F348167

General Info

Members Datasets Scaffolds Average Seq Length
235 170 470 664

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10000385|Ga0163161_1000038523
Length 709
Sequence MRYILFQFTILILIYCGTQLGTGMDLAFARKGRNARHCSSSMLIRGILLLALVFLTQIAIAQVRDSSKVHTLKEVKVRANKTSARNTSSTPAQIIGGEALQRLNSFSVADALRYFSGVQLKDYGGIGGLKTINVRSMGSNHTTVFYDGVQMGNAQNGQVDLGRFSLDNMEEVALYNGQKSTILQPAKSFSSSSTIYLRTRRPVFENGKSFNFKTGFKTGSFGLANPSFAYEQKITAKSAASISGEWVNANGRYKFYDRGNGYNDSTFVRTNADLDAYRLEAGLNGMLADSSIWAVKGYGYYSERGLPGAIVANRYDFTQRQWDRNLFIQGNFQTPEQNRYVLLFNAKYAKDYLRYLDPDFVKDDGFLDNRYHQDEVYLSVANRFRILPVWEVALSADYQWNKLNANLYRFPFPTRHTLLTALASELKLKSFSLQASLLGTFVSDMVREYSSAGNKQELSPTVIATFSPGWSEGLMFRAFYKNIFRLPTFNDLYYTFIGNTLLRPEFTDQYDIGATYTLQPEHTLLTSLSFQVDAYYNTVKDKIVAVPSSNLYRWTMYNIGRVRVQGLEANVQSAWTISDKLSLNASLSYTFQQSRDVTEGDIYPYNIPYIPLHSGSFIMAADWKRLELNYSYIYVGERYNQISTVQSAVYNRMDPWYTHDLGIGYTFPLFGKTAKITTEINNILNHNRDIIANFPLPPRFYRFKLNYTI

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
103 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
129 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
138 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
139 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
140 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
141 2738541283 Pedobacter sp. OK701 Isolate Unclassified
142 2738541284 Pedobacter sp. YR016 Isolate Unclassified
143 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
144 2738541302 Pedobacter sp. CF074 Isolate Unclassified
145 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
146 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
147 2738543023 Pedobacter sp. OK628 Isolate Unclassified
148 2739367651 Pedobacter sp. OK291 Isolate Unclassified
149 2739367656 Pedobacter sp. CF523 Isolate Unclassified
150 2739367663 Pedobacter sp. YR510 Isolate Unclassified
151 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
152 2818991437 Pedobacter terrae 518 Isolate Unclassified
153 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
154 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
155 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
156 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
157 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
158 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
159 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
160 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
161 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
162 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
163 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
164 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
165 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
166 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
167 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
168 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
169 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
170 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.96
Metatranscriptomes 0
Isolates 14.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.87
Nodule 0.85
Rhizoplane 0
Rhizosphere 64.26
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10000385 3300017792 Bacteria 37034
2 SwRhRL2b_contig_2796787 2162886007 Bacteria 12461
3 JGI24740J21852_10002255 3300001979 Bacteria 8794
4 JGI25162J39368_1000011 3300002737 Bacteria 379156
5 JGI25154J39366_1000019 3300002738 Bacteria 234419
6 JGI25152J39213_1000075 3300002773 Bacteria 66427
7 JGI25150J39212_1000009 3300002774 Bacteria 249509
8 JGI25151J46595_10000017 3300003187 Bacteria 249509
9 JGI25165J46597_1000436 3300003214 Bacteria 42359
10 JGI25153J46596_10000023 3300003215 Bacteria 249509
11 rootH2_10010259 3300003320 Bacteria 13946
12 rootH1_10006920 3300003323 Bacteria 63684
13 JGI25160J50197_1001826 3300003354 Bacteria 10259
14 Ga0055526_1006111 3300003771 Bacteria 6642
15 Ga0055536_1000011 3300003781 Bacteria 275969
16 Ga0055528_1000541 3300003790 Bacteria 28864
17 Ga0055528_1001608 3300003790 Bacteria 13354
18 Ga0055530_10007686 3300003791 Bacteria 4486
19 Ga0065165_1000172 3300005262 Bacteria 114850
20 Ga0065714_10003134 3300005288 Bacteria 28480
21 Ga0065714_10005445 3300005288 Bacteria 5666
22 Ga0065714_10009639 3300005288 Bacteria 3721
23 Ga0065714_10064511 3300005288 Bacteria 45172
24 Ga0065714_10072305 3300005288 Bacteria 3387
25 Ga0065704_10070224 3300005289 Bacteria 60921
26 Ga0065704_10071008 3300005289 Bacteria 13796
27 Ga0070658_10000832 3300005327 Bacteria 26408
28 Ga0070676_10004732 3300005328 Bacteria 7198
29 Ga0068869_100050412 3300005334 Bacteria 3017
30 Ga0070666_10004870 3300005335 Bacteria 8206
31 Ga0068868_100005360 3300005338 Bacteria 9006
32 Ga0070668_100000016 3300005347 Bacteria 104092
33 Ga0070675_100057565 3300005354 Bacteria 3205
34 Ga0070667_100000031 3300005367 Bacteria 177447
35 Ga0068867_100002758 3300005459 Bacteria 12381
36 Ga0068867_100020692 3300005459 Bacteria 4689
37 Ga0070684_100036352 3300005535 Bacteria 4220
38 Ga0068853_100014712 3300005539 Bacteria 6419
39 Ga0070672_100000002 3300005543 Bacteria 159809
40 Ga0070665_100000003 3300005548 Bacteria 811857
41 Ga0068855_100009351 3300005563 Bacteria 11833
42 Ga0070664_100020180 3300005564 Bacteria 5487
43 Ga0068854_100018855 3300005578 Bacteria 4639
44 Ga0068864_100001971 3300005618 Bacteria 16893
45 Ga0068861_100006920 3300005719 Bacteria 7743
46 Ga0068851_10004593 3300005834 Bacteria 6227
47 Ga0068863_100003289 3300005841 Bacteria 15952
48 Ga0068858_100000083 3300005842 Bacteria 98991
49 Ga0097621_100006117 3300006237 Bacteria 8522
50 Ga0068871_100000201 3300006358 Bacteria 41079
51 Ga0079104_1000005 3300006946 Bacteria 407099
52 Ga0105244_10000004 3300009036 Bacteria 492478
53 Ga0105240_10010292 3300009093 Bacteria 13166
54 Ga0105240_10050893 3300009093 Bacteria 5218
55 Ga0105242_10036626 3300009176 Bacteria 3937
56 Ga0105237_10006080 3300009545 Bacteria 13504
57 Ga0105237_10012535 3300009545 Bacteria 8930
58 Ga0105249_10001445 3300009553 Bacteria 20795
59 Ga0105239_10000256 3300010375 Bacteria 79404
60 Ga0105239_10014959 3300010375 Bacteria 8601
61 Ga0105246_10076168 3300011119 Bacteria 2377
62 Ga0157373_10000612 3300013100 Bacteria 27899
63 Ga0157373_10008161 3300013100 Bacteria 7784
64 Ga0157371_10000009 3300013102 Bacteria 392895
65 Ga0157371_10000258 3300013102 Bacteria 73082
66 Ga0157371_10001139 3300013102 Bacteria 28616
67 Ga0157371_10003137 3300013102 Bacteria 15241
68 Ga0157371_10013272 3300013102 Bacteria 6267
69 Ga0157370_10000132 3300013104 Bacteria 89678
70 Ga0157370_10005477 3300013104 Bacteria 14238
71 Ga0157370_10019321 3300013104 Bacteria 6839
72 Ga0157370_10022721 3300013104 Bacteria 6242
73 Ga0157370_10045839 3300013104 Bacteria 4194
74 Ga0157370_10066493 3300013104 Bacteria 3409
75 Ga0157369_10000006 3300013105 Bacteria 412230
76 Ga0157369_10000219 3300013105 Bacteria 79491
77 Ga0157369_10035142 3300013105 Bacteria 5497
78 Ga0157374_10007969 3300013296 Bacteria 9049
79 Ga0157378_10025983 3300013297 Bacteria 5160
80 Ga0157378_10029455 3300013297 Bacteria 4846
81 Ga0163162_10000029 3300013306 Bacteria 168510
82 Ga0163162_10000066 3300013306 Bacteria 100009
83 Ga0163162_10000126 3300013306 Bacteria 68238
84 Ga0163162_10001232 3300013306 Bacteria 23940
85 Ga0163162_10002908 3300013306 Bacteria 16312
86 Ga0163162_10054078 3300013306 Bacteria 4037
87 Ga0157375_10000042 3300013308 Bacteria 160008
88 Ga0157375_10000227 3300013308 Bacteria 52292
89 Ga0157375_10037000 3300013308 Bacteria 4673
90 Ga0163163_10000076 3300014325 Bacteria 108784
91 Ga0182008_10000010 3300014497 Bacteria 301527
92 Ga0182008_10000614 3300014497 Bacteria 26183
93 Ga0182008_10020934 3300014497 Bacteria 3364
94 Ga0157379_10000016 3300014968 Bacteria 103230
95 Ga0157379_10042639 3300014968 Bacteria 4051
96 Ga0157376_10000558 3300014969 Bacteria 23999
97 Ga0157376_10011324 3300014969 Bacteria 6570
98 Ga0157376_10014838 3300014969 Bacteria 5864
99 Ga0182006_1000689 3300015261 Bacteria 23570
100 Ga0182006_1001744 3300015261 Bacteria 12610
101 Ga0182007_10000001 3300015262 Bacteria 1127301
102 Ga0182007_10006378 3300015262 Bacteria 5065
103 Ga0182007_10008619 3300015262 Bacteria 4174
104 Ga0163161_10000026 3300017792 Bacteria 199745
105 Ga0163161_10001218 3300017792 Bacteria 19387
106 Ga0209436_102428 3300025208 Bacteria 5622
107 Ga0207427_100163 3300025231 Bacteria 74501
108 Ga0209437_100017 3300025233 Bacteria 694471
109 Ga0209437_100101 3300025233 Bacteria 226668
110 Ga0207425_1000007 3300025245 Bacteria 777411
111 Ga0209646_1000003 3300025246 Bacteria 1160860
112 Ga0209026_1000182 3300025250 Bacteria 92580
113 Ga0209026_1000318 3300025250 Bacteria 51578
114 Ga0209129_1000006 3300025258 Bacteria 777761
115 Ga0209233_1000124 3300025261 Bacteria 226743
116 Ga0209673_1000081 3300025273 Bacteria 220762
117 Ga0209676_1000001 3300025292 Bacteria 1852142
118 Ga0209025_1000025 3300025294 Bacteria 524454
119 Ga0209564_1001603 3300025295 Bacteria 22026
120 Ga0209564_1003485 3300025295 Bacteria 10706
121 Ga0209758_1000016 3300025297 Bacteria 778557
122 Ga0209758_1001842 3300025297 Bacteria 23265
123 Ga0209758_1002775 3300025297 Bacteria 17144
124 Ga0209758_1012749 3300025297 Bacteria 4659
125 Ga0209050_1000016 3300025298 Bacteria 729149
126 Ga0209050_1000346 3300025298 Bacteria 91427
127 Ga0207426_1000310 3300025302 Bacteria 96036
128 Ga0207426_1001499 3300025302 Bacteria 19104
129 Ga0207426_1003873 3300025302 Bacteria 7712
130 Ga0207656_10002486 3300025321 Bacteria 6225
131 Ga0207655_1000008 3300025728 Bacteria 734289
132 Ga0207680_10001505 3300025903 Bacteria 10979
133 Ga0207695_10012990 3300025913 Bacteria 9949
134 Ga0207671_10004387 3300025914 Bacteria 13522
135 Ga0207671_10006072 3300025914 Bacteria 10882
136 Ga0207704_10000756 3300025938 Bacteria 14262
137 Ga0207691_10000004 3300025940 Bacteria 168729
138 Ga0207689_10064334 3300025942 Bacteria 3018
139 Ga0207679_10044814 3300025945 Bacteria 3195
140 Ga0207667_10010192 3300025949 Bacteria 11007
141 Ga0207668_10001031 3300025972 Bacteria 16624
142 Ga0207658_10001793 3300025986 Bacteria 16085
143 Ga0207677_10004425 3300026023 Bacteria 7539
144 Ga0207703_10002453 3300026035 Bacteria 16080
145 Ga0207639_10030115 3300026041 Bacteria 3978
146 Ga0207641_10041314 3300026088 Bacteria 3864
147 Ga0207648_10010013 3300026089 Bacteria 9018
148 Ga0207648_10010016 3300026089 Bacteria 9018
149 Ga0207676_10001555 3300026095 Bacteria 16922
150 Ga0207676_10056731 3300026095 Bacteria 3081
151 Ga0207675_100113540 3300026118 Bacteria 2558
152 Ga0209281_1000566 3300027111 Bacteria 44512
153 Ga0268266_10000052 3300028379 Bacteria 296230
154 Ga0316176_1189460 3300030732 Bacteria 12906
155 Ga0316183_1171884 3300030742 Bacteria 28440
156 Ga0265327_10014006 3300031251 Bacteria 5281
157 Ga0307513_10040501 3300031456 Bacteria 5150
158 Ga0307408_100003333 3300031548 Bacteria 11030
159 Ga0307408_100003356 3300031548 Bacteria 10990
160 Ga0307412_10000018 3300031911 Bacteria 284374
161 Ga0307510_10000416 3300033180 Bacteria 40773
162 Ga0439445_0001083 3300042004 Bacteria 5815
163 Ga0495650_0000050 3300046471 Bacteria 318894
164 Ga0495606_0000505 3300046507 Bacteria 63449
165 Ga0495606_0009552 3300046507 Bacteria 8190
166 Ga0495606_0029377 3300046507 Bacteria 3861
167 Ga0495610_0000028 3300046512 Bacteria 272572
168 Ga0495610_0000167 3300046512 Bacteria 73458
169 Ga0495610_0005894 3300046512 Bacteria 8587
170 Ga0495632_0001122 3300046519 Bacteria 22926
171 Ga0495633_0000285 3300046558 Bacteria 58070
172 Ga0495633_0003119 3300046558 Bacteria 11230
173 Ga0495668_0000175 3300046616 Bacteria 95600
174 Ga0495625_0000077 3300046660 Bacteria 163166
175 Ga0495625_0000096 3300046660 Bacteria 142609
176 Ga0495625_0079529 3300046660 Unclassified 2285
177 Ga0495649_0000011 3300046694 Bacteria 416695
178 Ga0495660_0010901 3300046810 Bacteria 5281
179 Ga0495673_0012888 3300047469 Bacteria 4409
180 Ga0495686_0000069 3300047472 Bacteria 217778
181 Ga0495686_0000309 3300047472 Bacteria 82637
182 Ga0495686_0037644 3300047472 Bacteria 3098
183 Ga0496116_0000212 3300048919 Bacteria 109276
184 Ga0496121_0000011 3300048924 Bacteria 792193
185 Ga0496122_0002000 3300048925 Bacteria 30344
186 Ga0496123_0026876 3300048926 Bacteria 4300
187 Ga0496124_0036060 3300048927 Bacteria 4319
188 Ga0496125_0000062 3300048928 Bacteria 259277
189 Ga0496125_0031784 3300048928 Bacteria 4699
190 Ga0496125_0034329 3300048928 Bacteria 4474
191 Ga0496126_0110994 3300048929 Bacteria 2388
192 Ga0496126_0143878 3300048929 Bacteria 2050
193 Ga0501219_000579 3300049703 Bacteria 5360
194 Ga0501284_00213 3300050005 Bacteria 3577
195 Ga0500578_0000065 3300053086 Bacteria 117032
196 Ga0500644_0000167 3300053088 Bacteria 41835
197 Ga0500651_0000173 3300053093 Bacteria 41524
198 Ga0500608_000985 3300053122 Bacteria 10230
199 Ga0500618_000002 3300053125 Bacteria 370822
200 Ga0500559_0031510 3300053136 Bacteria 2275
201 Ga0500622_0001220 3300053156 Bacteria 21125
202 Ga0500633_0001145 3300053160 Bacteria 4808
203 2588234554 2585428187 Bacteria 4629388
204 2738701073 2738541273 Bacteria 4048577
205 2738732079 2738541279 Bacteria 6149495
206 2738757702 2738541283 Bacteria 7222293
207 2738760896 2738541284 Bacteria 5199923
208 2738764644 2738541285 Bacteria 6150075
209 2738853834 2738541302 Bacteria 5944758
210 2739213659 2738543007 Bacteria 6149845
211 2739255112 2738543014 Bacteria 4048139
212 2739305497 2738543023 Bacteria 6767879
213 2739588544 2739367651 Bacteria 6359826
214 2739614360 2739367656 Bacteria 5152243
215 2739646898 2739367663 Bacteria 5040914
216 2776613084 2775506987 Bacteria 5373360
217 2819549893 2818991437 Bacteria 5805520
218 2819682143 2818991460 Bacteria 7595395
219 2839990467 2839989709 Bacteria 3773432
220 2842906421 2842903701 Bacteria 6986368
221 2852627294 2852627209 Bacteria 5896285
222 2883068421 2883068021 Bacteria 6192739
223 2896089594 2896085136 Bacteria 6129793
224 2896111730 2896109856 Bacteria 7140722
225 2919187328 2919186247 Bacteria 6244071
226 2929156082 2929154850 Bacteria 6753285
227 2929182536 2929177148 Bacteria 7883697
228 2939665403 2939664404 Bacteria 6364494
229 2945978461 2945977869 Bacteria 7777518
230 2946015676 2946013367 Bacteria 7766675
231 2958460755 2958458903 Bacteria 5301041
232 2977232991 2977232053 Bacteria 5485925
233 8003155070 8003151029 Bacteria 8187759
234 8055421628 8055419101 Bacteria 5289643
235 8055593915 8055592153 Bacteria 5961247
236 Ga0163161_10000385
237 SwRhRL2b_contig_2796787
238 JGI24740J21852_10002255
239 JGI25162J39368_1000011
240 JGI25154J39366_1000019
241 JGI25152J39213_1000075
242 JGI25150J39212_1000009
243 JGI25151J46595_10000017
244 JGI25165J46597_1000436
245 JGI25153J46596_10000023
246 rootH2_10010259
247 rootH1_10006920
248 JGI25160J50197_1001826
249 Ga0055526_1006111
250 Ga0055536_1000011
251 Ga0055528_1000541
252 Ga0055528_1001608
253 Ga0055530_10007686
254 Ga0065165_1000172
255 Ga0065714_10003134
256 Ga0065714_10005445
257 Ga0065714_10009639
258 Ga0065714_10064511
259 Ga0065714_10072305
260 Ga0065704_10070224
261 Ga0065704_10071008
262 Ga0070658_10000832
263 Ga0070676_10004732
264 Ga0068869_100050412
265 Ga0070666_10004870
266 Ga0068868_100005360
267 Ga0070668_100000016
268 Ga0070675_100057565
269 Ga0070667_100000031
270 Ga0068867_100002758
271 Ga0068867_100020692
272 Ga0070684_100036352
273 Ga0068853_100014712
274 Ga0070672_100000002
275 Ga0070665_100000003
276 Ga0068855_100009351
277 Ga0070664_100020180
278 Ga0068854_100018855
279 Ga0068864_100001971
280 Ga0068861_100006920
281 Ga0068851_10004593
282 Ga0068863_100003289
283 Ga0068858_100000083
284 Ga0097621_100006117
285 Ga0068871_100000201
286 Ga0079104_1000005
287 Ga0105244_10000004
288 Ga0105240_10010292
289 Ga0105240_10050893
290 Ga0105242_10036626
291 Ga0105237_10006080
292 Ga0105237_10012535
293 Ga0105249_10001445
294 Ga0105239_10000256
295 Ga0105239_10014959
296 Ga0105246_10076168
297 Ga0157373_10000612
298 Ga0157373_10008161
299 Ga0157371_10000009
300 Ga0157371_10000258
301 Ga0157371_10001139
302 Ga0157371_10003137
303 Ga0157371_10013272
304 Ga0157370_10000132
305 Ga0157370_10005477
306 Ga0157370_10019321
307 Ga0157370_10022721
308 Ga0157370_10045839
309 Ga0157370_10066493
310 Ga0157369_10000006
311 Ga0157369_10000219
312 Ga0157369_10035142
313 Ga0157374_10007969
314 Ga0157378_10025983
315 Ga0157378_10029455
316 Ga0163162_10000029
317 Ga0163162_10000066
318 Ga0163162_10000126
319 Ga0163162_10001232
320 Ga0163162_10002908
321 Ga0163162_10054078
322 Ga0157375_10000042
323 Ga0157375_10000227
324 Ga0157375_10037000
325 Ga0163163_10000076
326 Ga0182008_10000010
327 Ga0182008_10000614
328 Ga0182008_10020934
329 Ga0157379_10000016
330 Ga0157379_10042639
331 Ga0157376_10000558
332 Ga0157376_10011324
333 Ga0157376_10014838
334 Ga0182006_1000689
335 Ga0182006_1001744
336 Ga0182007_10000001
337 Ga0182007_10006378
338 Ga0182007_10008619
339 Ga0163161_10000026
340 Ga0163161_10001218
341 Ga0209436_102428
342 Ga0207427_100163
343 Ga0209437_100017
344 Ga0209437_100101
345 Ga0207425_1000007
346 Ga0209646_1000003
347 Ga0209026_1000182
348 Ga0209026_1000318
349 Ga0209129_1000006
350 Ga0209233_1000124
351 Ga0209673_1000081
352 Ga0209676_1000001
353 Ga0209025_1000025
354 Ga0209564_1001603
355 Ga0209564_1003485
356 Ga0209758_1000016
357 Ga0209758_1001842
358 Ga0209758_1002775
359 Ga0209758_1012749
360 Ga0209050_1000016
361 Ga0209050_1000346
362 Ga0207426_1000310
363 Ga0207426_1001499
364 Ga0207426_1003873
365 Ga0207656_10002486
366 Ga0207655_1000008
367 Ga0207680_10001505
368 Ga0207695_10012990
369 Ga0207671_10004387
370 Ga0207671_10006072
371 Ga0207704_10000756
372 Ga0207691_10000004
373 Ga0207689_10064334
374 Ga0207679_10044814
375 Ga0207667_10010192
376 Ga0207668_10001031
377 Ga0207658_10001793
378 Ga0207677_10004425
379 Ga0207703_10002453
380 Ga0207639_10030115
381 Ga0207641_10041314
382 Ga0207648_10010013
383 Ga0207648_10010016
384 Ga0207676_10001555
385 Ga0207676_10056731
386 Ga0207675_100113540
387 Ga0209281_1000566
388 Ga0268266_10000052
389 Ga0316176_1189460
390 Ga0316183_1171884
391 Ga0265327_10014006
392 Ga0307513_10040501
393 Ga0307408_100003333
394 Ga0307408_100003356
395 Ga0307412_10000018
396 Ga0307510_10000416
397 Ga0439445_0001083
398 Ga0495650_0000050
399 Ga0495606_0000505
400 Ga0495606_0009552
401 Ga0495606_0029377
402 Ga0495610_0000028
403 Ga0495610_0000167
404 Ga0495610_0005894
405 Ga0495632_0001122
406 Ga0495633_0000285
407 Ga0495633_0003119
408 Ga0495668_0000175
409 Ga0495625_0000077
410 Ga0495625_0000096
411 Ga0495625_0079529
412 Ga0495649_0000011
413 Ga0495660_0010901
414 Ga0495673_0012888
415 Ga0495686_0000069
416 Ga0495686_0000309
417 Ga0495686_0037644
418 Ga0496116_0000212
419 Ga0496121_0000011
420 Ga0496122_0002000
421 Ga0496123_0026876
422 Ga0496124_0036060
423 Ga0496125_0000062
424 Ga0496125_0031784
425 Ga0496125_0034329
426 Ga0496126_0110994
427 Ga0496126_0143878
428 Ga0501219_000579
429 Ga0501284_00213
430 Ga0500578_0000065
431 Ga0500644_0000167
432 Ga0500651_0000173
433 Ga0500608_000985
434 Ga0500618_000002
435 Ga0500559_0031510
436 Ga0500622_0001220
437 Ga0500633_0001145
438 2588234554
439 2738701073
440 2738732079
441 2738757702
442 2738760896
443 2738764644
444 2738853834
445 2739213659
446 2739255112
447 2739305497
448 2739588544
449 2739614360
450 2739646898
451 2776613084
452 2819549893
453 2819682143
454 2839990467
455 2842906421
456 2852627294
457 2883068421
458 2896089594
459 2896111730
460 2919187328
461 2929156082
462 2929182536
463 2939665403
464 2945978461
465 2946015676
466 2958460755
467 2977232991
468 8003155070
469 8055421628
470 8055593915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

84

188

0.95

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

203

683

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8blw-assembly1.cif.gz_A vitamin b12 transporter btub1 with lipoprotein btug1 from b. theta 0.9398 64 686
8blw-assembly1.cif.gz_A vitamin b12 transporter btub1 with lipoprotein btug1 from b. theta 0.9369 64 686
8p98-assembly1.cif.gz_A btub3g3 bound to cyanocobalamin with ordered el8 0.8686 64 685
2guf-assembly1.cif.gz_A in meso crystal structure of the cobalamin transporter, btub 0.8662 64 686
8p97-assembly1.cif.gz_A btub3g3 bound to cyanocobalamin with disordered el8 0.8638 67 685
ID Description Score Start End Superfamily
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8375 181 686 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8357 181 686 2.40.170.20
3fhhA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7812 186 686 2.40.170.20
3cslA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7742 189 686 2.40.170.20
3fhhA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7697 186 686 2.40.170.20
ID Description Score Start End GO Terms
AF-A0A4Q3W6Y8-F1-model_v4 TonB-dependent receptor 0.9683 477 683 GO:0009279
GO:0015344
AF-R6WEA5-F1-model_v4 deleted 0.933 115 686
AF-R6WEA5-F1-model_v4 deleted 0.9314 115 686
AF-A0A4Q3W6Y8-F1-model_v4 TonB-dependent receptor 0.9043 477 683 GO:0009279
GO:0015344
AF-E7C8U9-F1-model_v4 Outer membrane cobalamin receptor protein 0.8881 70 686 GO:0009279
GO:0015889

Map