F348233

General Info

Members Datasets Scaffolds Average Seq Length
235 142 228 371

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10235153|Ga0207702_102351531
Length 420
Sequence LVSFINARGDARWYVTVFGARFTMGNALCEAGDCHLNIHNDYYFSTMITALHNLRLITDGSIRPGKVILITDXXIIAISEESSIPENVTKIDLKGAYVAPGLLDLQIYGSGGKLFAGTPVVEALERMENDLLAQGTTGFFATIGTNTPAIFEQGIAAAKAYRKYAKGNFLGMHFEGPYLNPAKRGAHPANLIKKGTLDEVKRWVDSAEGEIKMMTIAPELQDQEVIAYLHANGVILSSGHSNASYDEGKAFLNKPIPAVTHLFNAMPQMHHREPGYIPAIFEERPYTSVVADGIHVDFAMIRLAKRELGDKLFLITDAVTAVTEGTYQHQFTGDRYVMPDGTLSGSCLSMLKAAQNCVEKVGIDLAEAINMASLYPAQLAKMPHKGRVAVGCDADLIVFNDAFEVLGTVFKGEQNMNFTN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0.85
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 0.43
Rhizosphere 86.38
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004104 3300001904 Bacteria 2502
2 JGI24739J22299_10039162 3300001989 Bacteria 1589
3 JGI24739J22299_10051735 3300001989 Bacteria 1324
4 JGI24735J21928_10000003 3300002067 Bacteria 385983
5 JGI25162J39368_1000301 3300002737 Bacteria 45433
6 JGI25162J39368_1002474 3300002737 Bacteria 7135
7 JGI25165J46597_1000456 3300003214 Bacteria 41124
8 rootH1_10021888 3300003316 Bacteria 3968
9 rootH1_10036994 3300003316 Bacteria 7881
10 rootH2_10002709 3300003320 Bacteria 20537
11 rootH2_10089059 3300003320 Bacteria 6955
12 rootL2_10054152 3300003322 Bacteria 3544
13 rootH1_10000975 3300003316 Bacteria 12698
14 rootH1_10000975 3300003323 Bacteria 22074
15 rootH1_10123672 3300003323 Bacteria 1465
16 Ga0058863_10081386 3300004799 Bacteria 5279
17 Ga0058862_12459938 3300004803 Bacteria 1831
18 Ga0065714_10070953 3300005288 Bacteria 3712
19 Ga0065714_10082520 3300005288 Bacteria 2288
20 Ga0070658_10000008 3300005327 Bacteria 319912
21 Ga0070666_10000128 3300005335 Bacteria 53252
22 Ga0068868_100082508 3300005338 Unclassified 2578
23 Ga0068868_100314124 3300005338 Bacteria 1334
24 Ga0070671_100040160 3300005355 Bacteria 3886
25 Ga0070671_100220374 3300005355 Bacteria 1609
26 Ga0070673_100120328 3300005364 Bacteria 2189
27 Ga0070659_100016670 3300005366 Bacteria 5518
28 Ga0070667_100018783 3300005367 Bacteria 5733
29 Ga0070663_100012729 3300005455 Bacteria 5333
30 Ga0070662_100001291 3300005457 Bacteria 15376
31 Ga0070681_10034790 3300005458 Bacteria 5059
32 Ga0068867_100000904 3300005459 Bacteria 20133
33 Ga0070679_100010335 3300005530 Bacteria 8849
34 Ga0070679_100036706 3300005530 Bacteria 4864
35 Ga0070679_100292819 3300005530 Bacteria 1579
36 Ga0070684_100092576 3300005535 Bacteria 2690
37 Ga0068855_100000177 3300005563 Bacteria 82003
38 Ga0068855_100009928 3300005563 Bacteria 11481
39 Ga0068855_100014897 3300005563 Bacteria 9366
40 Ga0068855_100271428 3300005563 Bacteria 1886
41 Ga0068856_100003383 3300005614 Bacteria 16151
42 Ga0068856_100009146 3300005614 Bacteria 9630
43 Ga0068856_100084195 3300005614 Bacteria 3159
44 Ga0068856_100208732 3300005614 Bacteria 1968
45 Ga0068859_100000018 3300005617 Bacteria 248813
46 Ga0068851_10078701 3300005834 Unclassified 1718
47 Ga0068863_100079483 3300005841 Bacteria 3106
48 Ga0068858_100091320 3300005842 Bacteria 2834
49 Ga0068858_100186858 3300005842 Bacteria 1957
50 Ga0068860_100003505 3300005843 Bacteria 16152
51 Ga0068860_100012749 3300005843 Bacteria 8264
52 Ga0075366_10000660 3300006195 Bacteria 16235
53 Ga0075366_10010515 3300006195 Bacteria 5196
54 Ga0097621_100000174 3300006237 Bacteria 40714
55 Ga0097621_100103601 3300006237 Bacteria 2397
56 Ga0068871_100000060 3300006358 Bacteria 59245
57 Ga0097620_100000018 3300006931 Bacteria 248813
58 Ga0105240_10002497 3300009093 Bacteria 29564
59 Ga0105240_10116264 3300009093 Bacteria 3227
60 Ga0105240_10119427 3300009093 Bacteria 3175
61 Ga0105240_10262791 3300009093 Bacteria 1990
62 Ga0105247_10024254 3300009101 Bacteria 3654
63 Ga0105243_10111282 3300009148 Bacteria 2292
64 Ga0105241_10000510 3300009174 Bacteria 29254
65 Ga0105241_10005050 3300009174 Bacteria 9738
66 Ga0105241_10007345 3300009174 Bacteria 8104
67 Ga0105241_10028919 3300009174 Bacteria 4130
68 Ga0105242_10115429 3300009176 Bacteria 2295
69 Ga0105237_10001030 3300009545 Bacteria 37560
70 Ga0105237_10006927 3300009545 Bacteria 12496
71 Ga0105237_10008634 3300009545 Bacteria 11015
72 Ga0105237_10293962 3300009545 Bacteria 1627
73 Ga0105237_10347209 3300009545 Bacteria 1488
74 Ga0105238_10041236 3300009551 Bacteria 4676
75 Ga0105238_10076789 3300009551 Bacteria 3332
76 Ga0105249_10005809 3300009553 Bacteria 10672
77 Ga0105239_10000865 3300010375 Bacteria 43041
78 Ga0105239_10002625 3300010375 Bacteria 22737
79 Ga0105239_10004217 3300010375 Bacteria 17268
80 Ga0105239_10015371 3300010375 Bacteria 8479
81 Ga0105239_10019481 3300010375 Bacteria 7490
82 Ga0105239_10020300 3300010375 Bacteria 7329
83 Ga0105239_10116120 3300010375 Bacteria 2970
84 Ga0105246_10014766 3300011119 Bacteria 4918
85 Ga0157373_10000034 3300013100 Bacteria 124053
86 Ga0157373_10014428 3300013100 Bacteria 5791
87 Ga0157371_10000107 3300013102 Bacteria 126477
88 Ga0157371_10038757 3300013102 Bacteria 3409
89 Ga0157371_10082843 3300013102 Bacteria 2271
90 Ga0157370_10023850 3300013104 Bacteria 6068
91 Ga0157369_10001235 3300013105 Bacteria 31847
92 Ga0157369_10141939 3300013105 Bacteria 2541
93 Ga0157369_10508876 3300013105 Bacteria 1246
94 Ga0157369_10508877 3300013105 Bacteria 1246
95 Ga0157374_10000948 3300013296 Bacteria 25182
96 Ga0157374_10009410 3300013296 Bacteria 8386
97 Ga0157378_10151015 3300013297 Bacteria 2164
98 Ga0157378_10499940 3300013297 Unclassified 1214
99 Ga0163162_10000599 3300013306 Bacteria 33336
100 Ga0163162_10028147 3300013306 Bacteria 5559
101 Ga0163162_10063712 3300013306 Bacteria 3730
102 Ga0157372_10000041 3300013307 Bacteria 158494
103 Ga0157372_10012894 3300013307 Bacteria 8911
104 Ga0157372_10047377 3300013307 Bacteria 4776
105 Ga0157372_10065631 3300013307 Bacteria 4076
106 Ga0157372_10112528 3300013307 Bacteria 3119
107 Ga0157372_10225648 3300013307 Bacteria 2172
108 Ga0157372_10482760 3300013307 Bacteria 1445
109 Ga0157375_10037010 3300013308 Bacteria 4672
110 Ga0163163_10193118 3300014325 Bacteria 2084
111 Ga0157379_10082932 3300014968 Bacteria 2873
112 Ga0157379_10106889 3300014968 Unclassified 2512
113 Ga0209563_104608 3300025230 Bacteria 2611
114 Ga0207427_100083 3300025231 Bacteria 142745
115 Ga0209437_100021 3300025233 Bacteria 646400
116 Ga0209437_100030 3300025233 Bacteria 532466
117 Ga0209233_1000035 3300025261 Bacteria 568478
118 Ga0209233_1001001 3300025261 Bacteria 12075
119 Ga0209233_1022411 3300025261 Bacteria 1617
120 Ga0207656_10041284 3300025321 Unclassified 1960
121 Ga0207680_10000212 3300025903 Bacteria 27928
122 Ga0207647_10000231 3300025904 Bacteria 46261
123 Ga0207647_10000529 3300025904 Bacteria 30445
124 Ga0207645_10000347 3300025907 Bacteria 38694
125 Ga0207705_10000026 3300025909 Bacteria 256051
126 Ga0207654_10003074 3300025911 Bacteria 8455
127 Ga0207654_10012878 3300025911 Bacteria 4291
128 Ga0207654_10013537 3300025911 Bacteria 4197
129 Ga0207654_10015040 3300025911 Bacteria 4008
130 Ga0207695_10000179 3300025913 Bacteria 185564
131 Ga0207695_10012733 3300025913 Bacteria 10071
132 Ga0207695_10042583 3300025913 Bacteria 4848
133 Ga0207671_10000769 3300025914 Bacteria 40631
134 Ga0207671_10000815 3300025914 Bacteria 39441
135 Ga0207671_10001806 3300025914 Bacteria 23915
136 Ga0207671_10009106 3300025914 Bacteria 8341
137 Ga0207671_10184345 3300025914 Bacteria 1625
138 Ga0207657_10015841 3300025919 Bacteria 7284
139 Ga0207652_10019343 3300025921 Bacteria 5600
140 Ga0207694_10018515 3300025924 Bacteria 5262
141 Ga0207694_10042194 3300025924 Bacteria 3518
142 Ga0207687_10166223 3300025927 Bacteria 1697
143 Ga0207644_10083634 3300025931 Bacteria 2364
144 Ga0207644_10184985 3300025931 Bacteria 1635
145 Ga0207690_10031179 3300025932 Bacteria 3409
146 Ga0207706_10000406 3300025933 Bacteria 46320
147 Ga0207686_10017163 3300025934 Bacteria 4075
148 Ga0207704_10000307 3300025938 Bacteria 22913
149 Ga0207691_10036786 3300025940 Bacteria 4535
150 Ga0207689_10000602 3300025942 Bacteria 34433
151 Ga0207661_10163604 3300025944 Bacteria 1932
152 Ga0207667_10000070 3300025949 Bacteria 180479
153 Ga0207667_10002580 3300025949 Bacteria 22502
154 Ga0207667_10168447 3300025949 Bacteria 2252
155 Ga0207667_10245267 3300025949 Bacteria 1833
156 Ga0207712_10035720 3300025961 Bacteria 3379
157 Ga0207658_10036238 3300025986 Unclassified 3536
158 Ga0207658_10041991 3300025986 Bacteria 3315
159 Ga0207677_10006592 3300026023 Bacteria 6370
160 Ga0207703_10032250 3300026035 Bacteria 4145
161 Ga0207678_10017163 3300026067 Bacteria 6354
162 Ga0207702_10000194 3300026078 Bacteria 71816
163 Ga0207702_10011155 3300026078 Bacteria 7497
164 Ga0207702_10023393 3300026078 Bacteria 5124
165 Ga0207702_10235153 3300026078 Bacteria 1714
166 Ga0207641_10000015 3300026088 Bacteria 321332
167 Ga0207648_10000647 3300026089 Bacteria 39104
168 Ga0207676_10072340 3300026095 Bacteria 2771
169 Ga0207683_10002531 3300026121 Bacteria 15963
170 Ga0207698_10017428 3300026142 Bacteria 4872
171 Ga0268264_10000844 3300028381 Bacteria 32786
172 Ga0268264_10002184 3300028381 Bacteria 17393
173 Ga0307517_10001797 3300028786 Bacteria 35313
174 Ga0307515_10120832 3300028794 Bacteria 2968
175 Ga0307515_10124073 3300028794 Bacteria 2900
176 Ga0265327_10085951 3300031251 Bacteria 1544
177 Ga0307507_10000143 3300033179 Bacteria 124248
178 Ga0307510_10132732 3300033180 Bacteria 2157
179 Ga0395899_0000024 3300037312 Bacteria 357402
180 Ga0395899_0000027 3300037312 Bacteria 337387
181 Ga0395900_0000140 3300037418 Bacteria 121917
182 Ga0395900_0000251 3300037418 Bacteria 83846
183 Ga0395900_0120455 3300037418 Bacteria 2692
184 Ga0395905_0000248 3300037471 Bacteria 81042
185 Ga0395905_0001526 3300037471 Bacteria 27691
186 Ga0395901_0000145 3300038443 Bacteria 91739
187 Ga0466959_0219795 3300045049 Bacteria 1318
188 Ga0466958_0029865 3300045836 Bacteria 3235
189 Ga0495650_0000023 3300046471 Bacteria 527763
190 Ga0495585_0000250 3300046492 Bacteria 55780
191 Ga0495585_0002074 3300046492 Bacteria 14718
192 Ga0495596_0080760 3300046500 Bacteria 1262
193 Ga0495583_0015143 3300046506 Bacteria 4209
194 Ga0495606_0001103 3300046507 Bacteria 38654
195 Ga0495606_0034761 3300046507 Bacteria 3456
196 Ga0495616_0000353 3300046513 Bacteria 35893
197 Ga0495616_0010044 3300046513 Bacteria 5495
198 Ga0495631_0071351 3300046518 Bacteria 1501
199 Ga0495637_0046785 3300046520 Bacteria 1829
200 Ga0495644_0065008 3300046523 Unclassified 1371
201 Ga0495648_0009001 3300046524 Bacteria 7795
202 Ga0495654_0045609 3300046530 Bacteria 2162
203 Ga0495609_0031421 3300046538 Bacteria 2414
204 Ga0495633_0000083 3300046558 Bacteria 125035
205 Ga0495668_0000055 3300046616 Bacteria 199412
206 Ga0495668_0059509 3300046616 Bacteria 2108
207 Ga0495625_0000018 3300046660 Bacteria 299567
208 Ga0495625_0001180 3300046660 Bacteria 33548
209 Ga0495661_0001577 3300046665 Bacteria 18785
210 Ga0495661_0004587 3300046665 Bacteria 9943
211 Ga0495661_0069519 3300046665 Bacteria 2063
212 Ga0495671_0045107 3300046692 Bacteria 2208
213 Ga0495649_0000015 3300046694 Bacteria 246431
214 Ga0495660_0042854 3300046810 Bacteria 2499
215 Ga0495683_0006585 3300047323 Bacteria 6338
216 Ga0495687_000888 3300047443 Bacteria 31504
217 Ga0495686_0000917 3300047472 Bacteria 36995
218 Ga0495686_0000931 3300047472 Bacteria 36438
219 Ga0495686_0042956 3300047472 Bacteria 2870
220 Ga0495686_0067013 3300047472 Bacteria 2217
221 Ga0495686_0094177 3300047472 Bacteria 1815
222 Ga0495614_0000945 3300048089 Bacteria 12334
223 Ga0495678_003723 3300049459 Bacteria 9221
224 Ga0495682_0021652 3300049460 Bacteria 2407
225 nmdc:mga0k408_710_c1 3300050493 Bacteria 18223
226 Ga0500608_001030 3300053122 Bacteria 9990
227 Ga0500618_000006 3300053125 Bacteria 239188
228 Ga0500624_000631 3300053157 Bacteria 9385

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0015143 Ga0495583_0015143_921_2045 355
2 3300046665 Ga0495661_0004587 Ga0495661_0004587_8563_9687 355
3 3300046665 Ga0495661_0069519 Ga0495661_0069519_870_1994 355
4 3300003323 rootH1_10000975 rootH1_100009753 356
5 3300046471 Ga0495650_0000023 Ga0495650_0000023_302938_304062 359
6 3300009545 Ga0105237_10347209 Ga0105237_103472092 360
7 3300005338 Ga0068868_100082508 Ga0068868_1000825082 361
8 3300005364 Ga0070673_100120328 Ga0070673_1001203282 361
9 3300005367 Ga0070667_100018783 Ga0070667_1000187833 361
10 3300005834 Ga0068851_10078701 Ga0068851_100787012 361
11 3300005841 Ga0068863_100079483 Ga0068863_1000794832 361
12 3300005843 Ga0068860_100003505 Ga0068860_1000035053 361
13 3300013297 Ga0157378_10499940 Ga0157378_104999401 361
14 3300014325 Ga0163163_10193118 Ga0163163_101931182 361
15 3300014968 Ga0157379_10106889 Ga0157379_101068893 361
16 3300025321 Ga0207656_10041284 Ga0207656_100412842 361
17 3300025986 Ga0207658_10036238 Ga0207658_100362383 361
18 3300028381 Ga0268264_10002184 Ga0268264_100021844 361
19 3300010375 Ga0105239_10002625 Ga0105239_1000262511 362
20 3300046513 Ga0495616_0000353 Ga0495616_0000353_33343_34467 362
21 3300046660 Ga0495625_0000018 Ga0495625_0000018_236096_237220 362
22 3300046694 Ga0495649_0000015 Ga0495649_0000015_164790_165914 362
23 3300005335 Ga0070666_10000128 Ga0070666_1000012829 363
24 3300005338 Ga0068868_100314124 Ga0068868_1003141241 363
25 3300005355 Ga0070671_100220374 Ga0070671_1002203741 363
26 3300005617 Ga0068859_100000018 Ga0068859_10000001888 363
27 3300005842 Ga0068858_100186858 Ga0068858_1001868582 363
28 3300005843 Ga0068860_100012749 Ga0068860_1000127497 363
29 3300006237 Ga0097621_100103601 Ga0097621_1001036013 363
30 3300006931 Ga0097620_100000018 Ga0097620_10000001888 363
31 3300009101 Ga0105247_10024254 Ga0105247_100242542 363
32 3300009148 Ga0105243_10111282 Ga0105243_101112821 363
33 3300009174 Ga0105241_10000510 Ga0105241_1000051020 363
34 3300009545 Ga0105237_10001030 Ga0105237_1000103018 363
35 3300009553 Ga0105249_10005809 Ga0105249_100058092 363
36 3300010375 Ga0105239_10019481 Ga0105239_100194817 363
37 3300011119 Ga0105246_10014766 Ga0105246_100147663 363
38 3300013306 Ga0163162_10000599 Ga0163162_1000059919 363
39 3300013306 Ga0163162_10063712 Ga0163162_100637122 363
40 3300013308 Ga0157375_10037010 Ga0157375_100370103 363
41 3300014968 Ga0157379_10082932 Ga0157379_100829322 363
42 3300025903 Ga0207680_10000212 Ga0207680_100002127 363
43 3300025911 Ga0207654_10013537 Ga0207654_100135372 363
44 3300025914 Ga0207671_10001806 Ga0207671_1000180614 363
45 3300025927 Ga0207687_10166223 Ga0207687_101662232 363
46 3300025931 Ga0207644_10184985 Ga0207644_101849852 363
47 3300025940 Ga0207691_10036786 Ga0207691_100367865 363
48 3300025942 Ga0207689_10000602 Ga0207689_1000060220 363
49 3300025961 Ga0207712_10035720 Ga0207712_100357202 363
50 3300025986 Ga0207658_10041991 Ga0207658_100419913 363
51 3300026035 Ga0207703_10032250 Ga0207703_100322503 363
52 3300026088 Ga0207641_10000015 Ga0207641_1000001518 363
53 3300026095 Ga0207676_10072340 Ga0207676_100723402 363
54 3300026142 Ga0207698_10017428 Ga0207698_100174284 363
55 3300028381 Ga0268264_10000844 Ga0268264_1000084412 363
56 3300046513 Ga0495616_0010044 Ga0495616_0010044_353_1474 363
57 3300046692 Ga0495671_0045107 Ga0495671_0045107_139_1260 363
58 3300049459 Ga0495678_003723 Ga0495678_003723_4987_6108 363
59 iso_pu_bacteria 2599185184 2599479466 365
60 iso_pu_bacteria 2852623160 2852625659 365
61 iso_pu_bacteria 2884933994 2884934658 365
62 iso_pu_bacteria 2919437846 2919439903 365
63 iso_pu_bacteria 2977232053 2977234545 365
64 iso_pu_bacteria 2928078545 2928082228 366
65 iso_pu_bacteria 2928147474 2928149196 366
66 iso_pu_bacteria 2932082852 2932084944 366
67 3300003320 rootH2_10002709 rootH2_100027093 368
68 3300003320 rootH2_10089059 rootH2_100890595 368
69 3300005327 Ga0070658_10000008 Ga0070658_1000000893 368
70 3300005355 Ga0070671_100040160 Ga0070671_1000401602 368
71 3300005455 Ga0070663_100012729 Ga0070663_1000127294 368
72 3300005457 Ga0070662_100001291 Ga0070662_10000129113 368
73 3300005530 Ga0070679_100036706 Ga0070679_1000367062 368
74 3300005535 Ga0070684_100092576 Ga0070684_1000925762 368
75 3300005563 Ga0068855_100014897 Ga0068855_1000148973 368
76 3300005614 Ga0068856_100003383 Ga0068856_1000033839 368
77 3300005614 Ga0068856_100009146 Ga0068856_1000091463 368
78 3300009093 Ga0105240_10119427 Ga0105240_101194272 368
79 3300009174 Ga0105241_10005050 Ga0105241_100050504 368
80 3300009174 Ga0105241_10007345 Ga0105241_100073453 368
81 3300009176 Ga0105242_10115429 Ga0105242_101154292 368
82 3300009545 Ga0105237_10006927 Ga0105237_100069273 368
83 3300009551 Ga0105238_10041236 Ga0105238_100412362 368
84 3300010375 Ga0105239_10015371 Ga0105239_100153717 368
85 3300013100 Ga0157373_10000034 Ga0157373_1000003472 368
86 3300013102 Ga0157371_10038757 Ga0157371_100387574 368
87 3300013105 Ga0157369_10001235 Ga0157369_1000123512 368
88 3300013105 Ga0157369_10141939 Ga0157369_101419393 368
89 3300013296 Ga0157374_10009410 Ga0157374_100094104 368
90 3300013297 Ga0157378_10151015 Ga0157378_101510152 368
91 3300013307 Ga0157372_10000041 Ga0157372_10000041130 368
92 3300013307 Ga0157372_10047377 Ga0157372_100473772 368
93 3300013307 Ga0157372_10065631 Ga0157372_100656312 368
94 3300013307 Ga0157372_10225648 Ga0157372_102256482 368
95 3300025904 Ga0207647_10000231 Ga0207647_1000023115 368
96 3300025909 Ga0207705_10000026 Ga0207705_1000002693 368
97 3300025911 Ga0207654_10003074 Ga0207654_100030747 368
98 3300025913 Ga0207695_10012733 Ga0207695_100127338 368
99 3300025914 Ga0207671_10000815 Ga0207671_1000081533 368
100 3300025919 Ga0207657_10015841 Ga0207657_100158415 368
101 3300025921 Ga0207652_10019343 Ga0207652_100193436 368
102 3300025931 Ga0207644_10083634 Ga0207644_100836342 368
103 3300025933 Ga0207706_10000406 Ga0207706_1000040619 368
104 3300025944 Ga0207661_10163604 Ga0207661_101636042 368
105 3300026023 Ga0207677_10006592 Ga0207677_100065925 368
106 3300026067 Ga0207678_10017163 Ga0207678_100171635 368
107 3300026078 Ga0207702_10000194 Ga0207702_1000019444 368
108 3300026078 Ga0207702_10011155 Ga0207702_100111558 368
109 3300028786 Ga0307517_10001797 Ga0307517_1000179712 368
110 3300031251 Ga0265327_10085951 Ga0265327_100859512 368
111 3300033180 Ga0307510_10132732 Ga0307510_101327323 368
112 3300037312 Ga0395899_0000024 Ga0395899_0000024_269622_270734 368
113 3300037312 Ga0395899_0000027 Ga0395899_0000027_72500_73618 368
114 3300037418 Ga0395900_0000140 Ga0395900_0000140_85567_86676 368
115 3300037418 Ga0395900_0120455 Ga0395900_0120455_36_1145 368
116 3300037471 Ga0395905_0001526 Ga0395905_0001526_12053_13162 368
117 3300045049 Ga0466959_0219795 Ga0466959_0219795_31_1140 368
118 3300045836 Ga0466958_0029865 Ga0466958_0029865_893_2005 368
119 3300046500 Ga0495596_0080760 Ga0495596_0080760_104_1213 368
120 3300046616 Ga0495668_0059509 Ga0495668_0059509_200_1309 368
121 3300047323 Ga0495683_0006585 Ga0495683_0006585_1982_3091 368
122 3300047443 Ga0495687_000888 Ga0495687_000888_22952_24061 368
123 3300053122 Ga0500608_001030 Ga0500608_001030_281_1390 368
124 3300002737 JGI25162J39368_1000301 JGI25162J39368_100030131 369
125 3300002737 JGI25162J39368_1002474 JGI25162J39368_10024744 369
126 3300003214 JGI25165J46597_1000456 JGI25165J46597_10004563 369
127 3300003316 rootH1_10021888 rootH1_100218882 369
128 3300003322 rootL2_10054152 rootL2_100541522 369
129 3300003323 rootH1_10123672 rootH1_101236722 369
130 3300004799 Ga0058863_10081386 Ga0058863_100813863 369
131 3300004803 Ga0058862_12459938 Ga0058862_124599381 369
132 3300005288 Ga0065714_10070953 Ga0065714_100709533 369
133 3300005288 Ga0065714_10082520 Ga0065714_100825202 369
134 3300005458 Ga0070681_10034790 Ga0070681_100347903 369
135 3300005530 Ga0070679_100010335 Ga0070679_1000103358 369
136 3300005563 Ga0068855_100000177 Ga0068855_10000017777 369
137 3300005563 Ga0068855_100009928 Ga0068855_1000099282 369
138 3300005614 Ga0068856_100084195 Ga0068856_1000841953 369
139 3300006195 Ga0075366_10000660 Ga0075366_1000066015 369
140 3300009093 Ga0105240_10002497 Ga0105240_100024975 369
141 3300009093 Ga0105240_10116264 Ga0105240_101162642 369
142 3300009174 Ga0105241_10028919 Ga0105241_100289191 369
143 3300009545 Ga0105237_10008634 Ga0105237_100086349 369
144 3300010375 Ga0105239_10020300 Ga0105239_100203005 369
145 3300025230 Ga0209563_104608 Ga0209563_1046082 369
146 3300025231 Ga0207427_100083 Ga0207427_10008398 369
147 3300025233 Ga0209437_100021 Ga0209437_100021357 369
148 3300025233 Ga0209437_100030 Ga0209437_100030384 369
149 3300025261 Ga0209233_1000035 Ga0209233_1000035281 369
150 3300025261 Ga0209233_1022411 Ga0209233_10224112 369
151 3300025911 Ga0207654_10012878 Ga0207654_100128781 369
152 3300025911 Ga0207654_10015040 Ga0207654_100150401 369
153 3300025913 Ga0207695_10000179 Ga0207695_100001795 369
154 3300025913 Ga0207695_10042583 Ga0207695_100425832 369
155 3300025914 Ga0207671_10000769 Ga0207671_100007695 369
156 3300025914 Ga0207671_10009106 Ga0207671_1000910611 369
157 3300025924 Ga0207694_10042194 Ga0207694_100421942 369
158 3300025949 Ga0207667_10000070 Ga0207667_10000070155 369
159 3300025949 Ga0207667_10002580 Ga0207667_1000258018 369
160 3300025949 Ga0207667_10168447 Ga0207667_101684472 369
161 3300026078 Ga0207702_10023393 Ga0207702_100233934 369
162 3300028794 Ga0307515_10120832 Ga0307515_101208323 369
163 3300028794 Ga0307515_10124073 Ga0307515_101240731 369
164 3300033179 Ga0307507_10000143 Ga0307507_1000014327 369
165 3300046492 Ga0495585_0002074 Ga0495585_0002074_5024_6145 369
166 3300046507 Ga0495606_0001103 Ga0495606_0001103_20599_21720 369
167 3300046518 Ga0495631_0071351 Ga0495631_0071351_274_1392 369
168 3300046523 Ga0495644_0065008 Ga0495644_0065008_101_1219 369
169 3300046524 Ga0495648_0009001 Ga0495648_0009001_1656_2777 369
170 3300046530 Ga0495654_0045609 Ga0495654_0045609_865_1986 369
171 3300046538 Ga0495609_0031421 Ga0495609_0031421_838_1959 369
172 3300046558 Ga0495633_0000083 Ga0495633_0000083_49942_51063 369
173 3300046616 Ga0495668_0000055 Ga0495668_0000055_103308_104429 369
174 3300046660 Ga0495625_0001180 Ga0495625_0001180_30085_31206 369
175 3300046665 Ga0495661_0001577 Ga0495661_0001577_14120_15241 369
176 3300047472 Ga0495686_0000917 Ga0495686_0000917_20129_21256 369
177 3300047472 Ga0495686_0000931 Ga0495686_0000931_21960_23069 369
178 3300047472 Ga0495686_0042956 Ga0495686_0042956_367_1488 369
179 3300047472 Ga0495686_0067013 Ga0495686_0067013_963_2078 369
180 3300048089 Ga0495614_0000945 Ga0495614_0000945_1739_2860 369
181 3300049460 Ga0495682_0021652 Ga0495682_0021652_1173_2294 369
182 3300050493 nmdc:mga0k408_710_c1 nmdc:mga0k408_710_c1_3987_5108 369
183 3300053125 Ga0500618_000006 Ga0500618_000006_203495_204616 369
184 3300001989 JGI24739J22299_10039162 JGI24739J22299_100391622 370
185 3300001989 JGI24739J22299_10051735 JGI24739J22299_100517351 370
186 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003264 370
187 3300003316 rootH1_10036994 rootH1_100369943 370
188 3300006195 Ga0075366_10010515 Ga0075366_100105153 370
189 3300010375 Ga0105239_10000865 Ga0105239_1000086539 370
190 3300013102 Ga0157371_10082843 Ga0157371_100828432 370
191 3300013307 Ga0157372_10112528 Ga0157372_101125281 370
192 3300046492 Ga0495585_0000250 Ga0495585_0000250_54287_55411 370
193 3300046507 Ga0495606_0034761 Ga0495606_0034761_1677_2801 370
194 3300046520 Ga0495637_0046785 Ga0495637_0046785_674_1798 370
195 3300046810 Ga0495660_0042854 Ga0495660_0042854_906_2030 370
196 3300005530 Ga0070679_100292819 Ga0070679_1002928191 371
197 3300005842 Ga0068858_100091320 Ga0068858_1000913204 371
198 3300009093 Ga0105240_10262791 Ga0105240_102627912 371
199 3300009545 Ga0105237_10293962 Ga0105237_102939622 371
200 3300010375 Ga0105239_10116120 Ga0105239_101161202 371
201 3300013306 Ga0163162_10028147 Ga0163162_100281473 371
202 3300025914 Ga0207671_10184345 Ga0207671_101843452 371
203 3300005459 Ga0068867_100000904 Ga0068867_10000090411 372
204 3300006237 Ga0097621_100000174 Ga0097621_1000001742 372
205 3300006358 Ga0068871_100000060 Ga0068871_10000006013 372
206 3300013296 Ga0157374_10000948 Ga0157374_100009484 372
207 3300025907 Ga0207645_10000347 Ga0207645_1000034747 372
208 3300025924 Ga0207694_10018515 Ga0207694_100185154 372
209 3300025934 Ga0207686_10017163 Ga0207686_100171634 372
210 3300025938 Ga0207704_10000307 Ga0207704_100003078 372
211 3300026089 Ga0207648_10000647 Ga0207648_1000064722 372
212 3300026121 Ga0207683_10002531 Ga0207683_1000253117 372
213 3300037418 Ga0395900_0000251 Ga0395900_0000251_63046_64188 372
214 3300037471 Ga0395905_0000248 Ga0395905_0000248_69428_70570 372
215 3300038443 Ga0395901_0000145 Ga0395901_0000145_50506_51648 372
216 3300005614 Ga0068856_100208732 Ga0068856_1002087321 373
217 3300013100 Ga0157373_10014428 Ga0157373_100144287 373
218 3300013102 Ga0157371_10000107 Ga0157371_1000010780 373
219 3300013104 Ga0157370_10023850 Ga0157370_100238506 373
220 3300013105 Ga0157369_10508876 Ga0157369_105088761 373
221 3300013105 Ga0157369_10508877 Ga0157369_105088771 373
222 3300013307 Ga0157372_10012894 Ga0157372_100128942 373
223 3300053157 Ga0500624_000631 Ga0500624_000631_1797_2945 374
224 3300009551 Ga0105238_10076789 Ga0105238_100767893 376
225 3300010375 Ga0105239_10004217 Ga0105239_100042172 376
226 3300026078 Ga0207702_10235153 Ga0207702_102351531 376
227 3300047472 Ga0495686_0094177 Ga0495686_0094177_464_1627 376
228 3300013307 Ga0157372_10482760 Ga0157372_104827601 379
229 3300001904 JGI24736J21556_1004104 JGI24736J21556_10041042 380
230 3300005366 Ga0070659_100016670 Ga0070659_1000166702 380
231 3300005563 Ga0068855_100271428 Ga0068855_1002714282 380
232 3300025261 Ga0209233_1001001 Ga0209233_10010016 380
233 3300025904 Ga0207647_10000529 Ga0207647_1000052934 380
234 3300025932 Ga0207690_10031179 Ga0207690_100311792 380
235 3300025949 Ga0207667_10245267 Ga0207667_102452672 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

97

414

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egj-assembly1.cif.gz_A n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae. 0.9374 8 379
2p53-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate 0.9348 10 380
2p50-assembly1.cif.gz_A crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9343 10 380
2p50-assembly2.cif.gz_C crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9325 10 380
2p50-assembly2.cif.gz_D crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9313 10 380
ID Description Score Start End Superfamily
3iv8D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9305 9 62 2.30.40.10
af_P0AF18_1_54_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9254 10 62 2.30.40.10
1yrrB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9206 11 62 2.30.40.10
af_Q2G2U0_63_361_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9156 62 347 3.20.20.140
af_O53382_52_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9087 62 344 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A258WRN5-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9813 8 378 GO:0006046
GO:0008448
GO:0046872
AF-A0A482SHG6-F1-model_v4 deleted 0.9811 151 380
AF-A0A258WRN5-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9786 8 378 GO:0006046
GO:0008448
GO:0046872
AF-A0A358XRQ4-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9735 174 364 GO:0006046
GO:0008448
AF-A0A2S1LN73-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9728 8 377 GO:0006046
GO:0008448
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.04 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map