F347567

General Info

Members Datasets Scaffolds Average Seq Length
234 181 468 166

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0248549|Ga0500583_0248549_54_596
Length 180
Sequence MLPRQKVTAERSRPMPELQLLRADHAPAVLDFELANRAWFAASISDRGDGYFEEFAARHEALLAEQEAGVCAFYVLVAEDGSVLGRFNLYDLTEEHTADLGYRVAQHVAGHGVATATVEELCRLAAERHGLRTLRAATSHQNLASQKVLTKAGFTPVGPAHPSDLGGKQGTWYQRDLQAP

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
79 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
80 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
167 2643221647 Streptomyces sp. Root369 Isolate Unclassified
168 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
169 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
170 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
171 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
172 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
173 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
174 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
175 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
176 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
177 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
178 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
179 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
180 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
181 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0.43
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 9.4
Rhizosphere 81.62
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0248549 3300053092 Bacteria 878
2 JGI25404J52841_10012140 3300003659 Bacteria 1863
3 Ga0070683_100081831 3300005329 Bacteria 3023
4 Ga0070683_100340546 3300005329 Bacteria 1428
5 Ga0070680_100393726 3300005336 Bacteria 1180
6 Ga0070680_101211205 3300005336 Bacteria 653
7 Ga0070660_100519280 3300005339 Bacteria 992
8 Ga0070660_100931727 3300005339 Bacteria 733
9 Ga0070709_10021573 3300005434 Bacteria 3753
10 Ga0070714_100058711 3300005435 Bacteria 3297
11 Ga0070714_100109740 3300005435 Bacteria 2441
12 Ga0070714_100669269 3300005435 Bacteria 1000
13 Ga0070713_100005199 3300005436 Bacteria 8863
14 Ga0070710_10014348 3300005437 Bacteria 3987
15 Ga0070711_100010876 3300005439 Bacteria 5641
16 Ga0070711_100828524 3300005439 Bacteria 786
17 Ga0070705_100456139 3300005440 Bacteria 960
18 Ga0070708_100042211 3300005445 Bacteria 4002
19 Ga0070663_100762990 3300005455 Bacteria 827
20 Ga0070681_10042216 3300005458 Bacteria 4571
21 Ga0070707_100973311 3300005468 Bacteria 814
22 Ga0070698_100085390 3300005471 Bacteria 3144
23 Ga0070698_100488653 3300005471 Bacteria 1168
24 Ga0070679_100084043 3300005530 Bacteria 3171
25 Ga0070679_101410241 3300005530 Bacteria 643
26 Ga0070684_100052552 3300005535 Bacteria 3544
27 Ga0070684_101349666 3300005535 Bacteria 671
28 Ga0070665_100244865 3300005548 Bacteria 1793
29 Ga0070664_100799233 3300005564 Bacteria 882
30 Ga0068852_100618894 3300005616 Bacteria 1088
31 Ga0068870_10471346 3300005840 Bacteria 831
32 Ga0068863_100593587 3300005841 Bacteria 1096
33 Ga0081455_10249407 3300005937 Bacteria 1299
34 Ga0081540_1000520 3300005983 Bacteria 37750
35 Ga0070717_10102775 3300006028 Bacteria 2428
36 Ga0075365_10096165 3300006038 Bacteria 2024
37 Ga0075363_100218101 3300006048 Bacteria 1093
38 Ga0070715_10294904 3300006163 Bacteria 865
39 Ga0070716_100009992 3300006173 Bacteria 4745
40 Ga0070712_100246760 3300006175 Bacteria 1424
41 Ga0075370_10807323 3300006353 Bacteria 572
42 Ga0105240_10403239 3300009093 Bacteria 1540
43 Ga0111539_10076240 3300009094 Bacteria 3948
44 Ga0111539_10339556 3300009094 Unclassified 1748
45 Ga0111539_11400750 3300009094 Bacteria 811
46 Ga0105245_10503693 3300009098 Bacteria 1227
47 Ga0114129_10089618 3300009147 Bacteria 4264
48 Ga0114129_10775851 3300009147 Unclassified 1225
49 Ga0105243_10290599 3300009148 Bacteria 1476
50 Ga0105241_11026833 3300009174 Bacteria 773
51 Ga0105248_10107998 3300009177 Bacteria 3138
52 Ga0105237_10461933 3300009545 Bacteria 1275
53 Ga0105239_10265194 3300010375 Bacteria 1931
54 Ga0105246_10195325 3300011119 Bacteria 1569
55 Ga0157313_1043291 3300012503 Bacteria 561
56 Ga0157369_11672843 3300013105 Bacteria 647
57 Ga0157374_10526658 3300013296 Bacteria 1188
58 Ga0157372_10251932 3300013307 Bacteria 2050
59 Ga0157375_10059060 3300013308 Bacteria 3797
60 Ga0157375_10717011 3300013308 Bacteria 1153
61 Ga0163163_10478944 3300014325 Bacteria 1306
62 Ga0206354_10323131 3300020081 Bacteria 1842
63 Ga0207685_10190979 3300025905 Bacteria 956
64 Ga0207705_10047296 3300025909 Bacteria 3093
65 Ga0207684_10532940 3300025910 Bacteria 1005
66 Ga0207707_10071560 3300025912 Bacteria 3022
67 Ga0207695_10075230 3300025913 Bacteria 3436
68 Ga0207693_10107986 3300025915 Bacteria 2183
69 Ga0207693_10536306 3300025915 Bacteria 913
70 Ga0207663_10037366 3300025916 Bacteria 2927
71 Ga0207657_10093873 3300025919 Bacteria 2499
72 Ga0207652_10133945 3300025921 Bacteria 2211
73 Ga0207687_10378486 3300025927 Bacteria 1159
74 Ga0207700_10193051 3300025928 Bacteria 1712
75 Ga0207700_10909025 3300025928 Bacteria 788
76 Ga0207700_10934225 3300025928 Bacteria 776
77 Ga0207664_10155268 3300025929 Bacteria 1948
78 Ga0207664_10277831 3300025929 Bacteria 1469
79 Ga0207644_10801878 3300025931 Bacteria 788
80 Ga0207711_10388728 3300025941 Bacteria 1295
81 Ga0207661_10193244 3300025944 Bacteria 1785
82 Ga0207677_10222194 3300026023 Bacteria 1516
83 Ga0207678_10169891 3300026067 Bacteria 1862
84 Ga0207702_10326485 3300026078 Bacteria 1463
85 Ga0207641_10182995 3300026088 Bacteria 1921
86 Ga0207648_10187895 3300026089 Bacteria 1830
87 Ga0207648_10626599 3300026089 Bacteria 993
88 Ga0207683_10269719 3300026121 Bacteria 1555
89 Ga0307515_10000025 3300028794 Bacteria 390205
90 Ga0307515_10579575 3300028794 Bacteria 732
91 Ga0307509_10030507 3300031507 Bacteria 5962
92 Ga0307508_10032574 3300031616 Bacteria 4708
93 Ga0307516_10539810 3300031730 Bacteria 820
94 Ga0307518_10137135 3300031838 Bacteria 1711
95 Ga0307518_10201795 3300031838 Bacteria 1320
96 Ga0307416_101131723 3300032002 Bacteria 888
97 Ga0307510_10002306 3300033180 Bacteria 21560
98 Ga0373930_0056811 3300034816 Bacteria 866
99 Ga0373959_0023712 3300034820 Bacteria 1195
100 Ga0373929_0038260 3300035085 Bacteria 1055
101 Ga0373934_0000071 3300035086 Bacteria 35066
102 Ga0373934_0008196 3300035086 Bacteria 3890
103 Ga0373949_0106500 3300035090 Bacteria 773
104 Ga0373953_0000043 3300035117 Bacteria 32688
105 Ga0373954_0021872 3300035118 Bacteria 2898
106 Ga0373956_0005361 3300035119 Bacteria 5133
107 Ga0373957_0000288 3300035120 Bacteria 12713
108 Ga0373955_0000894 3300035172 Bacteria 12801
109 Ga0373955_0064426 3300035172 Bacteria 2032
110 Ga0373924_0064868 3300035410 Bacteria 1533
111 Ga0373931_0035519 3300035691 Bacteria 2592
112 Ga0373935_0242170 3300035692 Bacteria 1260
113 Ga0373933_0000283 3300035724 Bacteria 32966
114 Ga0373947_0294067 3300035725 Bacteria 1082
115 Ga0373937_0000560 3300036401 Bacteria 32978
116 Ga0373937_1616564 3300036401 Bacteria 595
117 Ga0373925_0017202 3300037068 Bacteria 5236
118 Ga0373925_0578254 3300037068 Bacteria 925
119 Ga0373925_1158381 3300037068 Bacteria 636
120 Ga0451837_0663092 3300041494 Bacteria 1025
121 Ga0451853_3076958 3300041512 Unclassified 702
122 Ga0466965_0007149 3300044683 Bacteria 5114
123 Ga0466963_0218994 3300044694 Bacteria 1333
124 Ga0466963_0447244 3300044694 Bacteria 912
125 Ga0466970_0009139 3300044765 Bacteria 5003
126 Ga0466957_0147229 3300044842 Bacteria 1521
127 Ga0466967_0051863 3300045976 Bacteria 3598
128 Ga0466967_0231098 3300045976 Bacteria 1761
129 Ga0466967_0576858 3300045976 Unclassified 1109
130 Ga0495592_0009192 3300046454 Bacteria 7436
131 Ga0495629_0031125 3300046459 Bacteria 3779
132 Ga0495651_0003795 3300046462 Bacteria 11559
133 Ga0495651_0070176 3300046462 Bacteria 2666
134 Ga0495653_0035847 3300046463 Bacteria 3912
135 Ga0495653_0059211 3300046463 Bacteria 2908
136 Ga0495662_0110638 3300046476 Bacteria 1346
137 Ga0495664_0101361 3300046477 Bacteria 1735
138 Ga0495664_0161083 3300046477 Bacteria 1361
139 Ga0495608_0000310 3300046511 Bacteria 34155
140 Ga0495608_0003288 3300046511 Bacteria 11548
141 Ga0495618_0382573 3300046514 Bacteria 863
142 Ga0495628_0004569 3300046516 Bacteria 12249
143 Ga0495628_0011984 3300046516 Bacteria 7312
144 Ga0495666_0354660 3300046526 Bacteria 661
145 Ga0495652_0153412 3300046529 Bacteria 1796
146 Ga0495640_0039189 3300046533 Bacteria 3327
147 Ga0495587_0000348 3300046536 Bacteria 32978
148 Ga0495587_0026908 3300046536 Bacteria 3503
149 Ga0495587_0239698 3300046536 Bacteria 1021
150 Ga0495587_0527978 3300046536 Bacteria 652
151 Ga0495645_0210992 3300046543 Bacteria 1311
152 Ga0495667_0001303 3300046559 Bacteria 16358
153 Ga0495667_0001844 3300046559 Bacteria 14067
154 Ga0495634_0176151 3300046642 Bacteria 1342
155 Ga0495625_0089627 3300046660 Bacteria 2129
156 Ga0495635_0855907 3300046663 Bacteria 584
157 Ga0495588_0011341 3300046674 Bacteria 4178
158 Ga0495657_0002234 3300046675 Bacteria 16398
159 Ga0495657_0033706 3300046675 Bacteria 3563
160 Ga0495599_0000267 3300046678 Bacteria 32878
161 Ga0495599_0133817 3300046678 Bacteria 1539
162 Ga0495623_0002895 3300046679 Bacteria 11296
163 Ga0495646_0010328 3300046680 Bacteria 5936
164 Ga0495646_0087494 3300046680 Bacteria 1806
165 Ga0495600_0030358 3300046809 Bacteria 3501
166 Ga0495604_0000550 3300047317 Bacteria 32980
167 Ga0495604_0061855 3300047317 Bacteria 2862
168 Ga0495680_0000904 3300047322 Bacteria 32976
169 Ga0495687_002804 3300047443 Bacteria 13446
170 Ga0495675_0001504 3300047444 Bacteria 14113
171 Ga0495675_0075397 3300047444 Bacteria 2126
172 Ga0495681_0004765 3300047470 Bacteria 9190
173 Ga0495684_0020912 3300047471 Bacteria 5042
174 Ga0495686_0157743 3300047472 Bacteria 1328
175 Ga0495602_0000631 3300048088 Bacteria 32978
176 Ga0495602_0434479 3300048088 Bacteria 929
177 Ga0496100_0431601 3300048903 Bacteria 1008
178 Ga0496101_0015472 3300048904 Bacteria 5143
179 Ga0496102_0207943 3300048905 Bacteria 1845
180 Ga0496102_1060157 3300048905 Bacteria 731
181 Ga0496104_0001726 3300048907 Bacteria 18876
182 Ga0496105_0000625 3300048908 Bacteria 23668
183 Ga0496106_0775466 3300048909 Bacteria 761
184 Ga0496107_0031712 3300048910 Bacteria 3773
185 Ga0496107_0494357 3300048910 Bacteria 907
186 Ga0496107_0914049 3300048910 Bacteria 639
187 Ga0496108_0235620 3300048911 Bacteria 1592
188 Ga0496108_0556013 3300048911 Bacteria 1001
189 Ga0496109_0008337 3300048912 Bacteria 8802
190 Ga0496109_0070584 3300048912 Bacteria 3206
191 Ga0496110_0360810 3300048913 Bacteria 1324
192 Ga0496110_0545801 3300048913 Bacteria 1053
193 Ga0496111_0141311 3300048914 Bacteria 1784
194 Ga0496111_0498148 3300048914 Bacteria 897
195 Ga0496112_0484098 3300048915 Bacteria 1174
196 Ga0496114_0020014 3300048917 Bacteria 5428
197 Ga0496114_0084056 3300048917 Bacteria 2694
198 Ga0496115_0001765 3300048918 Bacteria 15483
199 Ga0496126_1046795 3300048929 Bacteria 609
200 Ga0501034_0683000 3300049571 Bacteria 926
201 Ga0501042_0123620 3300049578 Bacteria 1863
202 Ga0501043_0544922 3300049579 Bacteria 862
203 Ga0501047_0018903 3300049581 Bacteria 6608
204 Ga0501070_0248334 3300049586 Bacteria 1456
205 Ga0501074_0501287 3300049590 Bacteria 860
206 Ga0501080_0136239 3300049742 Bacteria 2272
207 Ga0501035_0231262 3300049822 Bacteria 1575
208 Ga0501044_0105393 3300049823 Bacteria 2832
209 nmdc:mga0yw44_470805_c1 3300050492 Bacteria 852
210 nmdc:mga09592_30827_c1 3300050508 Bacteria 4465
211 nmdc:mga0qj67_125462_c1 3300050509 Bacteria 2078
212 nmdc:mga06r32_183678_c1 3300050510 Bacteria 2078
213 nmdc:mga08y16_305809_c1 3300050511 Unclassified 1638
214 nmdc:mga08y16_713350_c1 3300050511 Bacteria 1002
215 nmdc:mga08x19_469506_c1 3300050514 Bacteria 886
216 Ga0495601_0225253 3300053077 Bacteria 1225
217 Ga0495601_0327926 3300053077 Unclassified 997
218 Ga0495595_0203475 3300053084 Bacteria 986
219 Ga0500560_001836 3300053107 Bacteria 3845
220 2644261989 2643221647 Bacteria 10741251
221 2676474708 2675903058 Bacteria 6822861
222 2785343797 2784746763 Bacteria 9783172
223 2812351294 2811994878 Bacteria 5992952
224 2827631124 2827628540 Bacteria 6858585
225 2946072794 2946072368 Bacteria 8999607
226 2954693705 2954691527 Bacteria 10720516
227 2954708800 2954701450 Bacteria 10834262
228 2954718041 2954711539 Bacteria 10867210
229 2954728008 2954721474 Bacteria 10456478
230 2954733796 2954731030 Bacteria 10243860
231 2954746905 2954740390 Bacteria 10229294
232 2954752681 2954749733 Bacteria 10366972
233 2954766019 2954759201 Bacteria 9358192
234 3006323872 3006321560 Bacteria 8247479
235 Ga0500583_0248549
236 JGI25404J52841_10012140
237 Ga0070683_100081831
238 Ga0070683_100340546
239 Ga0070680_100393726
240 Ga0070680_101211205
241 Ga0070660_100519280
242 Ga0070660_100931727
243 Ga0070709_10021573
244 Ga0070714_100058711
245 Ga0070714_100109740
246 Ga0070714_100669269
247 Ga0070713_100005199
248 Ga0070710_10014348
249 Ga0070711_100010876
250 Ga0070711_100828524
251 Ga0070705_100456139
252 Ga0070708_100042211
253 Ga0070663_100762990
254 Ga0070681_10042216
255 Ga0070707_100973311
256 Ga0070698_100085390
257 Ga0070698_100488653
258 Ga0070679_100084043
259 Ga0070679_101410241
260 Ga0070684_100052552
261 Ga0070684_101349666
262 Ga0070665_100244865
263 Ga0070664_100799233
264 Ga0068852_100618894
265 Ga0068870_10471346
266 Ga0068863_100593587
267 Ga0081455_10249407
268 Ga0081540_1000520
269 Ga0070717_10102775
270 Ga0075365_10096165
271 Ga0075363_100218101
272 Ga0070715_10294904
273 Ga0070716_100009992
274 Ga0070712_100246760
275 Ga0075370_10807323
276 Ga0105240_10403239
277 Ga0111539_10076240
278 Ga0111539_10339556
279 Ga0111539_11400750
280 Ga0105245_10503693
281 Ga0114129_10089618
282 Ga0114129_10775851
283 Ga0105243_10290599
284 Ga0105241_11026833
285 Ga0105248_10107998
286 Ga0105237_10461933
287 Ga0105239_10265194
288 Ga0105246_10195325
289 Ga0157313_1043291
290 Ga0157369_11672843
291 Ga0157374_10526658
292 Ga0157372_10251932
293 Ga0157375_10059060
294 Ga0157375_10717011
295 Ga0163163_10478944
296 Ga0206354_10323131
297 Ga0207685_10190979
298 Ga0207705_10047296
299 Ga0207684_10532940
300 Ga0207707_10071560
301 Ga0207695_10075230
302 Ga0207693_10107986
303 Ga0207693_10536306
304 Ga0207663_10037366
305 Ga0207657_10093873
306 Ga0207652_10133945
307 Ga0207687_10378486
308 Ga0207700_10193051
309 Ga0207700_10909025
310 Ga0207700_10934225
311 Ga0207664_10155268
312 Ga0207664_10277831
313 Ga0207644_10801878
314 Ga0207711_10388728
315 Ga0207661_10193244
316 Ga0207677_10222194
317 Ga0207678_10169891
318 Ga0207702_10326485
319 Ga0207641_10182995
320 Ga0207648_10187895
321 Ga0207648_10626599
322 Ga0207683_10269719
323 Ga0307515_10000025
324 Ga0307515_10579575
325 Ga0307509_10030507
326 Ga0307508_10032574
327 Ga0307516_10539810
328 Ga0307518_10137135
329 Ga0307518_10201795
330 Ga0307416_101131723
331 Ga0307510_10002306
332 Ga0373930_0056811
333 Ga0373959_0023712
334 Ga0373929_0038260
335 Ga0373934_0000071
336 Ga0373934_0008196
337 Ga0373949_0106500
338 Ga0373953_0000043
339 Ga0373954_0021872
340 Ga0373956_0005361
341 Ga0373957_0000288
342 Ga0373955_0000894
343 Ga0373955_0064426
344 Ga0373924_0064868
345 Ga0373931_0035519
346 Ga0373935_0242170
347 Ga0373933_0000283
348 Ga0373947_0294067
349 Ga0373937_0000560
350 Ga0373937_1616564
351 Ga0373925_0017202
352 Ga0373925_0578254
353 Ga0373925_1158381
354 Ga0451837_0663092
355 Ga0451853_3076958
356 Ga0466965_0007149
357 Ga0466963_0218994
358 Ga0466963_0447244
359 Ga0466970_0009139
360 Ga0466957_0147229
361 Ga0466967_0051863
362 Ga0466967_0231098
363 Ga0466967_0576858
364 Ga0495592_0009192
365 Ga0495629_0031125
366 Ga0495651_0003795
367 Ga0495651_0070176
368 Ga0495653_0035847
369 Ga0495653_0059211
370 Ga0495662_0110638
371 Ga0495664_0101361
372 Ga0495664_0161083
373 Ga0495608_0000310
374 Ga0495608_0003288
375 Ga0495618_0382573
376 Ga0495628_0004569
377 Ga0495628_0011984
378 Ga0495666_0354660
379 Ga0495652_0153412
380 Ga0495640_0039189
381 Ga0495587_0000348
382 Ga0495587_0026908
383 Ga0495587_0239698
384 Ga0495587_0527978
385 Ga0495645_0210992
386 Ga0495667_0001303
387 Ga0495667_0001844
388 Ga0495634_0176151
389 Ga0495625_0089627
390 Ga0495635_0855907
391 Ga0495588_0011341
392 Ga0495657_0002234
393 Ga0495657_0033706
394 Ga0495599_0000267
395 Ga0495599_0133817
396 Ga0495623_0002895
397 Ga0495646_0010328
398 Ga0495646_0087494
399 Ga0495600_0030358
400 Ga0495604_0000550
401 Ga0495604_0061855
402 Ga0495680_0000904
403 Ga0495687_002804
404 Ga0495675_0001504
405 Ga0495675_0075397
406 Ga0495681_0004765
407 Ga0495684_0020912
408 Ga0495686_0157743
409 Ga0495602_0000631
410 Ga0495602_0434479
411 Ga0496100_0431601
412 Ga0496101_0015472
413 Ga0496102_0207943
414 Ga0496102_1060157
415 Ga0496104_0001726
416 Ga0496105_0000625
417 Ga0496106_0775466
418 Ga0496107_0031712
419 Ga0496107_0494357
420 Ga0496107_0914049
421 Ga0496108_0235620
422 Ga0496108_0556013
423 Ga0496109_0008337
424 Ga0496109_0070584
425 Ga0496110_0360810
426 Ga0496110_0545801
427 Ga0496111_0141311
428 Ga0496111_0498148
429 Ga0496112_0484098
430 Ga0496114_0020014
431 Ga0496114_0084056
432 Ga0496115_0001765
433 Ga0496126_1046795
434 Ga0501034_0683000
435 Ga0501042_0123620
436 Ga0501043_0544922
437 Ga0501047_0018903
438 Ga0501070_0248334
439 Ga0501074_0501287
440 Ga0501080_0136239
441 Ga0501035_0231262
442 Ga0501044_0105393
443 nmdc:mga0yw44_470805_c1
444 nmdc:mga09592_30827_c1
445 nmdc:mga0qj67_125462_c1
446 nmdc:mga06r32_183678_c1
447 nmdc:mga08y16_305809_c1
448 nmdc:mga08y16_713350_c1
449 nmdc:mga08x19_469506_c1
450 Ga0495601_0225253
451 Ga0495601_0327926
452 Ga0495595_0203475
453 Ga0500560_001836
454 2644261989
455 2676474708
456 2785343797
457 2812351294
458 2827631124
459 2946072794
460 2954693705
461 2954708800
462 2954718041
463 2954728008
464 2954733796
465 2954746905
466 2954752681
467 2954766019
468 3006323872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

32

154

0.79

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

17

155

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.9094 4 162
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.8988 4 161
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.8757 4 161
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.8743 4 161
1s7k-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) 0.8731 4 162
ID Description Score Start End Superfamily
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8991 4 161 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8895 97 161 3.40.630.30
3igrB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8829 4 162 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8803 1 163 3.40.630.30
1z9uA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8743 4 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1J4NPR6-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9857 1 162 GO:0005737
GO:0008999
AF-A0A1J4NPR6-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9738 1 162 GO:0005737
GO:0008999
AF-A0A401ZN28-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9715 1 162 GO:0005737
GO:0008999
AF-A0A7K2VER8-F1-model_v4 GNAT family N-acetyltransferase 0.9699 2 174 GO:0016747
AF-A0A3G7USU8-F1-model_v4 deleted 0.9382 4 161

Map