F347315

General Info

Members Datasets Scaffolds Average Seq Length
234 157 468 94

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0758480|Ga0436365_0758480_2031_2360
Length 109
Sequence MHPLAGMLARVERAAWWEVRRAQNRKPATYRCPLCGGFLPALSEHMLLVPEGDPSRRRHAHSRCVMAARRAGTLRTRDEWRRANSPEREGARGVPRRLLGRVRRDGPTD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.52
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 12.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0758480 3300039437 Bacteria 2393
2 Ga0070658_11064874 3300005327 Unclassified 703
3 Ga0070690_100102195 3300005330 Bacteria 1902
4 Ga0070670_100223285 3300005331 Bacteria 1639
5 Ga0068868_100002162 3300005338 Bacteria 13565
6 Ga0070660_100009363 3300005339 Bacteria 6883
7 Ga0070691_10050426 3300005341 Bacteria 1986
8 Ga0070661_100668338 3300005344 Bacteria 844
9 Ga0070667_101355940 3300005367 Bacteria 667
10 Ga0070714_100031906 3300005435 Bacteria 4397
11 Ga0070714_100399048 3300005435 Bacteria 1299
12 Ga0070713_100088451 3300005436 Bacteria 2659
13 Ga0070713_101006742 3300005436 Bacteria 804
14 Ga0070705_100151957 3300005440 Bacteria 1537
15 Ga0070705_101888230 3300005440 Bacteria 508
16 Ga0070700_100418780 3300005441 Bacteria 1012
17 Ga0070694_100256589 3300005444 Bacteria 1325
18 Ga0070694_101504112 3300005444 Bacteria 570
19 Ga0070678_100431504 3300005456 Bacteria 1151
20 Ga0070685_11619169 3300005466 Bacteria 501
21 Ga0070684_100215716 3300005535 Bacteria 1750
22 Ga0068853_100040462 3300005539 Bacteria 3977
23 Ga0068853_100885481 3300005539 Bacteria 857
24 Ga0068853_101158957 3300005539 Bacteria 746
25 Ga0070686_101294113 3300005544 Bacteria 609
26 Ga0070695_100076042 3300005545 Bacteria 2211
27 Ga0070695_100351446 3300005545 Unclassified 1104
28 Ga0070693_100275066 3300005547 Bacteria 1125
29 Ga0070664_100433373 3300005564 Bacteria 1205
30 Ga0068854_100027222 3300005578 Bacteria 3938
31 Ga0068856_100035790 3300005614 Bacteria 4866
32 Ga0068856_102090470 3300005614 Bacteria 576
33 Ga0070702_100807002 3300005615 Bacteria 726
34 Ga0068859_100043431 3300005617 Bacteria 4517
35 Ga0068863_101407978 3300005841 Unclassified 705
36 Ga0068858_100021932 3300005842 Bacteria 5963
37 Ga0068860_100548848 3300005843 Bacteria 1158
38 Ga0081455_10116806 3300005937 Bacteria 2109
39 Ga0070717_10000001 3300006028 Bacteria 465573
40 Ga0070717_11496587 3300006028 Unclassified 612
41 Ga0070716_100130952 3300006173 Bacteria 1585
42 Ga0070716_100309487 3300006173 Bacteria 1102
43 Ga0070716_100585283 3300006173 Bacteria 837
44 Ga0075433_10652862 3300006852 Bacteria 922
45 Ga0075434_100000506 3300006871 Bacteria 29511
46 Ga0075434_100113650 3300006871 Bacteria 2720
47 Ga0068865_100080902 3300006881 Bacteria 2332
48 Ga0075436_100093219 3300006914 Bacteria 2094
49 Ga0097620_100043430 3300006931 Bacteria 4517
50 Ga0075435_100132241 3300007076 Bacteria 2088
51 Ga0075435_101368176 3300007076 Bacteria 620
52 Ga0105240_10272009 3300009093 Bacteria 1950
53 Ga0105245_10016610 3300009098 Bacteria 6424
54 Ga0105245_10853011 3300009098 Unclassified 951
55 Ga0105245_10983022 3300009098 Bacteria 888
56 Ga0105245_11519501 3300009098 Bacteria 721
57 Ga0105247_10009741 3300009101 Bacteria 5825
58 Ga0105242_10199858 3300009176 Bacteria 1775
59 Ga0105242_11738590 3300009176 Unclassified 661
60 Ga0105248_10150152 3300009177 Bacteria 2629
61 Ga0105237_10085855 3300009545 Bacteria 3137
62 Ga0105238_10063681 3300009551 Bacteria 3688
63 Ga0105249_10269300 3300009553 Bacteria 1696
64 Ga0105239_10060370 3300010375 Bacteria 4162
65 Ga0105239_10888440 3300010375 Unclassified 1023
66 Ga0105246_10011277 3300011119 Bacteria 5544
67 Ga0157373_10466845 3300013100 Bacteria 910
68 Ga0157370_10512518 3300013104 Bacteria 1101
69 Ga0157369_11323006 3300013105 Bacteria 734
70 Ga0157374_10313004 3300013296 Bacteria 1555
71 Ga0157374_12844843 3300013296 Bacteria 511
72 Ga0157378_10055138 3300013297 Bacteria 3540
73 Ga0163162_10409775 3300013306 Bacteria 1488
74 Ga0163162_12406083 3300013306 Bacteria 605
75 Ga0157372_10028512 3300013307 Bacteria 6093
76 Ga0157372_12570123 3300013307 Unclassified 584
77 Ga0157375_10026879 3300013308 Bacteria 5371
78 Ga0157377_10006143 3300014745 Bacteria 5705
79 Ga0157379_10018982 3300014968 Bacteria 6070
80 Ga0157376_10199365 3300014969 Bacteria 1840
81 Ga0163161_10389961 3300017792 Bacteria 1115
82 Ga0197907_10627796 3300020069 Bacteria 830
83 Ga0213876_10224752 3300021384 Unclassified 998
84 Ga0213876_10528748 3300021384 Unclassified 628
85 Ga0207710_10216452 3300025900 Bacteria 950
86 Ga0207699_10448149 3300025906 Bacteria 925
87 Ga0207643_10936878 3300025908 Bacteria 561
88 Ga0207693_10611710 3300025915 Bacteria 848
89 Ga0207663_11719886 3300025916 Unclassified 504
90 Ga0207657_10347883 3300025919 Unclassified 1169
91 Ga0207652_10384448 3300025921 Bacteria 1267
92 Ga0207687_10440378 3300025927 Bacteria 1079
93 Ga0207687_10711153 3300025927 Bacteria 853
94 Ga0207700_10143056 3300025928 Bacteria 1967
95 Ga0207664_10084043 3300025929 Bacteria 2596
96 Ga0207664_10126085 3300025929 Bacteria 2149
97 Ga0207664_10201242 3300025929 Bacteria 1719
98 Ga0207664_10392081 3300025929 Bacteria 1234
99 Ga0207706_10488128 3300025933 Bacteria 1064
100 Ga0207686_10112621 3300025934 Bacteria 1838
101 Ga0207665_10078090 3300025939 Bacteria 2273
102 Ga0207665_10081694 3300025939 Bacteria 2226
103 Ga0207679_11947148 3300025945 Bacteria 535
104 Ga0207703_10028528 3300026035 Bacteria 4400
105 Ga0207639_10679789 3300026041 Bacteria 954
106 Ga0207678_10749255 3300026067 Bacteria 861
107 Ga0207708_10609706 3300026075 Bacteria 925
108 Ga0207702_10002365 3300026078 Bacteria 18011
109 Ga0207641_10082537 3300026088 Bacteria 2793
110 Ga0207641_12049129 3300026088 Unclassified 573
111 Ga0207683_10323499 3300026121 Bacteria 1413
112 Ga0373960_0032969 3300035121 Bacteria 1458
113 Ga0373925_1311392 3300037068 Bacteria 594
114 Ga0395900_0095366 3300037418 Bacteria 3057
115 Ga0395898_0573588 3300037466 Bacteria 1071
116 Ga0395898_0818097 3300037466 Bacteria 871
117 Ga0436364_1535977 3300037853 Bacteria 553
118 Ga0436365_0360893 3300039437 Bacteria 954
119 Ga0436365_0450190 3300039437 Bacteria 690
120 Ga0436360_0543654 3300039438 Bacteria 1072
121 Ga0436363_0119005 3300039450 Bacteria 1561
122 Ga0436363_1186637 3300039450 Bacteria 574
123 Ga0436362_0399377 3300039453 Bacteria 1364
124 Ga0466969_0408529 3300044656 Unclassified 616
125 Ga0466961_0065505 3300044693 Bacteria 2309
126 Ga0466963_0073424 3300044694 Bacteria 2306
127 Ga0466963_0240586 3300044694 Bacteria 1269
128 Ga0466963_0594864 3300044694 Bacteria 781
129 Ga0466964_0706208 3300044706 Unclassified 562
130 Ga0466971_0231791 3300044719 Bacteria 877
131 Ga0466971_0431829 3300044719 Bacteria 644
132 Ga0466968_0010009 3300044735 Bacteria 3663
133 Ga0466968_0467475 3300044735 Unclassified 625
134 Ga0466970_0540671 3300044765 Bacteria 673
135 Ga0466957_0294627 3300044842 Bacteria 1089
136 Ga0466957_0610111 3300044842 Bacteria 764
137 Ga0466959_0036950 3300045049 Bacteria 3608
138 Ga0466959_0039281 3300045049 Bacteria 3497
139 Ga0466959_0057815 3300045049 Bacteria 2826
140 Ga0466959_0844197 3300045049 Bacteria 612
141 Ga0466958_0073035 3300045836 Bacteria 2101
142 Ga0466958_0107025 3300045836 Bacteria 1744
143 Ga0466967_0017532 3300045976 Bacteria 5690
144 Ga0466967_0682287 3300045976 Bacteria 1017
145 Ga0495592_0254638 3300046454 Bacteria 1159
146 Ga0495603_0000411 3300046455 Bacteria 23687
147 Ga0495629_0423018 3300046459 Bacteria 904
148 Ga0495641_0097005 3300046461 Bacteria 1316
149 Ga0495641_0485162 3300046461 Bacteria 563
150 Ga0495651_0003527 3300046462 Bacteria 11990
151 Ga0495653_0120573 3300046463 Bacteria 1870
152 Ga0495653_0563873 3300046463 Unclassified 703
153 Ga0495582_0167251 3300046473 Bacteria 1251
154 Ga0495662_0019554 3300046476 Bacteria 3277
155 Ga0495664_0219318 3300046477 Bacteria 1151
156 Ga0495664_0291920 3300046477 Bacteria 985
157 Ga0495664_0437469 3300046477 Bacteria 784
158 Ga0495664_0484029 3300046477 Bacteria 740
159 Ga0495608_0130497 3300046511 Bacteria 1608
160 Ga0495628_0036998 3300046516 Bacteria 3914
161 Ga0495628_0457905 3300046516 Unclassified 926
162 Ga0495630_0019766 3300046517 Bacteria 4955
163 Ga0495666_0139244 3300046526 Bacteria 1132
164 Ga0495652_0133763 3300046529 Bacteria 1959
165 Ga0495652_0168833 3300046529 Bacteria 1691
166 Ga0495586_0314112 3300046535 Bacteria 898
167 Ga0495587_0132950 3300046536 Bacteria 1422
168 Ga0495667_0016276 3300046559 Bacteria 5023
169 Ga0495634_0103550 3300046642 Bacteria 1837
170 Ga0495657_0103897 3300046675 Bacteria 1807
171 Ga0495624_0353467 3300046690 Bacteria 884
172 Ga0495600_0083550 3300046809 Bacteria 2084
173 Ga0495604_0058890 3300047317 Bacteria 2948
174 Ga0495674_0011524 3300047319 Bacteria 8343
175 Ga0495674_1060616 3300047319 Bacteria 618
176 Ga0495676_0193635 3300047321 Bacteria 1417
177 Ga0495680_0163364 3300047322 Bacteria 1615
178 Ga0495675_0615910 3300047444 Bacteria 614
179 Ga0495684_0043311 3300047471 Unclassified 3446
180 Ga0495684_0168801 3300047471 Bacteria 1628
181 Ga0495614_0173551 3300048089 Unclassified 968
182 Ga0496100_0065260 3300048903 Bacteria 2411
183 Ga0496101_0008900 3300048904 Bacteria 6576
184 Ga0496101_0013422 3300048904 Bacteria 5487
185 Ga0496101_0126134 3300048904 Bacteria 1939
186 Ga0496101_1326058 3300048904 Bacteria 562
187 Ga0496102_0020022 3300048905 Bacteria 5904
188 Ga0496102_0646842 3300048905 Bacteria 980
189 Ga0496103_0005795 3300048906 Bacteria 7377
190 Ga0496103_0110591 3300048906 Bacteria 1745
191 Ga0496103_0633355 3300048906 Unclassified 680
192 Ga0496104_0203514 3300048907 Bacteria 1891
193 Ga0496104_0572230 3300048907 Unclassified 1040
194 Ga0496104_1029949 3300048907 Bacteria 727
195 Ga0496105_0007751 3300048908 Bacteria 8330
196 Ga0496105_0850843 3300048908 Bacteria 690
197 Ga0496106_0004253 3300048909 Bacteria 10656
198 Ga0496106_0005277 3300048909 Bacteria 9573
199 Ga0496107_0003586 3300048910 Bacteria 10405
200 Ga0496107_0014256 3300048910 Bacteria 5565
201 Ga0496107_0261701 3300048910 Bacteria 1287
202 Ga0496107_0581909 3300048910 Unclassified 828
203 Ga0496108_0100454 3300048911 Bacteria 2467
204 Ga0496108_0280142 3300048911 Unclassified 1452
205 Ga0496109_0035993 3300048912 Bacteria 4468
206 Ga0496110_0000410 3300048913 Bacteria 29170
207 Ga0496110_1310765 3300048913 Bacteria 633
208 Ga0496111_0002802 3300048914 Bacteria 10623
209 Ga0496111_0443186 3300048914 Bacteria 958
210 Ga0496112_0062280 3300048915 Bacteria 3679
211 Ga0496112_0629489 3300048915 Unclassified 1003
212 Ga0496112_1151423 3300048915 Bacteria 693
213 Ga0496113_0119700 3300048916 Bacteria 2057
214 Ga0496113_0136910 3300048916 Unclassified 1924
215 Ga0496113_0845797 3300048916 Unclassified 725
216 Ga0496114_0037876 3300048917 Bacteria 3989
217 Ga0496114_0391306 3300048917 Unclassified 1231
218 Ga0496114_1267247 3300048917 Bacteria 624
219 Ga0496115_0043784 3300048918 Bacteria 3569
220 Ga0496115_0125000 3300048918 Bacteria 2118
221 Ga0496115_0418657 3300048918 Bacteria 1085
222 Ga0496115_0568478 3300048918 Unclassified 904
223 Ga0501067_0000043 3300049583 Bacteria 75533
224 Ga0501068_0000353 3300049584 Bacteria 23073
225 Ga0501069_0000460 3300049585 Bacteria 18662
226 Ga0501081_0196447 3300049743 Bacteria 1462
227 nmdc:mga0n895_8893_c1 3300050512 Bacteria 8748
228 nmdc:mga0rr50_148029_c1 3300050513 Bacteria 1895
229 nmdc:mga0rr50_1700200_c1 3300050513 Unclassified 532
230 nmdc:mga08x19_85965_c1 3300050514 Bacteria 2070
231 nmdc:mga0a205_193643_c1 3300050515 Bacteria 1924
232 Ga0495601_0167075 3300053077 Bacteria 1438
233 Ga0495619_0075688 3300053085 Bacteria 2259
234 Ga0530510_0040989 3300061734 Bacteria 3343
235 Ga0436365_0758480
236 Ga0070658_11064874
237 Ga0070690_100102195
238 Ga0070670_100223285
239 Ga0068868_100002162
240 Ga0070660_100009363
241 Ga0070691_10050426
242 Ga0070661_100668338
243 Ga0070667_101355940
244 Ga0070714_100031906
245 Ga0070714_100399048
246 Ga0070713_100088451
247 Ga0070713_101006742
248 Ga0070705_100151957
249 Ga0070705_101888230
250 Ga0070700_100418780
251 Ga0070694_100256589
252 Ga0070694_101504112
253 Ga0070678_100431504
254 Ga0070685_11619169
255 Ga0070684_100215716
256 Ga0068853_100040462
257 Ga0068853_100885481
258 Ga0068853_101158957
259 Ga0070686_101294113
260 Ga0070695_100076042
261 Ga0070695_100351446
262 Ga0070693_100275066
263 Ga0070664_100433373
264 Ga0068854_100027222
265 Ga0068856_100035790
266 Ga0068856_102090470
267 Ga0070702_100807002
268 Ga0068859_100043431
269 Ga0068863_101407978
270 Ga0068858_100021932
271 Ga0068860_100548848
272 Ga0081455_10116806
273 Ga0070717_10000001
274 Ga0070717_11496587
275 Ga0070716_100130952
276 Ga0070716_100309487
277 Ga0070716_100585283
278 Ga0075433_10652862
279 Ga0075434_100000506
280 Ga0075434_100113650
281 Ga0068865_100080902
282 Ga0075436_100093219
283 Ga0097620_100043430
284 Ga0075435_100132241
285 Ga0075435_101368176
286 Ga0105240_10272009
287 Ga0105245_10016610
288 Ga0105245_10853011
289 Ga0105245_10983022
290 Ga0105245_11519501
291 Ga0105247_10009741
292 Ga0105242_10199858
293 Ga0105242_11738590
294 Ga0105248_10150152
295 Ga0105237_10085855
296 Ga0105238_10063681
297 Ga0105249_10269300
298 Ga0105239_10060370
299 Ga0105239_10888440
300 Ga0105246_10011277
301 Ga0157373_10466845
302 Ga0157370_10512518
303 Ga0157369_11323006
304 Ga0157374_10313004
305 Ga0157374_12844843
306 Ga0157378_10055138
307 Ga0163162_10409775
308 Ga0163162_12406083
309 Ga0157372_10028512
310 Ga0157372_12570123
311 Ga0157375_10026879
312 Ga0157377_10006143
313 Ga0157379_10018982
314 Ga0157376_10199365
315 Ga0163161_10389961
316 Ga0197907_10627796
317 Ga0213876_10224752
318 Ga0213876_10528748
319 Ga0207710_10216452
320 Ga0207699_10448149
321 Ga0207643_10936878
322 Ga0207693_10611710
323 Ga0207663_11719886
324 Ga0207657_10347883
325 Ga0207652_10384448
326 Ga0207687_10440378
327 Ga0207687_10711153
328 Ga0207700_10143056
329 Ga0207664_10084043
330 Ga0207664_10126085
331 Ga0207664_10201242
332 Ga0207664_10392081
333 Ga0207706_10488128
334 Ga0207686_10112621
335 Ga0207665_10078090
336 Ga0207665_10081694
337 Ga0207679_11947148
338 Ga0207703_10028528
339 Ga0207639_10679789
340 Ga0207678_10749255
341 Ga0207708_10609706
342 Ga0207702_10002365
343 Ga0207641_10082537
344 Ga0207641_12049129
345 Ga0207683_10323499
346 Ga0373960_0032969
347 Ga0373925_1311392
348 Ga0395900_0095366
349 Ga0395898_0573588
350 Ga0395898_0818097
351 Ga0436364_1535977
352 Ga0436365_0360893
353 Ga0436365_0450190
354 Ga0436360_0543654
355 Ga0436363_0119005
356 Ga0436363_1186637
357 Ga0436362_0399377
358 Ga0466969_0408529
359 Ga0466961_0065505
360 Ga0466963_0073424
361 Ga0466963_0240586
362 Ga0466963_0594864
363 Ga0466964_0706208
364 Ga0466971_0231791
365 Ga0466971_0431829
366 Ga0466968_0010009
367 Ga0466968_0467475
368 Ga0466970_0540671
369 Ga0466957_0294627
370 Ga0466957_0610111
371 Ga0466959_0036950
372 Ga0466959_0039281
373 Ga0466959_0057815
374 Ga0466959_0844197
375 Ga0466958_0073035
376 Ga0466958_0107025
377 Ga0466967_0017532
378 Ga0466967_0682287
379 Ga0495592_0254638
380 Ga0495603_0000411
381 Ga0495629_0423018
382 Ga0495641_0097005
383 Ga0495641_0485162
384 Ga0495651_0003527
385 Ga0495653_0120573
386 Ga0495653_0563873
387 Ga0495582_0167251
388 Ga0495662_0019554
389 Ga0495664_0219318
390 Ga0495664_0291920
391 Ga0495664_0437469
392 Ga0495664_0484029
393 Ga0495608_0130497
394 Ga0495628_0036998
395 Ga0495628_0457905
396 Ga0495630_0019766
397 Ga0495666_0139244
398 Ga0495652_0133763
399 Ga0495652_0168833
400 Ga0495586_0314112
401 Ga0495587_0132950
402 Ga0495667_0016276
403 Ga0495634_0103550
404 Ga0495657_0103897
405 Ga0495624_0353467
406 Ga0495600_0083550
407 Ga0495604_0058890
408 Ga0495674_0011524
409 Ga0495674_1060616
410 Ga0495676_0193635
411 Ga0495680_0163364
412 Ga0495675_0615910
413 Ga0495684_0043311
414 Ga0495684_0168801
415 Ga0495614_0173551
416 Ga0496100_0065260
417 Ga0496101_0008900
418 Ga0496101_0013422
419 Ga0496101_0126134
420 Ga0496101_1326058
421 Ga0496102_0020022
422 Ga0496102_0646842
423 Ga0496103_0005795
424 Ga0496103_0110591
425 Ga0496103_0633355
426 Ga0496104_0203514
427 Ga0496104_0572230
428 Ga0496104_1029949
429 Ga0496105_0007751
430 Ga0496105_0850843
431 Ga0496106_0004253
432 Ga0496106_0005277
433 Ga0496107_0003586
434 Ga0496107_0014256
435 Ga0496107_0261701
436 Ga0496107_0581909
437 Ga0496108_0100454
438 Ga0496108_0280142
439 Ga0496109_0035993
440 Ga0496110_0000410
441 Ga0496110_1310765
442 Ga0496111_0002802
443 Ga0496111_0443186
444 Ga0496112_0062280
445 Ga0496112_0629489
446 Ga0496112_1151423
447 Ga0496113_0119700
448 Ga0496113_0136910
449 Ga0496113_0845797
450 Ga0496114_0037876
451 Ga0496114_0391306
452 Ga0496114_1267247
453 Ga0496115_0043784
454 Ga0496115_0125000
455 Ga0496115_0418657
456 Ga0496115_0568478
457 Ga0501067_0000043
458 Ga0501068_0000353
459 Ga0501069_0000460
460 Ga0501081_0196447
461 nmdc:mga0n895_8893_c1
462 nmdc:mga0rr50_148029_c1
463 nmdc:mga0rr50_1700200_c1
464 nmdc:mga08x19_85965_c1
465 nmdc:mga0a205_193643_c1
466 Ga0495601_0167075
467 Ga0495619_0075688
468 Ga0530510_0040989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yxy-assembly1.cif.gz_EG state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.6776 10 65
6crf-assembly1.cif.gz_A crystal structure of shp2 e76k gof mutant in the open conformation 0.5924 10 53
4gry-assembly1.cif.gz_A crystal structure of shp1 catalytic domain with so4 0.5923 10 53
4hjp-assembly1.cif.gz_A shp-1 catalytic domain wpd loop open 0.5883 10 53
5bk8-assembly1.cif.gz_A cancer-associated shp2/t507k mutant 0.58 10 53
ID Description Score Start End Superfamily
af_A0A1P8B397_201_546_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6865 17 57 3.30.40.10
af_Q21275_7_107_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6846 12 60 3.30.1740.10
af_Q6Z584_4_114_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6808 11 60 3.30.40.10
af_Q84X54_432_632_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6666 17 58 3.30.40.10
af_Q9STF5_554_604_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6547 10 57 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A2W6BSN5-F1-model_v4 HNH endonuclease 0.9837 8 88
AF-A0A5B8U487-F1-model_v4 HNH endonuclease 0.9713 1 87
AF-A0A538EDF4-F1-model_v4 DUF448 domain-containing protein 0.971 5 93
AF-A0A538FZ84-F1-model_v4 Uncharacterized protein 0.9544 4 91
AF-A0A537W5S5-F1-model_v4 Uncharacterized protein 0.9525 4 79

Map