000149805 | 325 |
| 76 | 3300005834 | Ga0068851_10004786 | Ga0068851_100047862 | 325 |
| 77 | 3300005840 | Ga0068870_10001637 | Ga0068870_100016374 | 325 |
| 78 | 3300005841 | Ga0068863_100002119 | Ga0068863_10000211914 | 325 |
| 79 | 3300005842 | Ga0068858_100095521 | Ga0068858_1000955212 | 325 |
| 80 | 3300006844 | Ga0075428_100108172 | Ga0075428_1001081722 | 325 |
| 81 | 3300006852 | Ga0075433_10005558 | Ga0075433_100055586 | 325 |
| 82 | 3300006931 | Ga0097620_100063856 | Ga0097620_1000638561 | 325 |
| 83 | 3300007076 | Ga0075435_100008617 | Ga0075435_1000086175 | 325 |
| 84 | 3300009011 | Ga0105251_10017590 | Ga0105251_100175902 | 325 |
| 85 | 3300009093 | Ga0105240_10132973 | Ga0105240_101329733 | 325 |
| 86 | 3300009094 | Ga0111539_10469317 | Ga0111539_104693172 | 325 |
| 87 | 3300009174 | Ga0105241_10018923 | Ga0105241_100189232 | 325 |
| 88 | 3300009545 | Ga0105237_10152014 | Ga0105237_101520142 | 325 |
| 89 | 3300010375 | Ga0105239_10041033 | Ga0105239_100410333 | 325 |
| 90 | 3300013100 | Ga0157373_10009981 | Ga0157373_100099812 | 325 |
| 91 | 3300013104 | Ga0157370_10322674 | Ga0157370_103226741 | 325 |
| 92 | 3300013308 | Ga0157375_10091014 | Ga0157375_100910142 | 325 |
| 93 | 3300014969 | Ga0157376_10042886 | Ga0157376_100428862 | 325 |
| 94 | 3300025901 | Ga0207688_10011777 | Ga0207688_100117771 | 325 |
| 95 | 3300025908 | Ga0207643_10000602 | Ga0207643_100006026 | 325 |
| 96 | 3300025909 | Ga0207705_10147434 | Ga0207705_101474342 | 325 |
| 97 | 3300025912 | Ga0207707_10070348 | Ga0207707_100703483 | 325 |
| 98 | 3300025915 | Ga0207693_10035195 | Ga0207693_100351953 | 325 |
| 99 | 3300025916 | Ga0207663_10017904 | Ga0207663_100179041 | 325 |
| 100 | 3300025917 | Ga0207660_10013594 | Ga0207660_100135942 | 325 |
| 101 | 3300025920 | Ga0207649_10002620 | Ga0207649_100026204 | 325 |
| 102 | 3300025921 | Ga0207652_10007689 | Ga0207652_100076896 | 325 |
| 103 | 3300025925 | Ga0207650_10003326 | Ga0207650_100033265 | 325 |
| 104 | 3300025926 | Ga0207659_10277401 | Ga0207659_102774011 | 325 |
| 105 | 3300025927 | Ga0207687_10009399 | Ga0207687_100093994 | 325 |
| 106 | 3300025928 | Ga0207700_10045979 | Ga0207700_100459792 | 325 |
| 107 | 3300025931 | Ga0207644_10004541 | Ga0207644_100045412 | 325 |
| 108 | 3300025932 | Ga0207690_10008968 | Ga0207690_100089683 | 325 |
| 109 | 3300025933 | Ga0207706_10288567 | Ga0207706_102885671 | 325 |
| 110 | 3300025941 | Ga0207711_10153193 | Ga0207711_101531932 | 325 |
| 111 | 3300025942 | Ga0207689_10009070 | Ga0207689_100090705 | 325 |
| 112 | 3300025945 | Ga0207679_10001354 | Ga0207679_100013545 | 325 |
| 113 | 3300025961 | Ga0207712_10292152 | Ga0207712_102921522 | 325 |
| 114 | 3300026067 | Ga0207678_10001106 | Ga0207678_1000110623 | 325 |
| 115 | 3300026075 | Ga0207708_10007818 | Ga0207708_100078185 | 325 |
| 116 | 3300026078 | Ga0207702_10002580 | Ga0207702_100025805 | 325 |
| 117 | 3300026088 | Ga0207641_10002106 | Ga0207641_100021064 | 325 |
| 118 | 3300026121 | Ga0207683_10002769 | Ga0207683_100027694 | 325 |
| 119 | 3300026142 | Ga0207698_10001685 | Ga0207698_1000168513 | 325 |
| 120 | 3300027907 | Ga0207428_10028333 | Ga0207428_100283334 | 325 |
| 121 | 3300048903 | Ga0496100_0051427 | Ga0496100_0051427_94_1194 | 325 |
| 122 | 3300048908 | Ga0496105_0001018 | Ga0496105_0001018_9117_10217 | 325 |
| 123 | 3300048909 | Ga0496106_0004884 | Ga0496106_0004884_8719_9819 | 325 |
| 124 | 3300048911 | Ga0496108_0023135 | Ga0496108_0023135_3521_4621 | 325 |
| 125 | 3300048912 | Ga0496109_0208971 | Ga0496109_0208971_571_1671 | 325 |
| 126 | 3300048913 | Ga0496110_0001817 | Ga0496110_0001817_2572_3672 | 325 |
| 127 | 3300048914 | Ga0496111_0004317 | Ga0496111_0004317_1179_2279 | 325 |
| 128 | 3300048915 | Ga0496112_0024807 | Ga0496112_0024807_4622_5722 | 325 |
| 129 | 3300050511 | nmdc:mga08y16_8273_c1 | nmdc:mga08y16_8273_c1_2601_3701 | 325 |
| 130 | 3300050512 | nmdc:mga0n895_9136_c1 | nmdc:mga0n895_9136_c1_4280_5380 | 325 |
| 131 | 3300050515 | nmdc:mga0a205_5123_c1 | nmdc:mga0a205_5123_c1_97_1197 | 325 |
| 132 | 3300037853 | Ga0436364_1298760 | Ga0436364_1298760_194_1393 | 326 |
| 133 | 3300009148 | Ga0105243_10069012 | Ga0105243_100690122 | 329 |
| 134 | 3300013105 | Ga0157369_10127749 | Ga0157369_101277492 | 329 |
| 135 | 3300013307 | Ga0157372_10326061 | Ga0157372_103260611 | 329 |
| 136 | 3300048911 | Ga0496108_0032475 | Ga0496108_0032475_2864_3931 | 329 |
| 137 | 3300048911 | Ga0496108_0126550 | Ga0496108_0126550_479_1537 | 329 |
| 138 | 3300048912 | Ga0496109_0129957 | Ga0496109_0129957_553_1620 | 329 |
| 139 | 3300048914 | Ga0496111_0051523 | Ga0496111_0051523_1574_2641 | 329 |
| 140 | 3300048917 | Ga0496114_0009338 | Ga0496114_0009338_2933_4081 | 332 |
| 141 | 3300005548 | Ga0070665_100196691 | Ga0070665_1001966912 | 333 |
| 142 | 3300045976 | Ga0466967_0081098 | Ga0466967_0081098_66_1268 | 333 |
| 143 | 3300048918 | Ga0496115_0084866 | Ga0496115_0084866_691_1884 | 333 |
| 144 | iso_pu_bacteria | 2866612099 | 2866616321 | 333 |
| 145 | iso_pu_bacteria | 2917736166 | 2917743998 | 333 |
| 146 | 3300044765 | Ga0466970_0118516 | Ga0466970_0118516_20_1105 | 334 |
| 147 | iso_pu_bacteria | 2862705112 | 2862709095 | 334 |
| 148 | iso_pu_bacteria | 8008485437 | 8008488034 | 334 |
| 149 | iso_pu_bacteria | 8025524527 | 8025527111 | 334 |
| 150 | 3300005329 | Ga0070683_100061418 | Ga0070683_1000614182 | 335 |
| 151 | 3300005329 | Ga0070683_100090987 | Ga0070683_1000909872 | 335 |
| 152 | 3300005343 | Ga0070687_100011162 | Ga0070687_1000111623 | 335 |
| 153 | 3300005345 | Ga0070692_10005128 | Ga0070692_100051282 | 335 |
| 154 | 3300005356 | Ga0070674_100007677 | Ga0070674_1000076775 | 335 |
| 155 | 3300005365 | Ga0070688_100138775 | Ga0070688_1001387752 | 335 |
| 156 | 3300005441 | Ga0070700_100005607 | Ga0070700_1000056073 | 335 |
| 157 | 3300005459 | Ga0068867_100004733 | Ga0068867_1000047333 | 335 |
| 158 | 3300005535 | Ga0070684_100304908 | Ga0070684_1003049081 | 335 |
| 159 | 3300005539 | Ga0068853_100140213 | Ga0068853_1001402131 | 335 |
| 160 | 3300005543 | Ga0070672_100024532 | Ga0070672_1000245323 | 335 |
| 161 | 3300005544 | Ga0070686_100225139 | Ga0070686_1002251391 | 335 |
| 162 | 3300005616 | Ga0068852_100486594 | Ga0068852_1004865942 | 335 |
| 163 | 3300005834 | Ga0068851_10170124 | Ga0068851_101701241 | 335 |
| 164 | 3300005840 | Ga0068870_10001919 | Ga0068870_100019194 | 335 |
| 165 | 3300006881 | Ga0068865_100122428 | Ga0068865_1001224282 | 335 |
| 166 | 3300009098 | Ga0105245_10189870 | Ga0105245_101898702 | 335 |
| 167 | 3300009148 | Ga0105243_10006770 | Ga0105243_100067704 | 335 |
| 168 | 3300009553 | Ga0105249_10024172 | Ga0105249_100241726 | 335 |
| 169 | 3300014745 | Ga0157377_10010083 | Ga0157377_100100832 | 335 |
| 170 | 3300020082 | Ga0206353_11497251 | Ga0206353_114972513 | 335 |
| 171 | 3300025908 | Ga0207643_10002401 | Ga0207643_100024016 | 335 |
| 172 | 3300025918 | Ga0207662_10020252 | Ga0207662_100202522 | 335 |
| 173 | 3300025937 | Ga0207669_10128767 | Ga0207669_101287672 | 335 |
| 174 | 3300025940 | Ga0207691_10013460 | Ga0207691_100134606 | 335 |
| 175 | 3300026075 | Ga0207708_10006138 | Ga0207708_100061387 | 335 |
| 176 | 3300026089 | Ga0207648_10017780 | Ga0207648_100177803 | 335 |
| 177 | 3300026116 | Ga0207674_10304662 | Ga0207674_103046622 | 335 |
| 178 | 3300026142 | Ga0207698_10304986 | Ga0207698_103049862 | 335 |
| 179 | 3300028573 | Ga0265334_10025508 | Ga0265334_100255082 | 335 |
| 180 | 3300028800 | Ga0265338_10005080 | Ga0265338_100050808 | 335 |
| 181 | 3300031241 | Ga0265325_10001949 | Ga0265325_100019495 | 335 |
| 182 | 3300031595 | Ga0265313_10002215 | Ga0265313_100022158 | 335 |
| 183 | 3300037418 | Ga0395900_0348358 | Ga0395900_0348358_135_1241 | 335 |
| 184 | 3300038443 | Ga0395901_0234585 | Ga0395901_0234585_370_1476 | 335 |
| 185 | 3300048912 | Ga0496109_0188976 | Ga0496109_0188976_383_1459 | 335 |
| 186 | 3300048913 | Ga0496110_0028170 | Ga0496110_0028170_2647_3723 | 335 |
| 187 | iso_pu_bacteria | 8057568493 | 8057573891 | 335 |
| 188 | 3300006038 | Ga0075365_10022347 | Ga0075365_100223473 | 336 |
| 189 | 3300025961 | Ga0207712_10104035 | Ga0207712_101040353 | 336 |
| 190 | 3300027907 | Ga0207428_10071027 | Ga0207428_100710272 | 336 |
| 191 | 3300050511 | nmdc:mga08y16_33414_c1 | nmdc:mga08y16_33414_c1_1187_2266 | 336 |
| 192 | iso_pu_bacteria | 2919446982 | 2919447194 | 336 |
| 193 | iso_pu_bacteria | 8047710418 | 8047710666 | 336 |
| 194 | 3300005354 | Ga0070675_100272698 | Ga0070675_1002726981 | 338 |
| 195 | 3300005456 | Ga0070678_100230571 | Ga0070678_1002305712 | 338 |
| 196 | 3300005466 | Ga0070685_10152386 | Ga0070685_101523862 | 338 |
| 197 | 3300005844 | Ga0068862_100143884 | Ga0068862_1001438842 | 338 |
| 198 | 3300006881 | Ga0068865_100262146 | Ga0068865_1002621462 | 338 |
| 199 | 3300025271 | Ga0207666_1003763 | Ga0207666_10037632 | 338 |
| 200 | 3300025934 | Ga0207686_10229398 | Ga0207686_102293982 | 338 |
| 201 | 3300025936 | Ga0207670_10171288 | Ga0207670_101712881 | 338 |
| 202 | 3300026089 | Ga0207648_10024312 | Ga0207648_100243122 | 338 |
| 203 | 3300026121 | Ga0207683_10265544 | Ga0207683_102655442 | 338 |
| 204 | iso_pu_bacteria | 2643221604 | 2644034004 | 338 |
| 205 | iso_pu_bacteria | 2643221617 | 2644099570 | 338 |
| 206 | iso_pu_bacteria | 2643221620 | 2644116236 | 338 |
| 207 | iso_pu_bacteria | 2738541305 | 2738871605 | 338 |
| 208 | iso_pu_bacteria | 2867346516 | 2867346747 | 338 |
| 209 | iso_pu_bacteria | 8003314358 | 8003320224 | 338 |
| 210 | 3300026142 | Ga0207698_10319239 | Ga0207698_103192392 | 339 |
| 211 | 3300044658 | Ga0466972_0073818 | Ga0466972_0073818_106_1203 | 339 |
| 212 | iso_pu_bacteria | 2990044586 | 2990049792 | 339 |
| 213 | 3300013307 | Ga0157372_10267038 | Ga0157372_102670382 | 340 |
| 214 | iso_pu_bacteria | 2515154129 | 2515722913 | 340 |
| 215 | iso_pu_bacteria | 2515154202 | 2516085058 | 340 |
| 216 | 3300014968 | Ga0157379_10291421 | Ga0157379_102914212 | 341 |
| 217 | 3300035207 | Ga0373942_0009734 | Ga0373942_0009734_365_1585 | 341 |
| 218 | 3300044683 | Ga0466965_0055848 | Ga0466965_0055848_271_1368 | 341 |
| 219 | iso_pu_bacteria | 2811994874 | 2812333945 | 341 |
| 220 | iso_pu_bacteria | 8003856774 | 8003857935 | 341 |
| 221 | 3300049586 | Ga0501070_0154768 | Ga0501070_0154768_417_1568 | 342 |
| 222 | iso_pu_bacteria | 2984576629 | 2984580360 | 342 |
| 223 | iso_pu_bacteria | 2990256926 | 2990258053 | 342 |
| 224 | 3300006353 | Ga0075370_10091118 | Ga0075370_100911182 | 343 |
| 225 | 3300045976 | Ga0466967_0190607 | Ga0466967_0190607_153_1262 | 343 |
| 226 | 3300026078 | Ga0207702_10011788 | Ga0207702_100117883 | 344 |
| 227 | iso_pu_bacteria | 2832004796 | 2832010698 | 345 |
| 228 | iso_pu_bacteria | 2866065130 | 2866069462 | 345 |
| 229 | iso_pu_bacteria | 2767802112 | 2768645725 | 346 |
| 230 | iso_pu_bacteria | 2861520306 | 2861526258 | 346 |
| 231 | iso_pu_bacteria | 2867369537 | 2867374819 | 346 |
| 232 | iso_pu_bacteria | 2867507094 | 2867512351 | 346 |
| 233 | iso_pu_bacteria | 2501939600 | 2501943817 | 348 |
| 234 | iso_pu_bacteria | 649633069 | 649814623 | 348 |
| 235 | 3300003323 | rootH1_10244258 | rootH1_102442582 | 349 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4de6-assembly1.cif.gz_A | horse spleen apo-ferritin complex with arachidonic acid | 0.4267 | 202 | 301 |
| 5gou-assembly1.cif.gz_A | structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign | 0.3844 | 205 | 330 |
| 2za8-assembly1.cif.gz_A | recombinant horse l-chain apoferritin n-terminal deletion mutant (residues 1-8) | 0.3618 | 204 | 322 |
| 3af8-assembly1.cif.gz_X | crystal structure of pd(ally)/apo-c126afr | 0.3618 | 202 | 322 |
| 5x3x-assembly2.cif.gz_q | 2.8a resolution structure of a cobalt energy-coupling factor transporter-cbimqo | 0.3476 | 5 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O01578_26_133_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.4194 | 187 | 278 | 1.10.10.1740 |
| af_A0A1D6NFR3_201_388_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3998 | 200 | 328 | 1.20.120.1770 |
| 5gouA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3844 | 205 | 330 | 1.20.1260.10 |
| 5gouA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3446 | 205 | 330 | 1.20.1260.10 |
| af_Q4DEV8_1_176_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3425 | 163 | 328 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3H9P4-F1-model_v4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.8004 | 8 | 127 |
GO:0016020
|
| AF-A0A0M8WQA0-F1-model_v4 | Cobalt ABC transporter permease | 0.7335 | 17 | 333 |
GO:0005886
|
| AF-A0A1C9WN10-F1-model_v4 | ECF transporter S component | 0.7251 | 37 | 205 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-A0A0M8WQA0-F1-model_v4 | Cobalt ABC transporter permease | 0.7238 | 17 | 333 |
GO:0005886
|
| AF-A0A7K1ASP0-F1-model_v4 | Uncharacterized protein | 0.7233 | 8 | 150 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar