F347726

General Info

Members Datasets Scaffolds Average Seq Length
235 146 470 141

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10725924|Ga0065712_107259241
Length 148
Sequence MKMDVSSAVVSDLWPVYVSGEASPESRTLVETFLAADPTFAQVLHDSSGMMLGDAKVPELSPDHELKTLALTKRRLWGYLWLLQLAIAFSCFAFGRIVSDTSWDVSPRNFIVTASIAGVFWIAFFVSLIRIRARVLIVTPGQRVPDAK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 8.51
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 33.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10725924 3300005290 Unclassified 537
2 Ga0065704_10422242 3300005289 Unclassified 731
3 Ga0065712_10069635 3300005290 Bacteria 6946
4 Ga0065712_10096719 3300005290 Bacteria 2173
5 Ga0065715_10211120 3300005293 Bacteria 1314
6 Ga0065707_10086069 3300005295 Bacteria 5662
7 Ga0070676_10082320 3300005328 Unclassified 1955
8 Ga0070676_10103287 3300005328 Bacteria 1764
9 Ga0070690_101330406 3300005330 Unclassified 576
10 Ga0070680_100197291 3300005336 Bacteria 1697
11 Ga0068868_100211271 3300005338 Bacteria 1622
12 Ga0070689_100106235 3300005340 Unclassified 2227
13 Ga0070689_100745316 3300005340 Bacteria 858
14 Ga0070668_100048377 3300005347 Bacteria 3270
15 Ga0070675_100115386 3300005354 Bacteria 2276
16 Ga0070673_102390735 3300005364 Unclassified 502
17 Ga0070688_100025525 3300005365 Unclassified 3499
18 Ga0070688_100684602 3300005365 Bacteria 793
19 Ga0070701_10126445 3300005438 Bacteria 1447
20 Ga0070711_100491049 3300005439 Unclassified 1011
21 Ga0070694_100414478 3300005444 Bacteria 1057
22 Ga0070708_100213381 3300005445 Bacteria 1809
23 Ga0070663_100083428 3300005455 Bacteria 2353
24 Ga0070663_100939024 3300005455 Bacteria 749
25 Ga0070678_100059054 3300005456 Bacteria 2818
26 Ga0070678_100179353 3300005456 Bacteria 1732
27 Ga0070678_100352172 3300005456 Bacteria 1266
28 Ga0070678_101725928 3300005456 Bacteria 589
29 Ga0070678_101977024 3300005456 Unclassified 551
30 Ga0070662_100623383 3300005457 Unclassified 908
31 Ga0068867_100101280 3300005459 Bacteria 2200
32 Ga0068867_100118560 3300005459 Bacteria 2042
33 Ga0068867_100283703 3300005459 Unclassified 1359
34 Ga0068867_100610083 3300005459 Bacteria 953
35 Ga0068867_100821140 3300005459 Bacteria 831
36 Ga0070685_10296382 3300005466 Bacteria 1088
37 Ga0070706_101178610 3300005467 Bacteria 704
38 Ga0070698_100352623 3300005471 Bacteria 1403
39 Ga0070699_100003083 3300005518 Bacteria 14773
40 Ga0070672_100154079 3300005543 Bacteria 1903
41 Ga0070672_100609614 3300005543 Unclassified 951
42 Ga0070672_101112147 3300005543 Bacteria 702
43 Ga0070686_101751867 3300005544 Unclassified 528
44 Ga0070695_100195788 3300005545 Bacteria 1441
45 Ga0070696_101542712 3300005546 Unclassified 569
46 Ga0070693_100565328 3300005547 Bacteria 816
47 Ga0070665_100107659 3300005548 Unclassified 2790
48 Ga0070664_100352339 3300005564 Unclassified 1339
49 Ga0070702_100254487 3300005615 Unclassified 1192
50 Ga0068852_100454316 3300005616 Bacteria 1269
51 Ga0068852_102463486 3300005616 Bacteria 541
52 Ga0068859_100375995 3300005617 Bacteria 1516
53 Ga0068866_10052257 3300005718 Bacteria 2085
54 Ga0068866_10110948 3300005718 Bacteria 1530
55 Ga0068861_100092122 3300005719 Unclassified 2394
56 Ga0068863_100341860 3300005841 Bacteria 1456
57 Ga0068863_100664315 3300005841 Unclassified 1034
58 Ga0068860_100183399 3300005843 Bacteria 2023
59 Ga0068860_101191245 3300005843 Bacteria 782
60 Ga0068860_101305630 3300005843 Unclassified 746
61 Ga0068862_101042995 3300005844 Bacteria 810
62 Ga0068862_101836598 3300005844 Bacteria 615
63 Ga0075364_11155025 3300006051 Bacteria 525
64 Ga0075432_10405096 3300006058 Unclassified 590
65 Ga0070712_101395453 3300006175 Bacteria 611
66 Ga0097621_100300433 3300006237 Bacteria 1418
67 Ga0097621_100369476 3300006237 Bacteria 1279
68 Ga0097621_100655139 3300006237 Unclassified 964
69 Ga0068871_100146885 3300006358 Bacteria 2008
70 Ga0068871_100195733 3300006358 Bacteria 1743
71 Ga0068871_101353840 3300006358 Unclassified 670
72 Ga0075428_100026147 3300006844 Bacteria 6463
73 Ga0075428_100380990 3300006844 Bacteria 1512
74 Ga0075428_102070126 3300006844 Unclassified 589
75 Ga0075431_100004981 3300006847 Bacteria 13070
76 Ga0075431_101816341 3300006847 Unclassified 566
77 Ga0075433_10374505 3300006852 Bacteria 1257
78 Ga0075433_10973195 3300006852 Bacteria 739
79 Ga0075434_100330165 3300006871 Bacteria 1546
80 Ga0075434_100541001 3300006871 Unclassified 1185
81 Ga0075434_101316395 3300006871 Unclassified 733
82 Ga0075429_100356707 3300006880 Unclassified 1280
83 Ga0068865_100644988 3300006881 Unclassified 899
84 Ga0097620_100375992 3300006931 Bacteria 1516
85 Ga0075435_100391317 3300007076 Bacteria 1195
86 Ga0075435_101114467 3300007076 Unclassified 690
87 Ga0111539_10027860 3300009094 Bacteria 6899
88 Ga0111539_10085961 3300009094 Bacteria 3696
89 Ga0111539_10746420 3300009094 Bacteria 1139
90 Ga0105245_10115590 3300009098 Bacteria 2500
91 Ga0105245_11169622 3300009098 Bacteria 817
92 Ga0105247_10131999 3300009101 Bacteria 1628
93 Ga0114129_10102985 3300009147 Bacteria 3947
94 Ga0114129_10739322 3300009147 Bacteria 1260
95 Ga0105243_10182460 3300009148 Unclassified 1826
96 Ga0105243_10238222 3300009148 Unclassified 1618
97 Ga0105243_10595274 3300009148 Unclassified 1064
98 Ga0105241_10078112 3300009174 Unclassified 2586
99 Ga0105242_10119573 3300009176 Bacteria 2258
100 Ga0105242_10489004 3300009176 Bacteria 1168
101 Ga0105242_10741660 3300009176 Bacteria 966
102 Ga0105242_10870507 3300009176 Unclassified 898
103 Ga0105248_10112645 3300009177 Bacteria 3068
104 Ga0105248_10437282 3300009177 Bacteria 1473
105 Ga0105249_10464908 3300009553 Bacteria 1306
106 Ga0105249_10561057 3300009553 Unclassified 1193
107 Ga0105239_12276731 3300010375 Bacteria 630
108 Ga0105246_10256272 3300011119 Bacteria 1391
109 Ga0105246_10415874 3300011119 Bacteria 1121
110 Ga0157374_10148665 3300013296 Bacteria 2277
111 Ga0157374_10596762 3300013296 Bacteria 1114
112 Ga0157378_12278719 3300013297 Unclassified 593
113 Ga0163162_10321376 3300013306 Unclassified 1680
114 Ga0157375_10016849 3300013308 Bacteria 6578
115 Ga0163163_10027279 3300014325 Bacteria 5469
116 Ga0163163_10102220 3300014325 Bacteria 2889
117 Ga0163163_10536426 3300014325 Unclassified 1232
118 Ga0157380_10262822 3300014326 Bacteria 1569
119 Ga0157379_10139524 3300014968 Unclassified 2185
120 Ga0157379_10583952 3300014968 Bacteria 1042
121 Ga0157379_10837066 3300014968 Bacteria 870
122 Ga0157376_10143679 3300014969 Bacteria 2144
123 Ga0163161_10056750 3300017792 Bacteria 2844
124 Ga0207642_10341295 3300025899 Bacteria 881
125 Ga0207688_10229790 3300025901 Unclassified 1120
126 Ga0207688_10643078 3300025901 Bacteria 669
127 Ga0207645_10087472 3300025907 Unclassified 2002
128 Ga0207654_10037612 3300025911 Unclassified 2710
129 Ga0207660_10397997 3300025917 Bacteria 1109
130 Ga0207657_10954037 3300025919 Bacteria 659
131 Ga0207681_10236131 3300025923 Unclassified 1421
132 Ga0207681_10430678 3300025923 Bacteria 1070
133 Ga0207659_10395139 3300025926 Bacteria 1155
134 Ga0207659_10450004 3300025926 Bacteria 1084
135 Ga0207706_10432801 3300025933 Unclassified 1139
136 Ga0207706_10648282 3300025933 Unclassified 905
137 Ga0207686_10565420 3300025934 Unclassified 891
138 Ga0207686_11676497 3300025934 Unclassified 525
139 Ga0207709_10092519 3300025935 Unclassified 1980
140 Ga0207709_10546046 3300025935 Unclassified 911
141 Ga0207670_10640711 3300025936 Bacteria 875
142 Ga0207670_11043097 3300025936 Unclassified 689
143 Ga0207704_10731044 3300025938 Unclassified 822
144 Ga0207691_10088874 3300025940 Bacteria 2771
145 Ga0207691_10161667 3300025940 Bacteria 1964
146 Ga0207691_10872212 3300025940 Bacteria 754
147 Ga0207691_10875912 3300025940 Bacteria 752
148 Ga0207711_10249284 3300025941 Bacteria 1630
149 Ga0207711_10429146 3300025941 Bacteria 1230
150 Ga0207679_10310532 3300025945 Unclassified 1362
151 Ga0207668_10040767 3300025972 Bacteria 3135
152 Ga0207658_10955998 3300025986 Bacteria 781
153 Ga0207677_10371404 3300026023 Bacteria 1204
154 Ga0207678_10161375 3300026067 Bacteria 1914
155 Ga0207708_10549215 3300026075 Bacteria 974
156 Ga0207641_10032579 3300026088 Unclassified 4327
157 Ga0207641_10336767 3300026088 Bacteria 1435
158 Ga0207648_10060243 3300026089 Unclassified 3310
159 Ga0207648_10394820 3300026089 Unclassified 1252
160 Ga0207648_10465291 3300026089 Bacteria 1153
161 Ga0207676_10112516 3300026095 Bacteria 2281
162 Ga0207675_100217627 3300026118 Unclassified 1839
163 Ga0207675_100403936 3300026118 Bacteria 1347
164 Ga0207683_10046674 3300026121 Bacteria 3792
165 Ga0207683_10089733 3300026121 Bacteria 2736
166 Ga0207698_12125479 3300026142 Bacteria 575
167 Ga0207428_10002662 3300027907 Bacteria 17796
168 Ga0207428_10139010 3300027907 Bacteria 1855
169 Ga0268266_10128975 3300028379 Bacteria 2260
170 Ga0268265_10447942 3300028380 Unclassified 1205
171 Ga0268265_10594935 3300028380 Bacteria 1056
172 Ga0268264_10240512 3300028381 Unclassified 1676
173 Ga0268264_11098457 3300028381 Unclassified 804
174 Ga0268264_11193296 3300028381 Unclassified 770
175 Ga0373945_0513393 3300035116 Bacteria 535
176 Ga0373935_0814756 3300035692 Bacteria 690
177 Ga0373937_0509546 3300036401 Bacteria 1143
178 Ga0373925_0201528 3300037068 Unclassified 1583
179 Ga0373925_0385649 3300037068 Bacteria 1141
180 Ga0451853_2833276 3300041512 Bacteria 934
181 Ga0451576_0444233 3300045051 Bacteria 1361
182 Ga0451576_0874321 3300045051 Bacteria 943
183 Ga0451576_1424338 3300045051 Bacteria 721
184 Ga0495603_0142499 3300046455 Bacteria 1394
185 Ga0495629_0824958 3300046459 Bacteria 611
186 Ga0495580_0595909 3300046472 Unclassified 731
187 Ga0495608_0220087 3300046511 Bacteria 1191
188 Ga0495630_0581991 3300046517 Unclassified 858
189 Ga0495630_1018079 3300046517 Unclassified 629
190 Ga0495640_0300001 3300046533 Bacteria 998
191 Ga0495645_0287613 3300046543 Bacteria 1079
192 Ga0495645_0507656 3300046543 Bacteria 753
193 Ga0495635_0071735 3300046663 Bacteria 2374
194 Ga0495658_0047924 3300046683 Bacteria 2408
195 Ga0495613_0385849 3300046689 Unclassified 957
196 Ga0495600_0260926 3300046809 Bacteria 1100
197 Ga0495636_0008788 3300047318 Bacteria 3983
198 Ga0495675_0485980 3300047444 Bacteria 710
199 Ga0496100_0327798 3300048903 Bacteria 1152
200 Ga0496100_0563195 3300048903 Unclassified 882
201 Ga0496101_0607093 3300048904 Bacteria 865
202 Ga0496101_0709725 3300048904 Unclassified 794
203 Ga0496101_0716320 3300048904 Archaea 790
204 Ga0496104_0071439 3300048907 Bacteria 3300
205 Ga0496104_0357372 3300048907 Unclassified 1373
206 Ga0496104_1218028 3300048907 Bacteria 656
207 Ga0496105_0042168 3300048908 Bacteria 3761
208 Ga0496105_0362196 3300048908 Unclassified 1157
209 Ga0496105_0443835 3300048908 Unclassified 1025
210 Ga0496106_0077760 3300048909 Unclassified 2545
211 Ga0496107_0562321 3300048910 Unclassified 844
212 Ga0496108_0056176 3300048911 Bacteria 3307
213 Ga0496108_0510221 3300048911 Bacteria 1050
214 Ga0496109_1671088 3300048912 Bacteria 571
215 Ga0496112_0272306 3300048915 Unclassified 1641
216 Ga0496113_1146332 3300048916 Unclassified 609
217 Ga0496114_0010766 3300048917 Bacteria 7280
218 Ga0496115_0367306 3300048918 Unclassified 1172
219 Ga0501071_1320529 3300049587 Bacteria 557
220 nmdc:mga05p37_1491960_c1 3300050507 Unclassified 674
221 nmdc:mga05p37_830360_c1 3300050507 Bacteria 1006
222 nmdc:mga06r32_4094_c1 3300050510 Bacteria 13073
223 nmdc:mga06r32_927262_c1 3300050510 Unclassified 826
224 nmdc:mga08y16_24126_c1 3300050511 Bacteria 6422
225 nmdc:mga08y16_261440_c1 3300050511 Bacteria 1787
226 nmdc:mga08y16_543691_c1 3300050511 Bacteria 1176
227 nmdc:mga0n895_606126_c1 3300050512 Bacteria 1097
228 nmdc:mga0n895_732412_c1 3300050512 Unclassified 983
229 nmdc:mga0rr50_255281_c1 3300050513 Bacteria 1457
230 nmdc:mga0a205_18606_c1 3300050515 Bacteria 6534
231 nmdc:mga0a205_337056_c1 3300050515 Bacteria 1377
232 Ga0495601_0276749 3300053077 Bacteria 1094
233 Ga0495612_0196400 3300053078 Bacteria 889
234 Ga0495595_0067969 3300053084 Bacteria 1680
235 Ga0495619_0110244 3300053085 Bacteria 1880
236 Ga0065712_10725924
237 Ga0065704_10422242
238 Ga0065712_10069635
239 Ga0065712_10096719
240 Ga0065715_10211120
241 Ga0065707_10086069
242 Ga0070676_10082320
243 Ga0070676_10103287
244 Ga0070690_101330406
245 Ga0070680_100197291
246 Ga0068868_100211271
247 Ga0070689_100106235
248 Ga0070689_100745316
249 Ga0070668_100048377
250 Ga0070675_100115386
251 Ga0070673_102390735
252 Ga0070688_100025525
253 Ga0070688_100684602
254 Ga0070701_10126445
255 Ga0070711_100491049
256 Ga0070694_100414478
257 Ga0070708_100213381
258 Ga0070663_100083428
259 Ga0070663_100939024
260 Ga0070678_100059054
261 Ga0070678_100179353
262 Ga0070678_100352172
263 Ga0070678_101725928
264 Ga0070678_101977024
265 Ga0070662_100623383
266 Ga0068867_100101280
267 Ga0068867_100118560
268 Ga0068867_100283703
269 Ga0068867_100610083
270 Ga0068867_100821140
271 Ga0070685_10296382
272 Ga0070706_101178610
273 Ga0070698_100352623
274 Ga0070699_100003083
275 Ga0070672_100154079
276 Ga0070672_100609614
277 Ga0070672_101112147
278 Ga0070686_101751867
279 Ga0070695_100195788
280 Ga0070696_101542712
281 Ga0070693_100565328
282 Ga0070665_100107659
283 Ga0070664_100352339
284 Ga0070702_100254487
285 Ga0068852_100454316
286 Ga0068852_102463486
287 Ga0068859_100375995
288 Ga0068866_10052257
289 Ga0068866_10110948
290 Ga0068861_100092122
291 Ga0068863_100341860
292 Ga0068863_100664315
293 Ga0068860_100183399
294 Ga0068860_101191245
295 Ga0068860_101305630
296 Ga0068862_101042995
297 Ga0068862_101836598
298 Ga0075364_11155025
299 Ga0075432_10405096
300 Ga0070712_101395453
301 Ga0097621_100300433
302 Ga0097621_100369476
303 Ga0097621_100655139
304 Ga0068871_100146885
305 Ga0068871_100195733
306 Ga0068871_101353840
307 Ga0075428_100026147
308 Ga0075428_100380990
309 Ga0075428_102070126
310 Ga0075431_100004981
311 Ga0075431_101816341
312 Ga0075433_10374505
313 Ga0075433_10973195
314 Ga0075434_100330165
315 Ga0075434_100541001
316 Ga0075434_101316395
317 Ga0075429_100356707
318 Ga0068865_100644988
319 Ga0097620_100375992
320 Ga0075435_100391317
321 Ga0075435_101114467
322 Ga0111539_10027860
323 Ga0111539_10085961
324 Ga0111539_10746420
325 Ga0105245_10115590
326 Ga0105245_11169622
327 Ga0105247_10131999
328 Ga0114129_10102985
329 Ga0114129_10739322
330 Ga0105243_10182460
331 Ga0105243_10238222
332 Ga0105243_10595274
333 Ga0105241_10078112
334 Ga0105242_10119573
335 Ga0105242_10489004
336 Ga0105242_10741660
337 Ga0105242_10870507
338 Ga0105248_10112645
339 Ga0105248_10437282
340 Ga0105249_10464908
341 Ga0105249_10561057
342 Ga0105239_12276731
343 Ga0105246_10256272
344 Ga0105246_10415874
345 Ga0157374_10148665
346 Ga0157374_10596762
347 Ga0157378_12278719
348 Ga0163162_10321376
349 Ga0157375_10016849
350 Ga0163163_10027279
351 Ga0163163_10102220
352 Ga0163163_10536426
353 Ga0157380_10262822
354 Ga0157379_10139524
355 Ga0157379_10583952
356 Ga0157379_10837066
357 Ga0157376_10143679
358 Ga0163161_10056750
359 Ga0207642_10341295
360 Ga0207688_10229790
361 Ga0207688_10643078
362 Ga0207645_10087472
363 Ga0207654_10037612
364 Ga0207660_10397997
365 Ga0207657_10954037
366 Ga0207681_10236131
367 Ga0207681_10430678
368 Ga0207659_10395139
369 Ga0207659_10450004
370 Ga0207706_10432801
371 Ga0207706_10648282
372 Ga0207686_10565420
373 Ga0207686_11676497
374 Ga0207709_10092519
375 Ga0207709_10546046
376 Ga0207670_10640711
377 Ga0207670_11043097
378 Ga0207704_10731044
379 Ga0207691_10088874
380 Ga0207691_10161667
381 Ga0207691_10872212
382 Ga0207691_10875912
383 Ga0207711_10249284
384 Ga0207711_10429146
385 Ga0207679_10310532
386 Ga0207668_10040767
387 Ga0207658_10955998
388 Ga0207677_10371404
389 Ga0207678_10161375
390 Ga0207708_10549215
391 Ga0207641_10032579
392 Ga0207641_10336767
393 Ga0207648_10060243
394 Ga0207648_10394820
395 Ga0207648_10465291
396 Ga0207676_10112516
397 Ga0207675_100217627
398 Ga0207675_100403936
399 Ga0207683_10046674
400 Ga0207683_10089733
401 Ga0207698_12125479
402 Ga0207428_10002662
403 Ga0207428_10139010
404 Ga0268266_10128975
405 Ga0268265_10447942
406 Ga0268265_10594935
407 Ga0268264_10240512
408 Ga0268264_11098457
409 Ga0268264_11193296
410 Ga0373945_0513393
411 Ga0373935_0814756
412 Ga0373937_0509546
413 Ga0373925_0201528
414 Ga0373925_0385649
415 Ga0451853_2833276
416 Ga0451576_0444233
417 Ga0451576_0874321
418 Ga0451576_1424338
419 Ga0495603_0142499
420 Ga0495629_0824958
421 Ga0495580_0595909
422 Ga0495608_0220087
423 Ga0495630_0581991
424 Ga0495630_1018079
425 Ga0495640_0300001
426 Ga0495645_0287613
427 Ga0495645_0507656
428 Ga0495635_0071735
429 Ga0495658_0047924
430 Ga0495613_0385849
431 Ga0495600_0260926
432 Ga0495636_0008788
433 Ga0495675_0485980
434 Ga0496100_0327798
435 Ga0496100_0563195
436 Ga0496101_0607093
437 Ga0496101_0709725
438 Ga0496101_0716320
439 Ga0496104_0071439
440 Ga0496104_0357372
441 Ga0496104_1218028
442 Ga0496105_0042168
443 Ga0496105_0362196
444 Ga0496105_0443835
445 Ga0496106_0077760
446 Ga0496107_0562321
447 Ga0496108_0056176
448 Ga0496108_0510221
449 Ga0496109_1671088
450 Ga0496112_0272306
451 Ga0496113_1146332
452 Ga0496114_0010766
453 Ga0496115_0367306
454 Ga0501071_1320529
455 nmdc:mga05p37_1491960_c1
456 nmdc:mga05p37_830360_c1
457 nmdc:mga06r32_4094_c1
458 nmdc:mga06r32_927262_c1
459 nmdc:mga08y16_24126_c1
460 nmdc:mga08y16_261440_c1
461 nmdc:mga08y16_543691_c1
462 nmdc:mga0n895_606126_c1
463 nmdc:mga0n895_732412_c1
464 nmdc:mga0rr50_255281_c1
465 nmdc:mga0a205_18606_c1
466 nmdc:mga0a205_337056_c1
467 Ga0495601_0276749
468 Ga0495612_0196400
469 Ga0495595_0067969
470 Ga0495619_0110244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map