F348233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 142 | 228 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10235153|Ga0207702_102351531 |
| Length | 420 |
| Sequence | LVSFINARGDARWYVTVFGARFTMGNALCEAGDCHLNIHNDYYFSTMITALHNLRLITDGSIRPGKVILITDXXIIAISEESSIPENVTKIDLKGAYVAPGLLDLQIYGSGGKLFAGTPVVEALERMENDLLAQGTTGFFATIGTNTPAIFEQGIAAAKAYRKYAKGNFLGMHFEGPYLNPAKRGAHPANLIKKGTLDEVKRWVDSAEGEIKMMTIAPELQDQEVIAYLHANGVILSSGHSNASYDEGKAFLNKPIPAVTHLFNAMPQMHHREPGYIPAIFEERPYTSVVADGIHVDFAMIRLAKRELGDKLFLITDAVTAVTEGTYQHQFTGDRYVMPDGTLSGSCLSMLKAAQNCVEKVGIDLAEAINMASLYPAQLAKMPHKGRVAVGCDADLIVFNDAFEVLGTVFKGEQNMNFTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 5 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 6 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 7 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 8 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 114 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 141 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.74 |
| Metatranscriptomes | 0.85 |
| Isolates | 3.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.81 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 86.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004104 | 3300001904 | Bacteria | 2502 |
| 2 | JGI24739J22299_10039162 | 3300001989 | Bacteria | 1589 |
| 3 | JGI24739J22299_10051735 | 3300001989 | Bacteria | 1324 |
| 4 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 5 | JGI25162J39368_1000301 | 3300002737 | Bacteria | 45433 |
| 6 | JGI25162J39368_1002474 | 3300002737 | Bacteria | 7135 |
| 7 | JGI25165J46597_1000456 | 3300003214 | Bacteria | 41124 |
| 8 | rootH1_10021888 | 3300003316 | Bacteria | 3968 |
| 9 | rootH1_10036994 | 3300003316 | Bacteria | 7881 |
| 10 | rootH2_10002709 | 3300003320 | Bacteria | 20537 |
| 11 | rootH2_10089059 | 3300003320 | Bacteria | 6955 |
| 12 | rootL2_10054152 | 3300003322 | Bacteria | 3544 |
| 13 | rootH1_10000975 | 3300003316 | Bacteria | 12698 |
| 14 | rootH1_10000975 | 3300003323 | Bacteria | 22074 |
| 15 | rootH1_10123672 | 3300003323 | Bacteria | 1465 |
| 16 | Ga0058863_10081386 | 3300004799 | Bacteria | 5279 |
| 17 | Ga0058862_12459938 | 3300004803 | Bacteria | 1831 |
| 18 | Ga0065714_10070953 | 3300005288 | Bacteria | 3712 |
| 19 | Ga0065714_10082520 | 3300005288 | Bacteria | 2288 |
| 20 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 21 | Ga0070666_10000128 | 3300005335 | Bacteria | 53252 |
| 22 | Ga0068868_100082508 | 3300005338 | Unclassified | 2578 |
| 23 | Ga0068868_100314124 | 3300005338 | Bacteria | 1334 |
| 24 | Ga0070671_100040160 | 3300005355 | Bacteria | 3886 |
| 25 | Ga0070671_100220374 | 3300005355 | Bacteria | 1609 |
| 26 | Ga0070673_100120328 | 3300005364 | Bacteria | 2189 |
| 27 | Ga0070659_100016670 | 3300005366 | Bacteria | 5518 |
| 28 | Ga0070667_100018783 | 3300005367 | Bacteria | 5733 |
| 29 | Ga0070663_100012729 | 3300005455 | Bacteria | 5333 |
| 30 | Ga0070662_100001291 | 3300005457 | Bacteria | 15376 |
| 31 | Ga0070681_10034790 | 3300005458 | Bacteria | 5059 |
| 32 | Ga0068867_100000904 | 3300005459 | Bacteria | 20133 |
| 33 | Ga0070679_100010335 | 3300005530 | Bacteria | 8849 |
| 34 | Ga0070679_100036706 | 3300005530 | Bacteria | 4864 |
| 35 | Ga0070679_100292819 | 3300005530 | Bacteria | 1579 |
| 36 | Ga0070684_100092576 | 3300005535 | Bacteria | 2690 |
| 37 | Ga0068855_100000177 | 3300005563 | Bacteria | 82003 |
| 38 | Ga0068855_100009928 | 3300005563 | Bacteria | 11481 |
| 39 | Ga0068855_100014897 | 3300005563 | Bacteria | 9366 |
| 40 | Ga0068855_100271428 | 3300005563 | Bacteria | 1886 |
| 41 | Ga0068856_100003383 | 3300005614 | Bacteria | 16151 |
| 42 | Ga0068856_100009146 | 3300005614 | Bacteria | 9630 |
| 43 | Ga0068856_100084195 | 3300005614 | Bacteria | 3159 |
| 44 | Ga0068856_100208732 | 3300005614 | Bacteria | 1968 |
| 45 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 46 | Ga0068851_10078701 | 3300005834 | Unclassified | 1718 |
| 47 | Ga0068863_100079483 | 3300005841 | Bacteria | 3106 |
| 48 | Ga0068858_100091320 | 3300005842 | Bacteria | 2834 |
| 49 | Ga0068858_100186858 | 3300005842 | Bacteria | 1957 |
| 50 | Ga0068860_100003505 | 3300005843 | Bacteria | 16152 |
| 51 | Ga0068860_100012749 | 3300005843 | Bacteria | 8264 |
| 52 | Ga0075366_10000660 | 3300006195 | Bacteria | 16235 |
| 53 | Ga0075366_10010515 | 3300006195 | Bacteria | 5196 |
| 54 | Ga0097621_100000174 | 3300006237 | Bacteria | 40714 |
| 55 | Ga0097621_100103601 | 3300006237 | Bacteria | 2397 |
| 56 | Ga0068871_100000060 | 3300006358 | Bacteria | 59245 |
| 57 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 58 | Ga0105240_10002497 | 3300009093 | Bacteria | 29564 |
| 59 | Ga0105240_10116264 | 3300009093 | Bacteria | 3227 |
| 60 | Ga0105240_10119427 | 3300009093 | Bacteria | 3175 |
| 61 | Ga0105240_10262791 | 3300009093 | Bacteria | 1990 |
| 62 | Ga0105247_10024254 | 3300009101 | Bacteria | 3654 |
| 63 | Ga0105243_10111282 | 3300009148 | Bacteria | 2292 |
| 64 | Ga0105241_10000510 | 3300009174 | Bacteria | 29254 |
| 65 | Ga0105241_10005050 | 3300009174 | Bacteria | 9738 |
| 66 | Ga0105241_10007345 | 3300009174 | Bacteria | 8104 |
| 67 | Ga0105241_10028919 | 3300009174 | Bacteria | 4130 |
| 68 | Ga0105242_10115429 | 3300009176 | Bacteria | 2295 |
| 69 | Ga0105237_10001030 | 3300009545 | Bacteria | 37560 |
| 70 | Ga0105237_10006927 | 3300009545 | Bacteria | 12496 |
| 71 | Ga0105237_10008634 | 3300009545 | Bacteria | 11015 |
| 72 | Ga0105237_10293962 | 3300009545 | Bacteria | 1627 |
| 73 | Ga0105237_10347209 | 3300009545 | Bacteria | 1488 |
| 74 | Ga0105238_10041236 | 3300009551 | Bacteria | 4676 |
| 75 | Ga0105238_10076789 | 3300009551 | Bacteria | 3332 |
| 76 | Ga0105249_10005809 | 3300009553 | Bacteria | 10672 |
| 77 | Ga0105239_10000865 | 3300010375 | Bacteria | 43041 |
| 78 | Ga0105239_10002625 | 3300010375 | Bacteria | 22737 |
| 79 | Ga0105239_10004217 | 3300010375 | Bacteria | 17268 |
| 80 | Ga0105239_10015371 | 3300010375 | Bacteria | 8479 |
| 81 | Ga0105239_10019481 | 3300010375 | Bacteria | 7490 |
| 82 | Ga0105239_10020300 | 3300010375 | Bacteria | 7329 |
| 83 | Ga0105239_10116120 | 3300010375 | Bacteria | 2970 |
| 84 | Ga0105246_10014766 | 3300011119 | Bacteria | 4918 |
| 85 | Ga0157373_10000034 | 3300013100 | Bacteria | 124053 |
| 86 | Ga0157373_10014428 | 3300013100 | Bacteria | 5791 |
| 87 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 88 | Ga0157371_10038757 | 3300013102 | Bacteria | 3409 |
| 89 | Ga0157371_10082843 | 3300013102 | Bacteria | 2271 |
| 90 | Ga0157370_10023850 | 3300013104 | Bacteria | 6068 |
| 91 | Ga0157369_10001235 | 3300013105 | Bacteria | 31847 |
| 92 | Ga0157369_10141939 | 3300013105 | Bacteria | 2541 |
| 93 | Ga0157369_10508876 | 3300013105 | Bacteria | 1246 |
| 94 | Ga0157369_10508877 | 3300013105 | Bacteria | 1246 |
| 95 | Ga0157374_10000948 | 3300013296 | Bacteria | 25182 |
| 96 | Ga0157374_10009410 | 3300013296 | Bacteria | 8386 |
| 97 | Ga0157378_10151015 | 3300013297 | Bacteria | 2164 |
| 98 | Ga0157378_10499940 | 3300013297 | Unclassified | 1214 |
| 99 | Ga0163162_10000599 | 3300013306 | Bacteria | 33336 |
| 100 | Ga0163162_10028147 | 3300013306 | Bacteria | 5559 |
| 101 | Ga0163162_10063712 | 3300013306 | Bacteria | 3730 |
| 102 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 103 | Ga0157372_10012894 | 3300013307 | Bacteria | 8911 |
| 104 | Ga0157372_10047377 | 3300013307 | Bacteria | 4776 |
| 105 | Ga0157372_10065631 | 3300013307 | Bacteria | 4076 |
| 106 | Ga0157372_10112528 | 3300013307 | Bacteria | 3119 |
| 107 | Ga0157372_10225648 | 3300013307 | Bacteria | 2172 |
| 108 | Ga0157372_10482760 | 3300013307 | Bacteria | 1445 |
| 109 | Ga0157375_10037010 | 3300013308 | Bacteria | 4672 |
| 110 | Ga0163163_10193118 | 3300014325 | Bacteria | 2084 |
| 111 | Ga0157379_10082932 | 3300014968 | Bacteria | 2873 |
| 112 | Ga0157379_10106889 | 3300014968 | Unclassified | 2512 |
| 113 | Ga0209563_104608 | 3300025230 | Bacteria | 2611 |
| 114 | Ga0207427_100083 | 3300025231 | Bacteria | 142745 |
| 115 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 116 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 117 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 118 | Ga0209233_1001001 | 3300025261 | Bacteria | 12075 |
| 119 | Ga0209233_1022411 | 3300025261 | Bacteria | 1617 |
| 120 | Ga0207656_10041284 | 3300025321 | Unclassified | 1960 |
| 121 | Ga0207680_10000212 | 3300025903 | Bacteria | 27928 |
| 122 | Ga0207647_10000231 | 3300025904 | Bacteria | 46261 |
| 123 | Ga0207647_10000529 | 3300025904 | Bacteria | 30445 |
| 124 | Ga0207645_10000347 | 3300025907 | Bacteria | 38694 |
| 125 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 126 | Ga0207654_10003074 | 3300025911 | Bacteria | 8455 |
| 127 | Ga0207654_10012878 | 3300025911 | Bacteria | 4291 |
| 128 | Ga0207654_10013537 | 3300025911 | Bacteria | 4197 |
| 129 | Ga0207654_10015040 | 3300025911 | Bacteria | 4008 |
| 130 | Ga0207695_10000179 | 3300025913 | Bacteria | 185564 |
| 131 | Ga0207695_10012733 | 3300025913 | Bacteria | 10071 |
| 132 | Ga0207695_10042583 | 3300025913 | Bacteria | 4848 |
| 133 | Ga0207671_10000769 | 3300025914 | Bacteria | 40631 |
| 134 | Ga0207671_10000815 | 3300025914 | Bacteria | 39441 |
| 135 | Ga0207671_10001806 | 3300025914 | Bacteria | 23915 |
| 136 | Ga0207671_10009106 | 3300025914 | Bacteria | 8341 |
| 137 | Ga0207671_10184345 | 3300025914 | Bacteria | 1625 |
| 138 | Ga0207657_10015841 | 3300025919 | Bacteria | 7284 |
| 139 | Ga0207652_10019343 | 3300025921 | Bacteria | 5600 |
| 140 | Ga0207694_10018515 | 3300025924 | Bacteria | 5262 |
| 141 | Ga0207694_10042194 | 3300025924 | Bacteria | 3518 |
| 142 | Ga0207687_10166223 | 3300025927 | Bacteria | 1697 |
| 143 | Ga0207644_10083634 | 3300025931 | Bacteria | 2364 |
| 144 | Ga0207644_10184985 | 3300025931 | Bacteria | 1635 |
| 145 | Ga0207690_10031179 | 3300025932 | Bacteria | 3409 |
| 146 | Ga0207706_10000406 | 3300025933 | Bacteria | 46320 |
| 147 | Ga0207686_10017163 | 3300025934 | Bacteria | 4075 |
| 148 | Ga0207704_10000307 | 3300025938 | Bacteria | 22913 |
| 149 | Ga0207691_10036786 | 3300025940 | Bacteria | 4535 |
| 150 | Ga0207689_10000602 | 3300025942 | Bacteria | 34433 |
| 151 | Ga0207661_10163604 | 3300025944 | Bacteria | 1932 |
| 152 | Ga0207667_10000070 | 3300025949 | Bacteria | 180479 |
| 153 | Ga0207667_10002580 | 3300025949 | Bacteria | 22502 |
| 154 | Ga0207667_10168447 | 3300025949 | Bacteria | 2252 |
| 155 | Ga0207667_10245267 | 3300025949 | Bacteria | 1833 |
| 156 | Ga0207712_10035720 | 3300025961 | Bacteria | 3379 |
| 157 | Ga0207658_10036238 | 3300025986 | Unclassified | 3536 |
| 158 | Ga0207658_10041991 | 3300025986 | Bacteria | 3315 |
| 159 | Ga0207677_10006592 | 3300026023 | Bacteria | 6370 |
| 160 | Ga0207703_10032250 | 3300026035 | Bacteria | 4145 |
| 161 | Ga0207678_10017163 | 3300026067 | Bacteria | 6354 |
| 162 | Ga0207702_10000194 | 3300026078 | Bacteria | 71816 |
| 163 | Ga0207702_10011155 | 3300026078 | Bacteria | 7497 |
| 164 | Ga0207702_10023393 | 3300026078 | Bacteria | 5124 |
| 165 | Ga0207702_10235153 | 3300026078 | Bacteria | 1714 |
| 166 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 167 | Ga0207648_10000647 | 3300026089 | Bacteria | 39104 |
| 168 | Ga0207676_10072340 | 3300026095 | Bacteria | 2771 |
| 169 | Ga0207683_10002531 | 3300026121 | Bacteria | 15963 |
| 170 | Ga0207698_10017428 | 3300026142 | Bacteria | 4872 |
| 171 | Ga0268264_10000844 | 3300028381 | Bacteria | 32786 |
| 172 | Ga0268264_10002184 | 3300028381 | Bacteria | 17393 |
| 173 | Ga0307517_10001797 | 3300028786 | Bacteria | 35313 |
| 174 | Ga0307515_10120832 | 3300028794 | Bacteria | 2968 |
| 175 | Ga0307515_10124073 | 3300028794 | Bacteria | 2900 |
| 176 | Ga0265327_10085951 | 3300031251 | Bacteria | 1544 |
| 177 | Ga0307507_10000143 | 3300033179 | Bacteria | 124248 |
| 178 | Ga0307510_10132732 | 3300033180 | Bacteria | 2157 |
| 179 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 180 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 181 | Ga0395900_0000140 | 3300037418 | Bacteria | 121917 |
| 182 | Ga0395900_0000251 | 3300037418 | Bacteria | 83846 |
| 183 | Ga0395900_0120455 | 3300037418 | Bacteria | 2692 |
| 184 | Ga0395905_0000248 | 3300037471 | Bacteria | 81042 |
| 185 | Ga0395905_0001526 | 3300037471 | Bacteria | 27691 |
| 186 | Ga0395901_0000145 | 3300038443 | Bacteria | 91739 |
| 187 | Ga0466959_0219795 | 3300045049 | Bacteria | 1318 |
| 188 | Ga0466958_0029865 | 3300045836 | Bacteria | 3235 |
| 189 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 190 | Ga0495585_0000250 | 3300046492 | Bacteria | 55780 |
| 191 | Ga0495585_0002074 | 3300046492 | Bacteria | 14718 |
| 192 | Ga0495596_0080760 | 3300046500 | Bacteria | 1262 |
| 193 | Ga0495583_0015143 | 3300046506 | Bacteria | 4209 |
| 194 | Ga0495606_0001103 | 3300046507 | Bacteria | 38654 |
| 195 | Ga0495606_0034761 | 3300046507 | Bacteria | 3456 |
| 196 | Ga0495616_0000353 | 3300046513 | Bacteria | 35893 |
| 197 | Ga0495616_0010044 | 3300046513 | Bacteria | 5495 |
| 198 | Ga0495631_0071351 | 3300046518 | Bacteria | 1501 |
| 199 | Ga0495637_0046785 | 3300046520 | Bacteria | 1829 |
| 200 | Ga0495644_0065008 | 3300046523 | Unclassified | 1371 |
| 201 | Ga0495648_0009001 | 3300046524 | Bacteria | 7795 |
| 202 | Ga0495654_0045609 | 3300046530 | Bacteria | 2162 |
| 203 | Ga0495609_0031421 | 3300046538 | Bacteria | 2414 |
| 204 | Ga0495633_0000083 | 3300046558 | Bacteria | 125035 |
| 205 | Ga0495668_0000055 | 3300046616 | Bacteria | 199412 |
| 206 | Ga0495668_0059509 | 3300046616 | Bacteria | 2108 |
| 207 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 208 | Ga0495625_0001180 | 3300046660 | Bacteria | 33548 |
| 209 | Ga0495661_0001577 | 3300046665 | Bacteria | 18785 |
| 210 | Ga0495661_0004587 | 3300046665 | Bacteria | 9943 |
| 211 | Ga0495661_0069519 | 3300046665 | Bacteria | 2063 |
| 212 | Ga0495671_0045107 | 3300046692 | Bacteria | 2208 |
| 213 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 214 | Ga0495660_0042854 | 3300046810 | Bacteria | 2499 |
| 215 | Ga0495683_0006585 | 3300047323 | Bacteria | 6338 |
| 216 | Ga0495687_000888 | 3300047443 | Bacteria | 31504 |
| 217 | Ga0495686_0000917 | 3300047472 | Bacteria | 36995 |
| 218 | Ga0495686_0000931 | 3300047472 | Bacteria | 36438 |
| 219 | Ga0495686_0042956 | 3300047472 | Bacteria | 2870 |
| 220 | Ga0495686_0067013 | 3300047472 | Bacteria | 2217 |
| 221 | Ga0495686_0094177 | 3300047472 | Bacteria | 1815 |
| 222 | Ga0495614_0000945 | 3300048089 | Bacteria | 12334 |
| 223 | Ga0495678_003723 | 3300049459 | Bacteria | 9221 |
| 224 | Ga0495682_0021652 | 3300049460 | Bacteria | 2407 |
| 225 | nmdc:mga0k408_710_c1 | 3300050493 | Bacteria | 18223 |
| 226 | Ga0500608_001030 | 3300053122 | Bacteria | 9990 |
| 227 | Ga0500618_000006 | 3300053125 | Bacteria | 239188 |
| 228 | Ga0500624_000631 | 3300053157 | Bacteria | 9385 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0015143 | Ga0495583_0015143_921_2045 | 355 |
| 2 | 3300046665 | Ga0495661_0004587 | Ga0495661_0004587_8563_9687 | 355 |
| 3 | 3300046665 | Ga0495661_0069519 | Ga0495661_0069519_870_1994 | 355 |
| 4 | 3300003323 | rootH1_10000975 | rootH1_100009753 | 356 |
| 5 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_302938_304062 | 359 |
| 6 | 3300009545 | Ga0105237_10347209 | Ga0105237_103472092 | 360 |
| 7 | 3300005338 | Ga0068868_100082508 | Ga0068868_1000825082 | 361 |
| 8 | 3300005364 | Ga0070673_100120328 | Ga0070673_1001203282 | 361 |
| 9 | 3300005367 | Ga0070667_100018783 | Ga0070667_1000187833 | 361 |
| 10 | 3300005834 | Ga0068851_10078701 | Ga0068851_100787012 | 361 |
| 11 | 3300005841 | Ga0068863_100079483 | Ga0068863_1000794832 | 361 |
| 12 | 3300005843 | Ga0068860_100003505 | Ga0068860_1000035053 | 361 |
| 13 | 3300013297 | Ga0157378_10499940 | Ga0157378_104999401 | 361 |
| 14 | 3300014325 | Ga0163163_10193118 | Ga0163163_101931182 | 361 |
| 15 | 3300014968 | Ga0157379_10106889 | Ga0157379_101068893 | 361 |
| 16 | 3300025321 | Ga0207656_10041284 | Ga0207656_100412842 | 361 |
| 17 | 3300025986 | Ga0207658_10036238 | Ga0207658_100362383 | 361 |
| 18 | 3300028381 | Ga0268264_10002184 | Ga0268264_100021844 | 361 |
| 19 | 3300010375 | Ga0105239_10002625 | Ga0105239_1000262511 | 362 |
| 20 | 3300046513 | Ga0495616_0000353 | Ga0495616_0000353_33343_34467 | 362 |
| 21 | 3300046660 | Ga0495625_0000018 | Ga0495625_0000018_236096_237220 | 362 |
| 22 | 3300046694 | Ga0495649_0000015 | Ga0495649_0000015_164790_165914 | 362 |
| 23 | 3300005335 | Ga0070666_10000128 | Ga0070666_1000012829 | 363 |
| 24 | 3300005338 | Ga0068868_100314124 | Ga0068868_1003141241 | 363 |
| 25 | 3300005355 | Ga0070671_100220374 | Ga0070671_1002203741 | 363 |
| 26 | 3300005617 | Ga0068859_100000018 | Ga0068859_10000001888 | 363 |
| 27 | 3300005842 | Ga0068858_100186858 | Ga0068858_1001868582 | 363 |
| 28 | 3300005843 | Ga0068860_100012749 | Ga0068860_1000127497 | 363 |
| 29 | 3300006237 | Ga0097621_100103601 | Ga0097621_1001036013 | 363 |
| 30 | 3300006931 | Ga0097620_100000018 | Ga0097620_10000001888 | 363 |
| 31 | 3300009101 | Ga0105247_10024254 | Ga0105247_100242542 | 363 |
| 32 | 3300009148 | Ga0105243_10111282 | Ga0105243_101112821 | 363 |
| 33 | 3300009174 | Ga0105241_10000510 | Ga0105241_1000051020 | 363 |
| 34 | 3300009545 | Ga0105237_10001030 | Ga0105237_1000103018 | 363 |
| 35 | 3300009553 | Ga0105249_10005809 | Ga0105249_100058092 | 363 |
| 36 | 3300010375 | Ga0105239_10019481 | Ga0105239_100194817 | 363 |
| 37 | 3300011119 | Ga0105246_10014766 | Ga0105246_100147663 | 363 |
| 38 | 3300013306 | Ga0163162_10000599 | Ga0163162_1000059919 | 363 |
| 39 | 3300013306 | Ga0163162_10063712 | Ga0163162_100637122 | 363 |
| 40 | 3300013308 | Ga0157375_10037010 | Ga0157375_100370103 | 363 |
| 41 | 3300014968 | Ga0157379_10082932 | Ga0157379_100829322 | 363 |
| 42 | 3300025903 | Ga0207680_10000212 | Ga0207680_100002127 | 363 |
| 43 | 3300025911 | Ga0207654_10013537 | Ga0207654_100135372 | 363 |
| 44 | 3300025914 | Ga0207671_10001806 | Ga0207671_1000180614 | 363 |
| 45 | 3300025927 | Ga0207687_10166223 | Ga0207687_101662232 | 363 |
| 46 | 3300025931 | Ga0207644_10184985 | Ga0207644_101849852 | 363 |
| 47 | 3300025940 | Ga0207691_10036786 | Ga0207691_100367865 | 363 |
| 48 | 3300025942 | Ga0207689_10000602 | Ga0207689_1000060220 | 363 |
| 49 | 3300025961 | Ga0207712_10035720 | Ga0207712_100357202 | 363 |
| 50 | 3300025986 | Ga0207658_10041991 | Ga0207658_100419913 | 363 |
| 51 | 3300026035 | Ga0207703_10032250 | Ga0207703_100322503 | 363 |
| 52 | 3300026088 | Ga0207641_10000015 | Ga0207641_1000001518 | 363 |
| 53 | 3300026095 | Ga0207676_10072340 | Ga0207676_100723402 | 363 |
| 54 | 3300026142 | Ga0207698_10017428 | Ga0207698_100174284 | 363 |
| 55 | 3300028381 | Ga0268264_10000844 | Ga0268264_1000084412 | 363 |
| 56 | 3300046513 | Ga0495616_0010044 | Ga0495616_0010044_353_1474 | 363 |
| 57 | 3300046692 | Ga0495671_0045107 | Ga0495671_0045107_139_1260 | 363 |
| 58 | 3300049459 | Ga0495678_003723 | Ga0495678_003723_4987_6108 | 363 |
| 59 | iso_pu_bacteria | 2599185184 | 2599479466 | 365 |
| 60 | iso_pu_bacteria | 2852623160 | 2852625659 | 365 |
| 61 | iso_pu_bacteria | 2884933994 | 2884934658 | 365 |
| 62 | iso_pu_bacteria | 2919437846 | 2919439903 | 365 |
| 63 | iso_pu_bacteria | 2977232053 | 2977234545 | 365 |
| 64 | iso_pu_bacteria | 2928078545 | 2928082228 | 366 |
| 65 | iso_pu_bacteria | 2928147474 | 2928149196 | 366 |
| 66 | iso_pu_bacteria | 2932082852 | 2932084944 | 366 |
| 67 | 3300003320 | rootH2_10002709 | rootH2_100027093 | 368 |
| 68 | 3300003320 | rootH2_10089059 | rootH2_100890595 | 368 |
| 69 | 3300005327 | Ga0070658_10000008 | Ga0070658_1000000893 | 368 |
| 70 | 3300005355 | Ga0070671_100040160 | Ga0070671_1000401602 | 368 |
| 71 | 3300005455 | Ga0070663_100012729 | Ga0070663_1000127294 | 368 |
| 72 | 3300005457 | Ga0070662_100001291 | Ga0070662_10000129113 | 368 |
| 73 | 3300005530 | Ga0070679_100036706 | Ga0070679_1000367062 | 368 |
| 74 | 3300005535 | Ga0070684_100092576 | Ga0070684_1000925762 | 368 |
| 75 | 3300005563 | Ga0068855_100014897 | Ga0068855_1000148973 | 368 |
| 76 | 3300005614 | Ga0068856_100003383 | Ga0068856_1000033839 | 368 |
| 77 | 3300005614 | Ga0068856_100009146 | Ga0068856_1000091463 | 368 |
| 78 | 3300009093 | Ga0105240_10119427 | Ga0105240_101194272 | 368 |
| 79 | 3300009174 | Ga0105241_10005050 | Ga0105241_100050504 | 368 |
| 80 | 3300009174 | Ga0105241_10007345 | Ga0105241_100073453 | 368 |
| 81 | 3300009176 | Ga0105242_10115429 | Ga0105242_101154292 | 368 |
| 82 | 3300009545 | Ga0105237_10006927 | Ga0105237_100069273 | 368 |
| 83 | 3300009551 | Ga0105238_10041236 | Ga0105238_100412362 | 368 |
| 84 | 3300010375 | Ga0105239_10015371 | Ga0105239_100153717 | 368 |
| 85 | 3300013100 | Ga0157373_10000034 | Ga0157373_1000003472 | 368 |
| 86 | 3300013102 | Ga0157371_10038757 | Ga0157371_100387574 | 368 |
| 87 | 3300013105 | Ga0157369_10001235 | Ga0157369_1000123512 | 368 |
| 88 | 3300013105 | Ga0157369_10141939 | Ga0157369_101419393 | 368 |
| 89 | 3300013296 | Ga0157374_10009410 | Ga0157374_100094104 | 368 |
| 90 | 3300013297 | Ga0157378_10151015 | Ga0157378_101510152 | 368 |
| 91 | 3300013307 | Ga0157372_10000041 | Ga0157372_10000041130 | 368 |
| 92 | 3300013307 | Ga0157372_10047377 | Ga0157372_100473772 | 368 |
| 93 | 3300013307 | Ga0157372_10065631 | Ga0157372_100656312 | 368 |
| 94 | 3300013307 | Ga0157372_10225648 | Ga0157372_102256482 | 368 |
| 95 | 3300025904 | Ga0207647_10000231 | Ga0207647_1000023115 | 368 |
| 96 | 3300025909 | Ga0207705_10000026 | Ga0207705_1000002693 | 368 |
| 97 | 3300025911 | Ga0207654_10003074 | Ga0207654_100030747 | 368 |
| 98 | 3300025913 | Ga0207695_10012733 | Ga0207695_100127338 | 368 |
| 99 | 3300025914 | Ga0207671_10000815 | Ga0207671_1000081533 | 368 |
| 100 | 3300025919 | Ga0207657_10015841 | Ga0207657_100158415 | 368 |
| 101 | 3300025921 | Ga0207652_10019343 | Ga0207652_100193436 | 368 |
| 102 | 3300025931 | Ga0207644_10083634 | Ga0207644_100836342 | 368 |
| 103 | 3300025933 | Ga0207706_10000406 | Ga0207706_1000040619 | 368 |
| 104 | 3300025944 | Ga0207661_10163604 | Ga0207661_101636042 | 368 |
| 105 | 3300026023 | Ga0207677_10006592 | Ga0207677_100065925 | 368 |
| 106 | 3300026067 | Ga0207678_10017163 | Ga0207678_100171635 | 368 |
| 107 | 3300026078 | Ga0207702_10000194 | Ga0207702_1000019444 | 368 |
| 108 | 3300026078 | Ga0207702_10011155 | Ga0207702_100111558 | 368 |
| 109 | 3300028786 | Ga0307517_10001797 | Ga0307517_1000179712 | 368 |
| 110 | 3300031251 | Ga0265327_10085951 | Ga0265327_100859512 | 368 |
| 111 | 3300033180 | Ga0307510_10132732 | Ga0307510_101327323 | 368 |
| 112 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_269622_270734 | 368 |
| 113 | 3300037312 | Ga0395899_0000027 | Ga0395899_0000027_72500_73618 | 368 |
| 114 | 3300037418 | Ga0395900_0000140 | Ga0395900_0000140_85567_86676 | 368 |
| 115 | 3300037418 | Ga0395900_0120455 | Ga0395900_0120455_36_1145 | 368 |
| 116 | 3300037471 | Ga0395905_0001526 | Ga0395905_0001526_12053_13162 | 368 |
| 117 | 3300045049 | Ga0466959_0219795 | Ga0466959_0219795_31_1140 | 368 |
| 118 | 3300045836 | Ga0466958_0029865 | Ga0466958_0029865_893_2005 | 368 |
| 119 | 3300046500 | Ga0495596_0080760 | Ga0495596_0080760_104_1213 | 368 |
| 120 | 3300046616 | Ga0495668_0059509 | Ga0495668_0059509_200_1309 | 368 |
| 121 | 3300047323 | Ga0495683_0006585 | Ga0495683_0006585_1982_3091 | 368 |
| 122 | 3300047443 | Ga0495687_000888 | Ga0495687_000888_22952_24061 | 368 |
| 123 | 3300053122 | Ga0500608_001030 | Ga0500608_001030_281_1390 | 368 |
| 124 | 3300002737 | JGI25162J39368_1000301 | JGI25162J39368_100030131 | 369 |
| 125 | 3300002737 | JGI25162J39368_1002474 | JGI25162J39368_10024744 | 369 |
| 126 | 3300003214 | JGI25165J46597_1000456 | JGI25165J46597_10004563 | 369 |
| 127 | 3300003316 | rootH1_10021888 | rootH1_100218882 | 369 |
| 128 | 3300003322 | rootL2_10054152 | rootL2_100541522 | 369 |
| 129 | 3300003323 | rootH1_10123672 | rootH1_101236722 | 369 |
| 130 | 3300004799 | Ga0058863_10081386 | Ga0058863_100813863 | 369 |
| 131 | 3300004803 | Ga0058862_12459938 | Ga0058862_124599381 | 369 |
| 132 | 3300005288 | Ga0065714_10070953 | Ga0065714_100709533 | 369 |
| 133 | 3300005288 | Ga0065714_10082520 | Ga0065714_100825202 | 369 |
| 134 | 3300005458 | Ga0070681_10034790 | Ga0070681_100347903 | 369 |
| 135 | 3300005530 | Ga0070679_100010335 | Ga0070679_1000103358 | 369 |
| 136 | 3300005563 | Ga0068855_100000177 | Ga0068855_10000017777 | 369 |
| 137 | 3300005563 | Ga0068855_100009928 | Ga0068855_1000099282 | 369 |
| 138 | 3300005614 | Ga0068856_100084195 | Ga0068856_1000841953 | 369 |
| 139 | 3300006195 | Ga0075366_10000660 | Ga0075366_1000066015 | 369 |
| 140 | 3300009093 | Ga0105240_10002497 | Ga0105240_100024975 | 369 |
| 141 | 3300009093 | Ga0105240_10116264 | Ga0105240_101162642 | 369 |
| 142 | 3300009174 | Ga0105241_10028919 | Ga0105241_100289191 | 369 |
| 143 | 3300009545 | Ga0105237_10008634 | Ga0105237_100086349 | 369 |
| 144 | 3300010375 | Ga0105239_10020300 | Ga0105239_100203005 | 369 |
| 145 | 3300025230 | Ga0209563_104608 | Ga0209563_1046082 | 369 |
| 146 | 3300025231 | Ga0207427_100083 | Ga0207427_10008398 | 369 |
| 147 | 3300025233 | Ga0209437_100021 | Ga0209437_100021357 | 369 |
| 148 | 3300025233 | Ga0209437_100030 | Ga0209437_100030384 | 369 |
| 149 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035281 | 369 |
| 150 | 3300025261 | Ga0209233_1022411 | Ga0209233_10224112 | 369 |
| 151 | 3300025911 | Ga0207654_10012878 | Ga0207654_100128781 | 369 |
| 152 | 3300025911 | Ga0207654_10015040 | Ga0207654_100150401 | 369 |
| 153 | 3300025913 | Ga0207695_10000179 | Ga0207695_100001795 | 369 |
| 154 | 3300025913 | Ga0207695_10042583 | Ga0207695_100425832 | 369 |
| 155 | 3300025914 | Ga0207671_10000769 | Ga0207671_100007695 | 369 |
| 156 | 3300025914 | Ga0207671_10009106 | Ga0207671_1000910611 | 369 |
| 157 | 3300025924 | Ga0207694_10042194 | Ga0207694_100421942 | 369 |
| 158 | 3300025949 | Ga0207667_10000070 | Ga0207667_10000070155 | 369 |
| 159 | 3300025949 | Ga0207667_10002580 | Ga0207667_1000258018 | 369 |
| 160 | 3300025949 | Ga0207667_10168447 | Ga0207667_101684472 | 369 |
| 161 | 3300026078 | Ga0207702_10023393 | Ga0207702_100233934 | 369 |
| 162 | 3300028794 | Ga0307515_10120832 | Ga0307515_101208323 | 369 |
| 163 | 3300028794 | Ga0307515_10124073 | Ga0307515_101240731 | 369 |
| 164 | 3300033179 | Ga0307507_10000143 | Ga0307507_1000014327 | 369 |
| 165 | 3300046492 | Ga0495585_0002074 | Ga0495585_0002074_5024_6145 | 369 |
| 166 | 3300046507 | Ga0495606_0001103 | Ga0495606_0001103_20599_21720 | 369 |
| 167 | 3300046518 | Ga0495631_0071351 | Ga0495631_0071351_274_1392 | 369 |
| 168 | 3300046523 | Ga0495644_0065008 | Ga0495644_0065008_101_1219 | 369 |
| 169 | 3300046524 | Ga0495648_0009001 | Ga0495648_0009001_1656_2777 | 369 |
| 170 | 3300046530 | Ga0495654_0045609 | Ga0495654_0045609_865_1986 | 369 |
| 171 | 3300046538 | Ga0495609_0031421 | Ga0495609_0031421_838_1959 | 369 |
| 172 | 3300046558 | Ga0495633_0000083 | Ga0495633_0000083_49942_51063 | 369 |
| 173 | 3300046616 | Ga0495668_0000055 | Ga0495668_0000055_103308_104429 | 369 |
| 174 | 3300046660 | Ga0495625_0001180 | Ga0495625_0001180_30085_31206 | 369 |
| 175 | 3300046665 | Ga0495661_0001577 | Ga0495661_0001577_14120_15241 | 369 |
| 176 | 3300047472 | Ga0495686_0000917 | Ga0495686_0000917_20129_21256 | 369 |
| 177 | 3300047472 | Ga0495686_0000931 | Ga0495686_0000931_21960_23069 | 369 |
| 178 | 3300047472 | Ga0495686_0042956 | Ga0495686_0042956_367_1488 | 369 |
| 179 | 3300047472 | Ga0495686_0067013 | Ga0495686_0067013_963_2078 | 369 |
| 180 | 3300048089 | Ga0495614_0000945 | Ga0495614_0000945_1739_2860 | 369 |
| 181 | 3300049460 | Ga0495682_0021652 | Ga0495682_0021652_1173_2294 | 369 |
| 182 | 3300050493 | nmdc:mga0k408_710_c1 | nmdc:mga0k408_710_c1_3987_5108 | 369 |
| 183 | 3300053125 | Ga0500618_000006 | Ga0500618_000006_203495_204616 | 369 |
| 184 | 3300001989 | JGI24739J22299_10039162 | JGI24739J22299_100391622 | 370 |
| 185 | 3300001989 | JGI24739J22299_10051735 | JGI24739J22299_100517351 | 370 |
| 186 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003264 | 370 |
| 187 | 3300003316 | rootH1_10036994 | rootH1_100369943 | 370 |
| 188 | 3300006195 | Ga0075366_10010515 | Ga0075366_100105153 | 370 |
| 189 | 3300010375 | Ga0105239_10000865 | Ga0105239_1000086539 | 370 |
| 190 | 3300013102 | Ga0157371_10082843 | Ga0157371_100828432 | 370 |
| 191 | 3300013307 | Ga0157372_10112528 | Ga0157372_101125281 | 370 |
| 192 | 3300046492 | Ga0495585_0000250 | Ga0495585_0000250_54287_55411 | 370 |
| 193 | 3300046507 | Ga0495606_0034761 | Ga0495606_0034761_1677_2801 | 370 |
| 194 | 3300046520 | Ga0495637_0046785 | Ga0495637_0046785_674_1798 | 370 |
| 195 | 3300046810 | Ga0495660_0042854 | Ga0495660_0042854_906_2030 | 370 |
| 196 | 3300005530 | Ga0070679_100292819 | Ga0070679_1002928191 | 371 |
| 197 | 3300005842 | Ga0068858_100091320 | Ga0068858_1000913204 | 371 |
| 198 | 3300009093 | Ga0105240_10262791 | Ga0105240_102627912 | 371 |
| 199 | 3300009545 | Ga0105237_10293962 | Ga0105237_102939622 | 371 |
| 200 | 3300010375 | Ga0105239_10116120 | Ga0105239_101161202 | 371 |
| 201 | 3300013306 | Ga0163162_10028147 | Ga0163162_100281473 | 371 |
| 202 | 3300025914 | Ga0207671_10184345 | Ga0207671_101843452 | 371 |
| 203 | 3300005459 | Ga0068867_100000904 | Ga0068867_10000090411 | 372 |
| 204 | 3300006237 | Ga0097621_100000174 | Ga0097621_1000001742 | 372 |
| 205 | 3300006358 | Ga0068871_100000060 | Ga0068871_10000006013 | 372 |
| 206 | 3300013296 | Ga0157374_10000948 | Ga0157374_100009484 | 372 |
| 207 | 3300025907 | Ga0207645_10000347 | Ga0207645_1000034747 | 372 |
| 208 | 3300025924 | Ga0207694_10018515 | Ga0207694_100185154 | 372 |
| 209 | 3300025934 | Ga0207686_10017163 | Ga0207686_100171634 | 372 |
| 210 | 3300025938 | Ga0207704_10000307 | Ga0207704_100003078 | 372 |
| 211 | 3300026089 | Ga0207648_10000647 | Ga0207648_1000064722 | 372 |
| 212 | 3300026121 | Ga0207683_10002531 | Ga0207683_1000253117 | 372 |
| 213 | 3300037418 | Ga0395900_0000251 | Ga0395900_0000251_63046_64188 | 372 |
| 214 | 3300037471 | Ga0395905_0000248 | Ga0395905_0000248_69428_70570 | 372 |
| 215 | 3300038443 | Ga0395901_0000145 | Ga0395901_0000145_50506_51648 | 372 |
| 216 | 3300005614 | Ga0068856_100208732 | Ga0068856_1002087321 | 373 |
| 217 | 3300013100 | Ga0157373_10014428 | Ga0157373_100144287 | 373 |
| 218 | 3300013102 | Ga0157371_10000107 | Ga0157371_1000010780 | 373 |
| 219 | 3300013104 | Ga0157370_10023850 | Ga0157370_100238506 | 373 |
| 220 | 3300013105 | Ga0157369_10508876 | Ga0157369_105088761 | 373 |
| 221 | 3300013105 | Ga0157369_10508877 | Ga0157369_105088771 | 373 |
| 222 | 3300013307 | Ga0157372_10012894 | Ga0157372_100128942 | 373 |
| 223 | 3300053157 | Ga0500624_000631 | Ga0500624_000631_1797_2945 | 374 |
| 224 | 3300009551 | Ga0105238_10076789 | Ga0105238_100767893 | 376 |
| 225 | 3300010375 | Ga0105239_10004217 | Ga0105239_100042172 | 376 |
| 226 | 3300026078 | Ga0207702_10235153 | Ga0207702_102351531 | 376 |
| 227 | 3300047472 | Ga0495686_0094177 | Ga0495686_0094177_464_1627 | 376 |
| 228 | 3300013307 | Ga0157372_10482760 | Ga0157372_104827601 | 379 |
| 229 | 3300001904 | JGI24736J21556_1004104 | JGI24736J21556_10041042 | 380 |
| 230 | 3300005366 | Ga0070659_100016670 | Ga0070659_1000166702 | 380 |
| 231 | 3300005563 | Ga0068855_100271428 | Ga0068855_1002714282 | 380 |
| 232 | 3300025261 | Ga0209233_1001001 | Ga0209233_10010016 | 380 |
| 233 | 3300025904 | Ga0207647_10000529 | Ga0207647_1000052934 | 380 |
| 234 | 3300025932 | Ga0207690_10031179 | Ga0207690_100311792 | 380 |
| 235 | 3300025949 | Ga0207667_10245267 | Ga0207667_102452672 | 380 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3egj-assembly1.cif.gz_A | n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae. | 0.9374 | 8 | 379 |
| 2p53-assembly1.cif.gz_B | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate | 0.9348 | 10 | 380 |
| 2p50-assembly1.cif.gz_A | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.9343 | 10 | 380 |
| 2p50-assembly2.cif.gz_C | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.9325 | 10 | 380 |
| 2p50-assembly2.cif.gz_D | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.9313 | 10 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iv8D01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9305 | 9 | 62 | 2.30.40.10 |
| af_P0AF18_1_54_2.30.40.10 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9254 | 10 | 62 | 2.30.40.10 |
| 1yrrB01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9206 | 11 | 62 | 2.30.40.10 |
| af_Q2G2U0_63_361_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9156 | 62 | 347 | 3.20.20.140 |
| af_O53382_52_348_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9087 | 62 | 344 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258WRN5-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9813 | 8 | 378 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A482SHG6-F1-model_v4 | deleted | 0.9811 | 151 | 380 |
|
| AF-A0A258WRN5-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9786 | 8 | 378 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A358XRQ4-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9735 | 174 | 364 |
GO:0006046
GO:0008448 |
| AF-A0A2S1LN73-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9728 | 8 | 377 |
GO:0006046
GO:0008448 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar