F347147

General Info

Members Datasets Scaffolds Average Seq Length
234 133 468 295

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10005166|Ga0213875_100051662
Length 320
Sequence MPLLSGPARARNQAAAHHRAPKQAPSTPAMPEPLVDRSFLERLERLTLHWQKSFHGLVGGHNLSRFAGSGQEFLDHRNFHQGDDLRAVNWRAYMRFEKLFLKMFQVEPRVPVRLLLDISSSMTAGAGQGDLNKFDYARKIAAALVYVGLVRLDSILLQPFSSRLLDPFLASGGRHRFTPAENYLRALTPRGKTNYFDIARPQRGLTIIISDFLDDSDCLHPLQYMADFGHELLLIQLWGEEDRHPSGQGELELIDSESGARLKIALDDQARQTYSESFDTYTEELKKLAVRNGGRYAGLSTHTPVDEAVFGPLTIIQNGN

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10005166 3300021388 Bacteria 7060
2 Ga0070658_10065650 3300005327 Unclassified 2962
3 Ga0070658_10088560 3300005327 Bacteria 2549
4 Ga0070680_100212289 3300005336 Unclassified 1633
5 Ga0070680_100405562 3300005336 Unclassified 1162
6 Ga0068868_100133506 3300005338 Bacteria 2033
7 Ga0070660_100056254 3300005339 Bacteria 3043
8 Ga0070671_100030656 3300005355 Bacteria 4438
9 Ga0070674_100198071 3300005356 Unclassified 1549
10 Ga0070659_100034285 3300005366 Bacteria 3948
11 Ga0070709_10232085 3300005434 Bacteria 1321
12 Ga0070714_100004724 3300005435 Bacteria 10307
13 Ga0070714_100173324 3300005435 Bacteria 1959
14 Ga0070713_100008974 3300005436 Bacteria 7125
15 Ga0070711_100161718 3300005439 Bacteria 1698
16 Ga0070694_100079860 3300005444 Bacteria 2272
17 Ga0070663_100139050 3300005455 Unclassified 1852
18 Ga0070678_100136251 3300005456 Bacteria 1958
19 Ga0070681_10009940 3300005458 Bacteria 9376
20 Ga0070681_10122566 3300005458 Bacteria 2533
21 Ga0070681_10190324 3300005458 Bacteria 1971
22 Ga0070684_100003472 3300005535 Bacteria 11830
23 Ga0068853_100000928 3300005539 Bacteria 20497
24 Ga0068853_100139888 3300005539 Bacteria 2173
25 Ga0070672_100449125 3300005543 Unclassified 1110
26 Ga0070695_100196671 3300005545 Bacteria 1438
27 Ga0070696_100000196 3300005546 Bacteria 35612
28 Ga0070665_100102176 3300005548 Bacteria 2870
29 Ga0068855_100107631 3300005563 Bacteria 3203
30 Ga0068855_100125651 3300005563 Bacteria 2933
31 Ga0068855_100227265 3300005563 Unclassified 2091
32 Ga0070664_100032119 3300005564 Bacteria 4391
33 Ga0070664_100051175 3300005564 Bacteria 3497
34 Ga0068856_100006795 3300005614 Bacteria 11197
35 Ga0068856_100017361 3300005614 Bacteria 6978
36 Ga0068856_100031368 3300005614 Bacteria 5199
37 Ga0068856_100069920 3300005614 Bacteria 3472
38 Ga0068859_100306259 3300005617 Bacteria 1682
39 Ga0068858_100616263 3300005842 Bacteria 1053
40 Ga0068860_100417916 3300005843 Unclassified 1329
41 Ga0070717_10001639 3300006028 Bacteria 15558
42 Ga0070717_10029139 3300006028 Bacteria 4426
43 Ga0070717_10155438 3300006028 Bacteria 1981
44 Ga0070717_10350345 3300006028 Bacteria 1320
45 Ga0097621_100045906 3300006237 Bacteria 3531
46 Ga0068871_100046162 3300006358 Bacteria 3508
47 Ga0097620_100306302 3300006931 Bacteria 1682
48 Ga0105240_10000824 3300009093 Bacteria 56281
49 Ga0105240_10001491 3300009093 Bacteria 39868
50 Ga0105240_10316888 3300009093 Bacteria 1779
51 Ga0105245_10279306 3300009098 Bacteria 1632
52 Ga0105241_10008041 3300009174 Bacteria 7757
53 Ga0105241_10079499 3300009174 Bacteria 2564
54 Ga0105241_10159666 3300009174 Bacteria 1852
55 Ga0105248_10008375 3300009177 Bacteria 11354
56 Ga0105248_10063547 3300009177 Bacteria 4144
57 Ga0105237_10011283 3300009545 Bacteria 9454
58 Ga0105237_10017831 3300009545 Bacteria 7360
59 Ga0105238_10028330 3300009551 Bacteria 5708
60 Ga0105249_10176655 3300009553 Bacteria 2075
61 Ga0105239_10025016 3300010375 Bacteria 6577
62 Ga0105239_10225251 3300010375 Bacteria 2103
63 Ga0105239_10310855 3300010375 Bacteria 1776
64 Ga0157369_10002216 3300013105 Bacteria 23394
65 Ga0157369_10149939 3300013105 Bacteria 2464
66 Ga0157369_10197993 3300013105 Bacteria 2109
67 Ga0157369_10412246 3300013105 Unclassified 1401
68 Ga0157369_10761074 3300013105 Unclassified 996
69 Ga0157374_10167781 3300013296 Bacteria 2140
70 Ga0157374_10630489 3300013296 Bacteria 1083
71 Ga0157372_10073496 3300013307 Bacteria 3854
72 Ga0157372_10184213 3300013307 Unclassified 2418
73 Ga0157375_10068363 3300013308 Bacteria 3554
74 Ga0157375_10372147 3300013308 Bacteria 1595
75 Ga0163163_10077683 3300014325 Unclassified 3315
76 Ga0163163_10168462 3300014325 Bacteria 2237
77 Ga0163163_10509582 3300014325 Bacteria 1265
78 Ga0157377_10287957 3300014745 Unclassified 1079
79 Ga0157379_10006084 3300014968 Bacteria 10389
80 Ga0157376_10215733 3300014969 Bacteria 1774
81 Ga0157376_10451880 3300014969 Bacteria 1253
82 Ga0213872_10001079 3300021361 Bacteria 18793
83 Ga0213876_10002059 3300021384 Bacteria 11913
84 Ga0213876_10004469 3300021384 Bacteria 7825
85 Ga0213875_10000004 3300021388 Bacteria 703388
86 Ga0213875_10000013 3300021388 Bacteria 305595
87 Ga0213875_10011234 3300021388 Bacteria 4461
88 Ga0213875_10013586 3300021388 Bacteria 3992
89 Ga0213875_10017753 3300021388 Bacteria 3433
90 Ga0213875_10021754 3300021388 Bacteria 3069
91 Ga0213875_10030585 3300021388 Bacteria 2548
92 Ga0213875_10056859 3300021388 Bacteria 1832
93 Ga0213875_10072938 3300021388 Bacteria 1602
94 Ga0207710_10077450 3300025900 Bacteria 1536
95 Ga0207699_10103479 3300025906 Bacteria 1811
96 Ga0207705_10257522 3300025909 Bacteria 1332
97 Ga0207654_10044299 3300025911 Bacteria 2526
98 Ga0207654_10233337 3300025911 Unclassified 1226
99 Ga0207707_10021252 3300025912 Bacteria 5673
100 Ga0207695_10001611 3300025913 Bacteria 36602
101 Ga0207695_10009382 3300025913 Bacteria 12103
102 Ga0207695_10164917 3300025913 Bacteria 2144
103 Ga0207671_10012591 3300025914 Bacteria 6794
104 Ga0207671_10022786 3300025914 Bacteria 4731
105 Ga0207663_10074538 3300025916 Bacteria 2199
106 Ga0207663_10083075 3300025916 Bacteria 2103
107 Ga0207663_10135391 3300025916 Bacteria 1709
108 Ga0207657_10066808 3300025919 Bacteria 3059
109 Ga0207649_10010013 3300025920 Bacteria 5199
110 Ga0207681_10203321 3300025923 Bacteria 1522
111 Ga0207694_10014899 3300025924 Bacteria 5865
112 Ga0207694_10201792 3300025924 Bacteria 1618
113 Ga0207664_10004464 3300025929 Bacteria 9477
114 Ga0207690_10017464 3300025932 Bacteria 4381
115 Ga0207711_10012008 3300025941 Bacteria 7198
116 Ga0207661_10002898 3300025944 Bacteria 11851
117 Ga0207661_10034248 3300025944 Bacteria 3948
118 Ga0207667_10086598 3300025949 Bacteria 3242
119 Ga0207667_10214162 3300025949 Bacteria 1974
120 Ga0207712_10156375 3300025961 Unclassified 1766
121 Ga0207703_10097560 3300026035 Bacteria 2483
122 Ga0207639_10007583 3300026041 Bacteria 7402
123 Ga0207639_10148852 3300026041 Bacteria 1959
124 Ga0207678_10026916 3300026067 Bacteria 5016
125 Ga0207702_10040783 3300026078 Bacteria 3892
126 Ga0207702_10131216 3300026078 Bacteria 2255
127 Ga0207683_10133227 3300026121 Bacteria 2236
128 Ga0207698_10171227 3300026142 Bacteria 1912
129 Ga0265325_10124420 3300031241 Bacteria 1240
130 Ga0265316_10004637 3300031344 Bacteria 13623
131 Ga0373934_0011525 3300035086 Bacteria 3325
132 Ga0373923_0041816 3300035111 Bacteria 1891
133 Ga0373955_0302067 3300035172 Bacteria 965
134 Ga0373931_0227930 3300035691 Bacteria 1125
135 Ga0373935_0019702 3300035692 Bacteria 4114
136 Ga0373927_0007859 3300035695 Bacteria 7213
137 Ga0373933_0035808 3300035724 Bacteria 2902
138 Ga0373933_0227012 3300035724 Bacteria 1199
139 Ga0373937_0002447 3300036401 Bacteria 15426
140 Ga0373937_0013005 3300036401 Bacteria 7330
141 Ga0373937_0028759 3300036401 Bacteria 5031
142 Ga0373925_0053208 3300037068 Unclassified 3026
143 Ga0373925_0101103 3300037068 Bacteria 2217
144 Ga0373925_0148687 3300037068 Bacteria 1837
145 Ga0373925_0160637 3300037068 Unclassified 1770
146 Ga0395899_0310092 3300037312 Bacteria 1066
147 Ga0436364_0055392 3300037853 Bacteria 1564
148 Ga0436364_0319093 3300037853 Bacteria 4874
149 Ga0436364_0525863 3300037853 Bacteria 8203
150 Ga0436364_0548076 3300037853 Bacteria 5257
151 Ga0436364_0646270 3300037853 Bacteria 2314
152 Ga0436364_0650572 3300037853 Bacteria 7852
153 Ga0436364_0654439 3300037853 Bacteria 4873
154 Ga0436364_0702515 3300037853 Bacteria 4491
155 Ga0436364_0735737 3300037853 Bacteria 8196
156 Ga0436364_0748068 3300037853 Bacteria 528910
157 Ga0436364_0786459 3300037853 Bacteria 3753
158 Ga0436364_0794765 3300037853 Bacteria 162685
159 Ga0436364_0839992 3300037853 Bacteria 4548
160 Ga0436364_0954022 3300037853 Bacteria 3012
161 Ga0436364_1348451 3300037853 Bacteria 3996
162 Ga0436365_0234280 3300039437 Bacteria 1825
163 Ga0436365_0262571 3300039437 Bacteria 2471
164 Ga0436365_0309833 3300039437 Bacteria 16171
165 Ga0436365_0377228 3300039437 Bacteria 4473
166 Ga0436365_1233751 3300039437 Bacteria 1708
167 Ga0436365_1446566 3300039437 Bacteria 2878
168 Ga0436360_0727539 3300039438 Bacteria 4629
169 Ga0436360_1278007 3300039438 Bacteria 3831
170 Ga0436361_0306192 3300039447 Bacteria 136694
171 Ga0436363_0619434 3300039450 Bacteria 3081
172 Ga0436363_0628311 3300039450 Bacteria 2302
173 Ga0436363_1565714 3300039450 Unclassified 1737
174 Ga0436362_0511561 3300039453 Bacteria 2838
175 Ga0436362_1234902 3300039453 Bacteria 2589
176 Ga0466959_0217002 3300045049 Unclassified 1328
177 Ga0466967_0226187 3300045976 Bacteria 1780
178 Ga0466967_0330465 3300045976 Bacteria 1472
179 Ga0495580_0012971 3300046472 Bacteria 6381
180 Ga0495580_0104725 3300046472 Bacteria 1966
181 Ga0495580_0114477 3300046472 Unclassified 1873
182 Ga0495652_0499296 3300046529 Bacteria 844
183 Ga0495587_0124745 3300046536 Bacteria 1474
184 Ga0495667_0074801 3300046559 Bacteria 2205
185 Ga0495604_0171471 3300047317 Bacteria 1525
186 Ga0495684_0058938 3300047471 Bacteria 2924
187 Ga0496112_0777432 3300048915 Unclassified 883
188 Ga0501031_0001386 3300049568 Bacteria 14983
189 Ga0501032_0000739 3300049569 Bacteria 26535
190 Ga0501032_0156823 3300049569 Bacteria 1495
191 Ga0501033_0007558 3300049570 Bacteria 8455
192 Ga0501034_0045094 3300049571 Bacteria 4456
193 Ga0501036_0000450 3300049572 Bacteria 29352
194 Ga0501036_0164366 3300049572 Bacteria 1871
195 Ga0501037_0002856 3300049573 Bacteria 12522
196 Ga0501038_0000709 3300049574 Bacteria 29746
197 Ga0501039_0000495 3300049575 Bacteria 28516
198 Ga0501042_0018904 3300049578 Bacteria 4777
199 Ga0501043_0002583 3300049579 Bacteria 15301
200 Ga0501043_0211255 3300049579 Bacteria 1504
201 Ga0501046_0000865 3300049580 Bacteria 29481
202 Ga0501046_0028947 3300049580 Bacteria 4508
203 Ga0501047_0012588 3300049581 Bacteria 8015
204 Ga0501047_0012818 3300049581 Bacteria 7943
205 Ga0501047_0013851 3300049581 Bacteria 7657
206 Ga0501047_0034534 3300049581 Bacteria 4883
207 Ga0501047_0403872 3300049581 Bacteria 1199
208 Ga0501048_0207306 3300049582 Bacteria 1390
209 Ga0501068_0000845 3300049584 Bacteria 15953
210 Ga0501070_0021562 3300049586 Bacteria 5405
211 Ga0501070_0035567 3300049586 Bacteria 4161
212 Ga0501070_0037274 3300049586 Bacteria 4060
213 Ga0501072_0034238 3300049588 Bacteria 3980
214 Ga0501073_0000198 3300049589 Bacteria 39977
215 Ga0501074_0058386 3300049590 Bacteria 2779
216 Ga0501074_0088978 3300049590 Bacteria 2211
217 Ga0501075_0290273 3300049591 Unclassified 1246
218 Ga0501076_0213141 3300049592 Unclassified 1578
219 Ga0501077_0037155 3300049593 Bacteria 3103
220 Ga0501079_0001477 3300049741 Bacteria 16638
221 Ga0501080_0000924 3300049742 Bacteria 23984
222 Ga0501080_0360393 3300049742 Bacteria 1312
223 Ga0501081_0310826 3300049743 Unclassified 1157
224 Ga0501083_0027104 3300049744 Bacteria 3955
225 Ga0501035_0073716 3300049822 Bacteria 3020
226 Ga0501044_0001499 3300049823 Bacteria 27357
227 Ga0501044_0002458 3300049823 Bacteria 21124
228 Ga0501044_0004603 3300049823 Bacteria 15429
229 Ga0501045_0044105 3300049824 Bacteria 3248
230 nmdc:mga08x19_2861_c1 3300050514 Bacteria 10401
231 Ga0501084_0000725 3300054114 Bacteria 25109
232 Ga0501082_0000628 3300060353 Bacteria 31112
233 Ga0501082_0002354 3300060353 Bacteria 16547
234 Ga0530510_0274689 3300061734 Unclassified 1258
235 Ga0213875_10005166
236 Ga0070658_10065650
237 Ga0070658_10088560
238 Ga0070680_100212289
239 Ga0070680_100405562
240 Ga0068868_100133506
241 Ga0070660_100056254
242 Ga0070671_100030656
243 Ga0070674_100198071
244 Ga0070659_100034285
245 Ga0070709_10232085
246 Ga0070714_100004724
247 Ga0070714_100173324
248 Ga0070713_100008974
249 Ga0070711_100161718
250 Ga0070694_100079860
251 Ga0070663_100139050
252 Ga0070678_100136251
253 Ga0070681_10009940
254 Ga0070681_10122566
255 Ga0070681_10190324
256 Ga0070684_100003472
257 Ga0068853_100000928
258 Ga0068853_100139888
259 Ga0070672_100449125
260 Ga0070695_100196671
261 Ga0070696_100000196
262 Ga0070665_100102176
263 Ga0068855_100107631
264 Ga0068855_100125651
265 Ga0068855_100227265
266 Ga0070664_100032119
267 Ga0070664_100051175
268 Ga0068856_100006795
269 Ga0068856_100017361
270 Ga0068856_100031368
271 Ga0068856_100069920
272 Ga0068859_100306259
273 Ga0068858_100616263
274 Ga0068860_100417916
275 Ga0070717_10001639
276 Ga0070717_10029139
277 Ga0070717_10155438
278 Ga0070717_10350345
279 Ga0097621_100045906
280 Ga0068871_100046162
281 Ga0097620_100306302
282 Ga0105240_10000824
283 Ga0105240_10001491
284 Ga0105240_10316888
285 Ga0105245_10279306
286 Ga0105241_10008041
287 Ga0105241_10079499
288 Ga0105241_10159666
289 Ga0105248_10008375
290 Ga0105248_10063547
291 Ga0105237_10011283
292 Ga0105237_10017831
293 Ga0105238_10028330
294 Ga0105249_10176655
295 Ga0105239_10025016
296 Ga0105239_10225251
297 Ga0105239_10310855
298 Ga0157369_10002216
299 Ga0157369_10149939
300 Ga0157369_10197993
301 Ga0157369_10412246
302 Ga0157369_10761074
303 Ga0157374_10167781
304 Ga0157374_10630489
305 Ga0157372_10073496
306 Ga0157372_10184213
307 Ga0157375_10068363
308 Ga0157375_10372147
309 Ga0163163_10077683
310 Ga0163163_10168462
311 Ga0163163_10509582
312 Ga0157377_10287957
313 Ga0157379_10006084
314 Ga0157376_10215733
315 Ga0157376_10451880
316 Ga0213872_10001079
317 Ga0213876_10002059
318 Ga0213876_10004469
319 Ga0213875_10000004
320 Ga0213875_10000013
321 Ga0213875_10011234
322 Ga0213875_10013586
323 Ga0213875_10017753
324 Ga0213875_10021754
325 Ga0213875_10030585
326 Ga0213875_10056859
327 Ga0213875_10072938
328 Ga0207710_10077450
329 Ga0207699_10103479
330 Ga0207705_10257522
331 Ga0207654_10044299
332 Ga0207654_10233337
333 Ga0207707_10021252
334 Ga0207695_10001611
335 Ga0207695_10009382
336 Ga0207695_10164917
337 Ga0207671_10012591
338 Ga0207671_10022786
339 Ga0207663_10074538
340 Ga0207663_10083075
341 Ga0207663_10135391
342 Ga0207657_10066808
343 Ga0207649_10010013
344 Ga0207681_10203321
345 Ga0207694_10014899
346 Ga0207694_10201792
347 Ga0207664_10004464
348 Ga0207690_10017464
349 Ga0207711_10012008
350 Ga0207661_10002898
351 Ga0207661_10034248
352 Ga0207667_10086598
353 Ga0207667_10214162
354 Ga0207712_10156375
355 Ga0207703_10097560
356 Ga0207639_10007583
357 Ga0207639_10148852
358 Ga0207678_10026916
359 Ga0207702_10040783
360 Ga0207702_10131216
361 Ga0207683_10133227
362 Ga0207698_10171227
363 Ga0265325_10124420
364 Ga0265316_10004637
365 Ga0373934_0011525
366 Ga0373923_0041816
367 Ga0373955_0302067
368 Ga0373931_0227930
369 Ga0373935_0019702
370 Ga0373927_0007859
371 Ga0373933_0035808
372 Ga0373933_0227012
373 Ga0373937_0002447
374 Ga0373937_0013005
375 Ga0373937_0028759
376 Ga0373925_0053208
377 Ga0373925_0101103
378 Ga0373925_0148687
379 Ga0373925_0160637
380 Ga0395899_0310092
381 Ga0436364_0055392
382 Ga0436364_0319093
383 Ga0436364_0525863
384 Ga0436364_0548076
385 Ga0436364_0646270
386 Ga0436364_0650572
387 Ga0436364_0654439
388 Ga0436364_0702515
389 Ga0436364_0735737
390 Ga0436364_0748068
391 Ga0436364_0786459
392 Ga0436364_0794765
393 Ga0436364_0839992
394 Ga0436364_0954022
395 Ga0436364_1348451
396 Ga0436365_0234280
397 Ga0436365_0262571
398 Ga0436365_0309833
399 Ga0436365_0377228
400 Ga0436365_1233751
401 Ga0436365_1446566
402 Ga0436360_0727539
403 Ga0436360_1278007
404 Ga0436361_0306192
405 Ga0436363_0619434
406 Ga0436363_0628311
407 Ga0436363_1565714
408 Ga0436362_0511561
409 Ga0436362_1234902
410 Ga0466959_0217002
411 Ga0466967_0226187
412 Ga0466967_0330465
413 Ga0495580_0012971
414 Ga0495580_0104725
415 Ga0495580_0114477
416 Ga0495652_0499296
417 Ga0495587_0124745
418 Ga0495667_0074801
419 Ga0495604_0171471
420 Ga0495684_0058938
421 Ga0496112_0777432
422 Ga0501031_0001386
423 Ga0501032_0000739
424 Ga0501032_0156823
425 Ga0501033_0007558
426 Ga0501034_0045094
427 Ga0501036_0000450
428 Ga0501036_0164366
429 Ga0501037_0002856
430 Ga0501038_0000709
431 Ga0501039_0000495
432 Ga0501042_0018904
433 Ga0501043_0002583
434 Ga0501043_0211255
435 Ga0501046_0000865
436 Ga0501046_0028947
437 Ga0501047_0012588
438 Ga0501047_0012818
439 Ga0501047_0013851
440 Ga0501047_0034534
441 Ga0501047_0403872
442 Ga0501048_0207306
443 Ga0501068_0000845
444 Ga0501070_0021562
445 Ga0501070_0035567
446 Ga0501070_0037274
447 Ga0501072_0034238
448 Ga0501073_0000198
449 Ga0501074_0058386
450 Ga0501074_0088978
451 Ga0501075_0290273
452 Ga0501076_0213141
453 Ga0501077_0037155
454 Ga0501079_0001477
455 Ga0501080_0000924
456 Ga0501080_0360393
457 Ga0501081_0310826
458 Ga0501083_0027104
459 Ga0501035_0073716
460 Ga0501044_0001499
461 Ga0501044_0002458
462 Ga0501044_0004603
463 Ga0501045_0044105
464 nmdc:mga08x19_2861_c1
465 Ga0501084_0000725
466 Ga0501082_0000628
467 Ga0501082_0002354
468 Ga0530510_0274689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

70

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pyx-assembly2.cif.gz_B calcium activated chloride channel regulator 1 (clca1) vwa domain 0.7264 82 209
4cn8-assembly1.cif.gz_A structure of proximal thread matrix protein 1 (ptmp1) from the mussel byssus 0.7168 82 211
4okr-assembly2.cif.gz_B structures of toxoplasma gondii mic2 0.6748 83 212
2i91-assembly2.cif.gz_B 60kda ro autoantigen in complex with a fragment of misfolded rna 0.6718 82 210
5of4-assembly1.cif.gz_E the cryo-em structure of human tfiih 0.6632 83 289
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8192 140 283 3.40.50.410
af_A0A0P0WT04_289_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7985 84 175 3.40.50.410
af_Q76NM2_26_240_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7424 82 210 3.40.50.410
af_X1WDY9_182_353_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7424 81 280 3.40.50.410
af_Q502W6_508_661_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7385 84 274 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A2V8T486-F1-model_v4 DUF58 domain-containing protein 0.9602 113 294
AF-A0A2V8T486-F1-model_v4 DUF58 domain-containing protein 0.9499 113 294
AF-A0A5J4KRV9-F1-model_v4 DUF58 domain-containing protein 0.9192 182 283
AF-A0A3M0YWI0-F1-model_v4 deleted 0.9133 181 290
AF-A0A348PBW9-F1-model_v4 DUF58 domain-containing protein 0.9092 82 289

Map