F347306

General Info

Members Datasets Scaffolds Average Seq Length
234 162 469 121

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0199662|Ga0436364_0199662_937_1359
Length 140
Sequence VAGLSNEQLATEPKGGKTTMTQQKTGFDFEALRRGVEQLDADVLISLYADDAELRIVNRYTTPSSPRELRGKEEITEYLRDVCGRAMTHRIENEVVGAERVAFNEACKYPDGTRVLCAATLEVREGKISRQVNVEAWDEQ

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
14 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
15 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
16 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
19 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
20 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
21 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
26 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
31 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
32 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
33 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
34 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
35 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
36 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
37 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
42 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
138 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
139 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
140 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
141 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
142 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
143 2808606448 Streptomyces sp. 193411 Isolate Unclassified
144 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
145 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
146 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
147 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
148 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
149 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
150 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
151 2867428634 Streptomyces sp. RP5T Isolate Unclassified
152 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
153 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
154 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
155 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
156 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
157 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
158 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
159 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
160 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
161 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
162 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.18
Metatranscriptomes 2.14
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0.85
Rhizoplane 3.42
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0199662 3300037853 Bacteria 1681
2 Ga0006777J48905_1069166 3300003308 Bacteria 609
3 rootH1_10005029 3300003316 Bacteria 23039
4 rootH1_10016338 3300003316 Bacteria 1598
5 rootH1_10016338 3300003323 Unclassified 4934
6 rootL2_10054571 3300003322 Bacteria 2861
7 rootL2_10185719 3300003322 Bacteria 1207
8 rootH1_10038652 3300003323 Bacteria 3429
9 rootH1_10108163 3300003323 Bacteria 1880
10 Ga0007427J51700_104909 3300003559 Bacteria 1469
11 Ga0007429J51699_1029732 3300003579 Bacteria 925
12 Ga0075363_100041780 3300006048 Bacteria 2419
13 Ga0075363_100198116 3300006048 Bacteria 1147
14 Ga0075370_10903484 3300006353 Bacteria 540
15 Ga0105250_10276231 3300009092 Bacteria 722
16 Ga0157375_11564574 3300013308 Unclassified 779
17 Ga0183367_1004 3300015688 Bacteria 716880
18 Ga0206350_11626542 3300020080 Bacteria 504
19 Ga0213875_10011281 3300021388 Bacteria 4451
20 Ga0213875_10299399 3300021388 Unclassified 761
21 Ga0307515_10152684 3300028794 Bacteria 2404
22 Ga0307511_10055606 3300030521 Bacteria 3105
23 Ga0307512_10051724 3300030522 Bacteria 3283
24 Ga0316180_1184525 3300030736 Unclassified 508
25 Ga0307513_10953358 3300031456 Bacteria 566
26 Ga0307408_101728139 3300031548 Bacteria 597
27 Ga0307408_101728492 3300031548 Bacteria 597
28 Ga0307508_10102841 3300031616 Bacteria 2453
29 Ga0307514_10038801 3300031649 Bacteria 3764
30 Ga0307514_10196386 3300031649 Bacteria 1276
31 Ga0307409_100734544 3300031995 Bacteria 990
32 Ga0307409_101427637 3300031995 Bacteria 719
33 Ga0307416_102669298 3300032002 Unclassified 596
34 Ga0307415_100302592 3300032126 Bacteria 1325
35 Ga0373937_1149459 3300036401 Bacteria 725
36 Ga0395900_0544348 3300037418 Bacteria 1106
37 Ga0395898_0001353 3300037466 Bacteria 35343
38 Ga0395905_0382845 3300037471 Bacteria 1301
39 Ga0436364_0178471 3300037853 Unclassified 2400
40 Ga0436364_1371666 3300037853 Bacteria 1155
41 Ga0436364_1457976 3300037853 Bacteria 36311
42 Ga0439436_0003385 3300041404 Bacteria 4835
43 Ga0439439_0008356 3300041406 Bacteria 2444
44 Ga0451791_0839871 3300041451 Bacteria 1088
45 Ga0451797_1343887 3300041453 Bacteria 1258
46 Ga0451802_0675412 3300041460 Bacteria 1136
47 Ga0451843_0843053 3300041509 Bacteria 1138
48 Ga0451853_0762338 3300041512 Bacteria 3638
49 Ga0451853_1767468 3300041512 Bacteria 2668
50 Ga0451853_3726170 3300041512 Bacteria 2656
51 Ga0439442_014681 3300042002 Bacteria 1613
52 Ga0439442_055185 3300042002 Bacteria 840
53 Ga0439449_0024796 3300042007 Bacteria 2242
54 Ga0439449_0035582 3300042007 Bacteria 1853
55 Ga0439449_0068539 3300042007 Bacteria 1308
56 Ga0439457_006648 3300042014 Bacteria 2814
57 Ga0439457_120238 3300042014 Bacteria 620
58 Ga0450894_000536 3300042131 Bacteria 6430
59 Ga0450895_005925 3300042132 Bacteria 991
60 Ga0450898_000362 3300042134 Bacteria 5197
61 Ga0450899_013451 3300042135 Bacteria 924
62 Ga0439458_0018768 3300042157 Bacteria 1587
63 Ga0450908_001788 3300042184 Bacteria 4195
64 Ga0466972_0034725 3300044658 Bacteria 2469
65 Ga0466972_0317373 3300044658 Bacteria 728
66 Ga0466963_0612344 3300044694 Bacteria 769
67 Ga0466971_0028261 3300044719 Bacteria 2510
68 Ga0466959_0982384 3300045049 Unclassified 562
69 Ga0466958_0716446 3300045836 Bacteria 652
70 Ga0466967_0165663 3300045976 Bacteria 2077
71 Ga0466967_2227487 3300045976 Bacteria 544
72 Ga0495617_059224 3300046452 Bacteria 1268
73 Ga0495592_0009684 3300046454 Bacteria 7253
74 Ga0495603_0015772 3300046455 Bacteria 4568
75 Ga0495603_0023558 3300046455 Bacteria 3723
76 Ga0495603_0027211 3300046455 Bacteria 3452
77 Ga0495590_0118128 3300046457 Bacteria 949
78 Ga0495629_0017892 3300046459 Bacteria 5079
79 Ga0495629_0104536 3300046459 Bacteria 1975
80 Ga0495629_0122255 3300046459 Bacteria 1813
81 Ga0495638_0098281 3300046460 Bacteria 1754
82 Ga0495638_0275158 3300046460 Bacteria 917
83 Ga0495651_0032841 3300046462 Bacteria 4048
84 Ga0495580_0047003 3300046472 Bacteria 3061
85 Ga0495582_0084637 3300046473 Bacteria 1763
86 Ga0495605_0002415 3300046474 Bacteria 11546
87 Ga0495605_0050614 3300046474 Bacteria 2026
88 Ga0495639_0004345 3300046475 Bacteria 6079
89 Ga0495639_0707493 3300046475 Bacteria 520
90 Ga0495662_0003724 3300046476 Bacteria 7679
91 Ga0495662_0046934 3300046476 Bacteria 2085
92 Ga0495662_0163897 3300046476 Bacteria 1095
93 Ga0495585_0147533 3300046492 Bacteria 1228
94 Ga0495594_0042016 3300046499 Bacteria 2503
95 Ga0495594_0050142 3300046499 Bacteria 2295
96 Ga0495596_0079242 3300046500 Bacteria 1275
97 Ga0495607_0030528 3300046501 Bacteria 3307
98 Ga0495583_0039117 3300046506 Bacteria 2236
99 Ga0495583_0042243 3300046506 Bacteria 2130
100 Ga0495583_0079009 3300046506 Bacteria 1432
101 Ga0495606_0019299 3300046507 Bacteria 5077
102 Ga0495608_0283720 3300046511 Bacteria 1027
103 Ga0495610_0060146 3300046512 Bacteria 1810
104 Ga0495616_0005693 3300046513 Bacteria 7634
105 Ga0495618_0105712 3300046514 Bacteria 1802
106 Ga0495620_0006602 3300046515 Bacteria 6361
107 Ga0495620_0039702 3300046515 Bacteria 2077
108 Ga0495630_0066728 3300046517 Bacteria 2705
109 Ga0495630_0688739 3300046517 Bacteria 782
110 Ga0495630_1401397 3300046517 Unclassified 526
111 Ga0495637_0160312 3300046520 Bacteria 844
112 Ga0495643_0001303 3300046522 Bacteria 23710
113 Ga0495644_0209539 3300046523 Bacteria 752
114 Ga0495648_0098210 3300046524 Bacteria 1622
115 Ga0495648_0479746 3300046524 Bacteria 537
116 Ga0495666_0040781 3300046526 Bacteria 2250
117 Ga0495642_0191293 3300046528 Bacteria 891
118 Ga0495652_0082223 3300046529 Bacteria 2655
119 Ga0495654_0381213 3300046530 Bacteria 562
120 Ga0495640_0045627 3300046533 Bacteria 3040
121 Ga0495609_0124816 3300046538 Bacteria 1105
122 Ga0495597_0011458 3300046542 Bacteria 4298
123 Ga0495597_0041398 3300046542 Bacteria 2058
124 Ga0495622_0011638 3300046557 Bacteria 4066
125 Ga0495633_0118288 3300046558 Bacteria 1227
126 Ga0495667_0144760 3300046559 Bacteria 1531
127 Ga0495656_0424490 3300046615 Bacteria 698
128 Ga0495668_0010603 3300046616 Bacteria 5567
129 Ga0495634_0852105 3300046642 Bacteria 517
130 Ga0495611_0246488 3300046648 Bacteria 828
131 Ga0495611_0333095 3300046648 Bacteria 697
132 Ga0495625_0028367 3300046660 Bacteria 4198
133 Ga0495625_0042284 3300046660 Bacteria 3313
134 Ga0495625_0059250 3300046660 Bacteria 2717
135 Ga0495625_0083704 3300046660 Bacteria 2217
136 Ga0495635_0120516 3300046663 Bacteria 1789
137 Ga0495661_0060976 3300046665 Bacteria 2240
138 Ga0495588_0003126 3300046674 Bacteria 7161
139 Ga0495657_0038961 3300046675 Bacteria 3267
140 Ga0495657_0045547 3300046675 Bacteria 2976
141 Ga0495599_0178688 3300046678 Bacteria 1309
142 Ga0495613_0005827 3300046689 Bacteria 9223
143 Ga0495613_0011309 3300046689 Bacteria 6629
144 Ga0495613_0040041 3300046689 Bacteria 3473
145 Ga0495613_0040895 3300046689 Bacteria 3433
146 Ga0495670_0229958 3300046691 Bacteria 986
147 Ga0495649_0160541 3300046694 Bacteria 1178
148 Ga0495649_0299744 3300046694 Bacteria 818
149 Ga0495589_0013197 3300046794 Bacteria 4264
150 Ga0495589_0078007 3300046794 Bacteria 1613
151 Ga0495589_0131234 3300046794 Bacteria 1203
152 Ga0495589_0143528 3300046794 Bacteria 1142
153 Ga0495589_0210176 3300046794 Bacteria 916
154 Ga0495600_0203733 3300046809 Bacteria 1270
155 Ga0495660_0040641 3300046810 Bacteria 2576
156 Ga0495660_0058701 3300046810 Bacteria 2071
157 Ga0495581_0023796 3300047315 Bacteria 3549
158 Ga0495581_0061513 3300047315 Bacteria 2170
159 Ga0495581_0062980 3300047315 Bacteria 2143
160 Ga0495604_0055902 3300047317 Bacteria 3040
161 Ga0495636_0000910 3300047318 Bacteria 11010
162 Ga0495636_0001271 3300047318 Bacteria 9563
163 Ga0495636_0006511 3300047318 Bacteria 4592
164 Ga0495636_0027122 3300047318 Bacteria 2333
165 Ga0495636_0169925 3300047318 Bacteria 985
166 Ga0495672_0230864 3300047320 Bacteria 908
167 Ga0495676_0033424 3300047321 Bacteria 4331
168 Ga0495680_0014939 3300047322 Bacteria 6709
169 Ga0495687_001922 3300047443 Bacteria 17816
170 Ga0495687_024764 3300047443 Bacteria 2847
171 Ga0495687_045097 3300047443 Bacteria 1911
172 Ga0495687_045742 3300047443 Bacteria 1893
173 Ga0495675_0021718 3300047444 Bacteria 4089
174 Ga0495675_0080410 3300047444 Bacteria 2053
175 Ga0495675_0364204 3300047444 Bacteria 848
176 Ga0495677_0048589 3300047445 Bacteria 1559
177 Ga0495685_000851 3300047447 Bacteria 9285
178 Ga0495685_022196 3300047447 Bacteria 2184
179 Ga0495685_024984 3300047447 Bacteria 2056
180 Ga0495685_055884 3300047447 Bacteria 1335
181 Ga0495685_060780 3300047447 Bacteria 1273
182 Ga0495685_133544 3300047447 Bacteria 811
183 Ga0495681_0029091 3300047470 Bacteria 2833
184 Ga0495686_0096830 3300047472 Bacteria 1785
185 Ga0495686_0099314 3300047472 Bacteria 1757
186 Ga0495593_0027409 3300047673 Bacteria 3137
187 Ga0495602_0070118 3300048088 Bacteria 3002
188 Ga0495614_0527273 3300048089 Bacteria 563
189 Ga0495626_0023817 3300048091 Bacteria 3009
190 Ga0496102_1225951 3300048905 Bacteria 670
191 Ga0496106_0431611 3300048909 Bacteria 1059
192 Ga0496108_0840532 3300048911 Bacteria 790
193 Ga0496109_0934110 3300048912 Bacteria 805
194 Ga0496109_1097236 3300048912 Bacteria 733
195 Ga0496121_0875564 3300048924 Bacteria 519
196 Ga0501305_075416 3300049161 Bacteria 599
197 Ga0495678_038331 3300049459 Bacteria 1940
198 Ga0495678_145318 3300049459 Bacteria 771
199 Ga0501033_0096072 3300049570 Bacteria 2165
200 Ga0501034_0041532 3300049571 Bacteria 4654
201 Ga0501070_0235937 3300049586 Bacteria 1498
202 Ga0501070_1513937 3300049586 Bacteria 507
203 Ga0501035_0073508 3300049822 Bacteria 3025
204 Ga0501035_0083140 3300049822 Bacteria 2825
205 Ga0501212_024692 3300049851 Bacteria 947
206 nmdc:mga03n38_32957_c1 3300050490 Bacteria 2200
207 nmdc:mga03n38_80909_c1 3300050490 Bacteria 1526
208 nmdc:mga0yw44_663436_c1 3300050492 Bacteria 709
209 nmdc:mga07m45_83966_c1 3300050496 Bacteria 1820
210 Ga0500600_0160294 3300053149 Bacteria 1107
211 2547409364 2547132111 Bacteria 8013147
212 2585312590 2582581314 Bacteria 11452267
213 2616696426 2616644814 Bacteria 11555299
214 2784592331 2784132148 Bacteria 8627943
215 2785374050 2784746768 Bacteria 10036182
216 2809235961 2808606448 Bacteria 8656184
217 2812353834 2811994879 Bacteria 9313447
218 2812483095 2811994917 Bacteria 7761064
219 2852639034 2852635781 Bacteria 8251373
220 2862283799 2862281513 Bacteria 9621493
221 2862387451 2862382967 Bacteria 10317375
222 2862515873 2862507626 Bacteria 9425308
223 2863410711 2863404153 Bacteria 9672205
224 2867434807 2867428634 Bacteria 9590268
225 2877677229 2877676314 Bacteria 9512378
226 2912715558 2912715099 Bacteria 9460473
227 2946071861 2946064051 Bacteria 8957905
228 2947232742 2947224130 Bacteria 9938529
229 2954009236 2954002825 Bacteria 9173742
230 2990066805 2990059506 Bacteria 9321252
231 3006499201 3006493962 Bacteria 8825450
232 8008564747 8008558824 Bacteria 10610750
233 8008575484 8008574985 Bacteria 7815457
234 8023626614 8023623736 Bacteria 8593882
235 8056834828 8056829672 Bacteria 9045328
236 Ga0436364_0199662
237 Ga0006777J48905_1069166
238 rootH1_10005029
239 rootH1_10016338
240 rootL2_10054571
241 rootL2_10185719
242 rootH1_10038652
243 rootH1_10108163
244 Ga0007427J51700_104909
245 Ga0007429J51699_1029732
246 Ga0075363_100041780
247 Ga0075363_100198116
248 Ga0075370_10903484
249 Ga0105250_10276231
250 Ga0157375_11564574
251 Ga0183367_1004
252 Ga0206350_11626542
253 Ga0213875_10011281
254 Ga0213875_10299399
255 Ga0307515_10152684
256 Ga0307511_10055606
257 Ga0307512_10051724
258 Ga0316180_1184525
259 Ga0307513_10953358
260 Ga0307408_101728139
261 Ga0307408_101728492
262 Ga0307508_10102841
263 Ga0307514_10038801
264 Ga0307514_10196386
265 Ga0307409_100734544
266 Ga0307409_101427637
267 Ga0307416_102669298
268 Ga0307415_100302592
269 Ga0373937_1149459
270 Ga0395900_0544348
271 Ga0395898_0001353
272 Ga0395905_0382845
273 Ga0436364_0178471
274 Ga0436364_1371666
275 Ga0436364_1457976
276 Ga0439436_0003385
277 Ga0439439_0008356
278 Ga0451791_0839871
279 Ga0451797_1343887
280 Ga0451802_0675412
281 Ga0451843_0843053
282 Ga0451853_0762338
283 Ga0451853_1767468
284 Ga0451853_3726170
285 Ga0439442_014681
286 Ga0439442_055185
287 Ga0439449_0024796
288 Ga0439449_0035582
289 Ga0439449_0068539
290 Ga0439457_006648
291 Ga0439457_120238
292 Ga0450894_000536
293 Ga0450895_005925
294 Ga0450898_000362
295 Ga0450899_013451
296 Ga0439458_0018768
297 Ga0450908_001788
298 Ga0466972_0034725
299 Ga0466972_0317373
300 Ga0466963_0612344
301 Ga0466971_0028261
302 Ga0466959_0982384
303 Ga0466958_0716446
304 Ga0466967_0165663
305 Ga0466967_2227487
306 Ga0495617_059224
307 Ga0495592_0009684
308 Ga0495603_0015772
309 Ga0495603_0023558
310 Ga0495603_0027211
311 Ga0495590_0118128
312 Ga0495629_0017892
313 Ga0495629_0104536
314 Ga0495629_0122255
315 Ga0495638_0098281
316 Ga0495638_0275158
317 Ga0495651_0032841
318 Ga0495580_0047003
319 Ga0495582_0084637
320 Ga0495605_0002415
321 Ga0495605_0050614
322 Ga0495639_0004345
323 Ga0495639_0707493
324 Ga0495662_0003724
325 Ga0495662_0046934
326 Ga0495662_0163897
327 Ga0495585_0147533
328 Ga0495594_0042016
329 Ga0495594_0050142
330 Ga0495596_0079242
331 Ga0495607_0030528
332 Ga0495583_0039117
333 Ga0495583_0042243
334 Ga0495583_0079009
335 Ga0495606_0019299
336 Ga0495608_0283720
337 Ga0495610_0060146
338 Ga0495616_0005693
339 Ga0495618_0105712
340 Ga0495620_0006602
341 Ga0495620_0039702
342 Ga0495630_0066728
343 Ga0495630_0688739
344 Ga0495630_1401397
345 Ga0495637_0160312
346 Ga0495643_0001303
347 Ga0495644_0209539
348 Ga0495648_0098210
349 Ga0495648_0479746
350 Ga0495666_0040781
351 Ga0495642_0191293
352 Ga0495652_0082223
353 Ga0495654_0381213
354 Ga0495640_0045627
355 Ga0495609_0124816
356 Ga0495597_0011458
357 Ga0495597_0041398
358 Ga0495622_0011638
359 Ga0495633_0118288
360 Ga0495667_0144760
361 Ga0495656_0424490
362 Ga0495668_0010603
363 Ga0495634_0852105
364 Ga0495611_0246488
365 Ga0495611_0333095
366 Ga0495625_0028367
367 Ga0495625_0042284
368 Ga0495625_0059250
369 Ga0495625_0083704
370 Ga0495635_0120516
371 Ga0495661_0060976
372 Ga0495588_0003126
373 Ga0495657_0038961
374 Ga0495657_0045547
375 Ga0495599_0178688
376 Ga0495613_0005827
377 Ga0495613_0011309
378 Ga0495613_0040041
379 Ga0495613_0040895
380 Ga0495670_0229958
381 Ga0495649_0160541
382 Ga0495649_0299744
383 Ga0495589_0013197
384 Ga0495589_0078007
385 Ga0495589_0131234
386 Ga0495589_0143528
387 Ga0495589_0210176
388 Ga0495600_0203733
389 Ga0495660_0040641
390 Ga0495660_0058701
391 Ga0495581_0023796
392 Ga0495581_0061513
393 Ga0495581_0062980
394 Ga0495604_0055902
395 Ga0495636_0000910
396 Ga0495636_0001271
397 Ga0495636_0006511
398 Ga0495636_0027122
399 Ga0495636_0169925
400 Ga0495672_0230864
401 Ga0495676_0033424
402 Ga0495680_0014939
403 Ga0495687_001922
404 Ga0495687_024764
405 Ga0495687_045097
406 Ga0495687_045742
407 Ga0495675_0021718
408 Ga0495675_0080410
409 Ga0495675_0364204
410 Ga0495677_0048589
411 Ga0495685_000851
412 Ga0495685_022196
413 Ga0495685_024984
414 Ga0495685_055884
415 Ga0495685_060780
416 Ga0495685_133544
417 Ga0495681_0029091
418 Ga0495686_0096830
419 Ga0495686_0099314
420 Ga0495593_0027409
421 Ga0495602_0070118
422 Ga0495614_0527273
423 Ga0495626_0023817
424 Ga0496102_1225951
425 Ga0496106_0431611
426 Ga0496108_0840532
427 Ga0496109_0934110
428 Ga0496109_1097236
429 Ga0496121_0875564
430 Ga0501305_075416
431 Ga0495678_038331
432 Ga0495678_145318
433 Ga0501033_0096072
434 Ga0501034_0041532
435 Ga0501070_0235937
436 Ga0501070_1513937
437 Ga0501035_0073508
438 Ga0501035_0083140
439 Ga0501212_024692
440 nmdc:mga03n38_32957_c1
441 nmdc:mga03n38_80909_c1
442 nmdc:mga0yw44_663436_c1
443 nmdc:mga07m45_83966_c1
444 Ga0500600_0160294
445 2547409364
446 2585312590
447 2616696426
448 2784592331
449 2785374050
450 2809235961
451 2812353834
452 2812483095
453 2852639034
454 2862283799
455 2862387451
456 2862515873
457 2863410711
458 2867434807
459 2877677229
460 2912715558
461 2946071861
462 2947232742
463 2954009236
464 2990066805
465 3006499201
466 8008564747
467 8008575484
468 8023626614
469 8056834828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

29

131

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tph-assembly1.cif.gz_A crystal structure of a de novo designed protein homodimer with curved beta-sheet 0.9127 12 118
5u35-assembly1.cif.gz_B crystal structure of a de novo designed protein with curved beta-sheet 0.8848 12 118
5trv-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.8669 11 115
3fh1-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (mll8193) from mesorhizobium loti at 1.60 a resolution 0.8476 11 118
4lmi-assembly1.cif.gz_A crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 0.8397 11 125
ID Description Score Start End Superfamily
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8397 11 125 3.10.450.50
3fh1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8264 11 121 3.10.450.50
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8257 11 121 3.10.450.50
af_Q58FW4_193_288_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8181 65 106 3.30.390.80
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8129 71 106 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A197SW16-F1-model_v4 SnoaL-like domain-containing protein 1.005 7 121
AF-A0A7Z0WFE9-F1-model_v4 SnoaL-like domain-containing protein 0.9995 5 121
AF-A0A2H5B5H0-F1-model_v4 SnoaL-like domain-containing protein 0.9967 6 121
AF-A0A536VCV9-F1-model_v4 Nuclear transport factor 2 family protein 0.992 11 121
AF-A0A840IGD9-F1-model_v4 Ketosteroid isomerase-like protein 0.9918 8 121 GO:0016853

Map