F347143

General Info

Members Datasets Scaffolds Average Seq Length
234 170 468 377

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_11595085|Ga0206353_115950855
Length 420
Sequence MTQPTTTYTETDERIALRKAVASLARSYGPEYYFSRARSGGHTTELWDEAGRLGYLGVAVPEEYGGGGAGIGDLAAVLEEFCAAGAPLLLMMVSPAICATVIARFGTEQQKQTWLPRFATGEVRMSFGITEPEAGSNSHRLTTTARRDGDGWVLTGRKVFISGVDEADAVLIVGRTEDAKTGRLRPALFIVPTDAPGFEYRQIQMDITAADRQFGLFLDEVRLPAEALIGAQDADLAAMFAGLNPERIMSAAFSVGVARYALEKAVAYAGQRSVWGVPIGAHQGLAHPLAQIKIELELARLMMQKAAALYDAGDDHAAGEAANMAKYAAAEVAVRAVDQAIQVHGGNGLASEYGLGVLLGVVRASRIAPVSREMVLNFVAQHSLGLPKSYGSSGRPEPAPAVAATSEPAAPNIASHEHAF

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
147 2582580736 Prauserella sp. Am3 Isolate Unclassified
148 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
149 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
150 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
151 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
152 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
153 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
154 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
155 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
156 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
157 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
158 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
159 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
160 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
161 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
162 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
163 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
164 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
165 2922554459 Rhodococcus sp. 66b Isolate Unclassified
166 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
167 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
168 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
169 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
170 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.89
Metatranscriptomes 0.43
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0
Rhizoplane 14.1
Rhizosphere 59.83
Stem 0
Stem Tuber 0.43
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_11595085 3300020082 Bacteria 6255
2 LJQas_1006020 3300000549 Bacteria 1520
3 JGI25406J46586_10020527 3300003203 Bacteria 2670
4 rootH2_10107091 3300003320 Bacteria 1897
5 Ga0070658_10068621 3300005327 Bacteria 2899
6 Ga0070683_100005394 3300005329 Bacteria 10670
7 Ga0070683_100010370 3300005329 Bacteria 8013
8 Ga0068869_100014817 3300005334 Bacteria 5214
9 Ga0068868_100004095 3300005338 Bacteria 10182
10 Ga0070660_100139391 3300005339 Bacteria 1945
11 Ga0070661_100009176 3300005344 Bacteria 6838
12 Ga0070692_10025591 3300005345 Bacteria 2910
13 Ga0070668_100076286 3300005347 Bacteria 2618
14 Ga0070675_100006538 3300005354 Bacteria 8956
15 Ga0070659_100063628 3300005366 Bacteria 2919
16 Ga0070667_100035773 3300005367 Bacteria 4161
17 Ga0070663_100005241 3300005455 Bacteria 7682
18 Ga0070663_100051756 3300005455 Bacteria 2927
19 Ga0070678_100119138 3300005456 Bacteria 2079
20 Ga0070662_100058863 3300005457 Bacteria 2797
21 Ga0070679_100007453 3300005530 Bacteria 10224
22 Ga0070672_100169549 3300005543 Bacteria 1815
23 Ga0070665_100002429 3300005548 Bacteria 20530
24 Ga0070664_100002541 3300005564 Bacteria 14717
25 Ga0068857_100014774 3300005577 Bacteria 6812
26 Ga0068857_100254692 3300005577 Bacteria 1610
27 Ga0068852_100048672 3300005616 Bacteria 3623
28 Ga0068864_100054580 3300005618 Bacteria 3449
29 Ga0068864_100315800 3300005618 Bacteria 1466
30 Ga0068866_10049235 3300005718 Bacteria 2134
31 Ga0068861_100067248 3300005719 Bacteria 2765
32 Ga0068861_100235862 3300005719 Bacteria 1554
33 Ga0068870_10066982 3300005840 Bacteria 1947
34 Ga0068858_100052389 3300005842 Bacteria 3776
35 Ga0068858_100176530 3300005842 Bacteria 2016
36 Ga0068860_100059973 3300005843 Bacteria 3616
37 Ga0081455_10000297 3300005937 Bacteria 65930
38 Ga0081455_10088146 3300005937 Bacteria 2523
39 Ga0081539_10000125 3300005985 Bacteria 180646
40 Ga0081539_10000451 3300005985 Bacteria 87519
41 Ga0075365_10003497 3300006038 Bacteria 8114
42 Ga0075365_10047930 3300006038 Bacteria 2810
43 Ga0075368_10014274 3300006042 Bacteria 2931
44 Ga0075368_10062189 3300006042 Bacteria 1496
45 Ga0075363_100002571 3300006048 Bacteria 7460
46 Ga0075363_100006196 3300006048 Bacteria 5408
47 Ga0075363_100043370 3300006048 Bacteria 2379
48 Ga0075364_10008475 3300006051 Bacteria 6149
49 Ga0075364_10030251 3300006051 Bacteria 3475
50 Ga0075364_10093345 3300006051 Bacteria 1998
51 Ga0075364_10095984 3300006051 Bacteria 1971
52 Ga0075367_10022937 3300006178 Bacteria 3507
53 Ga0075431_100176755 3300006847 Bacteria 2192
54 Ga0068865_100022844 3300006881 Bacteria 4087
55 Ga0111539_10013921 3300009094 Bacteria 10056
56 Ga0105245_10000417 3300009098 Bacteria 39694
57 Ga0105245_10094008 3300009098 Bacteria 2763
58 Ga0105242_10061623 3300009176 Bacteria 3085
59 Ga0105249_10066256 3300009553 Bacteria 3324
60 Ga0105239_10025071 3300010375 Bacteria 6569
61 Ga0105239_10167643 3300010375 Bacteria 2456
62 Ga0105246_10001919 3300011119 Bacteria 12524
63 Ga0105246_10042066 3300011119 Bacteria 3093
64 Ga0157369_10297017 3300013105 Bacteria 1681
65 Ga0157369_10403099 3300013105 Bacteria 1419
66 Ga0157375_10083082 3300013308 Bacteria 3247
67 Ga0157375_10181855 3300013308 Bacteria 2254
68 Ga0163163_10056856 3300014325 Bacteria 3867
69 Ga0163163_10284261 3300014325 Bacteria 1706
70 Ga0157377_10014381 3300014745 Bacteria 4026
71 Ga0157379_10007454 3300014968 Bacteria 9473
72 Ga0163161_10040806 3300017792 Bacteria 3334
73 Ga0207647_10006675 3300025904 Bacteria 8384
74 Ga0207647_10014279 3300025904 Bacteria 5479
75 Ga0207705_10037642 3300025909 Bacteria 3462
76 Ga0207657_10138415 3300025919 Bacteria 1991
77 Ga0207646_10065838 3300025922 Bacteria 3235
78 Ga0207650_10123580 3300025925 Bacteria 2017
79 Ga0207687_10206793 3300025927 Bacteria 1538
80 Ga0207690_10074204 3300025932 Bacteria 2356
81 Ga0207706_10070264 3300025933 Bacteria 3080
82 Ga0207704_10300635 3300025938 Bacteria 1229
83 Ga0207691_10125415 3300025940 Bacteria 2272
84 Ga0207691_10286751 3300025940 Bacteria 1416
85 Ga0207661_10150323 3300025944 Bacteria 2012
86 Ga0207679_10031051 3300025945 Bacteria 3737
87 Ga0207712_10082339 3300025961 Bacteria 2346
88 Ga0207668_10015064 3300025972 Bacteria 4799
89 Ga0207677_10004680 3300026023 Bacteria 7372
90 Ga0207703_10028425 3300026035 Bacteria 4408
91 Ga0207678_10000555 3300026067 Bacteria 34090
92 Ga0207678_10070714 3300026067 Bacteria 2992
93 Ga0207702_10419415 3300026078 Bacteria 1294
94 Ga0207674_10007788 3300026116 Bacteria 12460
95 Ga0207674_10020010 3300026116 Bacteria 7242
96 Ga0207675_100099310 3300026118 Bacteria 2742
97 Ga0207698_10144723 3300026142 Bacteria 2054
98 Ga0209813_10028902 3300027866 Bacteria 1620
99 Ga0207428_10089359 3300027907 Bacteria 2394
100 Ga0268266_10003293 3300028379 Bacteria 16233
101 Ga0268264_10000664 3300028381 Bacteria 40313
102 Ga0307517_10091264 3300028786 Bacteria 2490
103 Ga0307515_10018497 3300028794 Bacteria 12599
104 Ga0307515_10018851 3300028794 Bacteria 12458
105 Ga0307515_10022037 3300028794 Bacteria 11252
106 Ga0307515_10029011 3300028794 Bacteria 9377
107 Ga0307512_10007441 3300030522 Bacteria 10867
108 Ga0307512_10009763 3300030522 Bacteria 9218
109 Ga0265327_10002363 3300031251 Bacteria 20105
110 Ga0307513_10006905 3300031456 Bacteria 14777
111 Ga0307513_10049030 3300031456 Bacteria 4576
112 Ga0307508_10198746 3300031616 Bacteria 1606
113 Ga0316576_10038584 3300031727 Bacteria 3426
114 Ga0307413_10030450 3300031824 Bacteria 3032
115 Ga0307518_10001260 3300031838 Bacteria 19022
116 Ga0307406_10069192 3300031901 Bacteria 2307
117 Ga0307409_100027743 3300031995 Bacteria 4019
118 Ga0307409_100090085 3300031995 Bacteria 2510
119 Ga0307409_100195061 3300031995 Bacteria 1806
120 Ga0307409_100454446 3300031995 Bacteria 1237
121 Ga0307416_100052618 3300032002 Bacteria 3261
122 Ga0307416_100278415 3300032002 Bacteria 1648
123 Ga0307415_100015782 3300032126 Bacteria 4484
124 Ga0307415_100025312 3300032126 Bacteria 3721
125 Ga0307415_100146441 3300032126 Bacteria 1811
126 Ga0307507_10000084 3300033179 Bacteria 145642
127 Ga0395898_0132769 3300037466 Bacteria 2384
128 Ga0436364_0023063 3300037853 Bacteria 2121
129 Ga0436364_0438602 3300037853 Bacteria 13999
130 Ga0436365_0278091 3300039437 Bacteria 4463
131 Ga0466969_0029706 3300044656 Bacteria 2790
132 Ga0466972_0025496 3300044658 Bacteria 2931
133 Ga0466966_0010226 3300044684 Bacteria 6224
134 Ga0466961_0077252 3300044693 Bacteria 2109
135 Ga0466963_0006378 3300044694 Bacteria 6980
136 Ga0466963_0079563 3300044694 Bacteria 2218
137 Ga0466963_0098575 3300044694 Bacteria 1998
138 Ga0466964_0023592 3300044706 Bacteria 2392
139 Ga0466971_0015331 3300044719 Bacteria 3372
140 Ga0466970_0079628 3300044765 Bacteria 1769
141 Ga0466960_0027261 3300044901 Bacteria 2604
142 Ga0466959_0002716 3300045049 Bacteria 11371
143 Ga0466967_0009448 3300045976 Bacteria 7234
144 Ga0466967_0022630 3300045976 Bacteria 5134
145 Ga0466967_0061397 3300045976 Bacteria 3334
146 Ga0466967_0143681 3300045976 Bacteria 2224
147 Ga0495668_0000407 3300046616 Bacteria 56229
148 Ga0495581_0077803 3300047315 Bacteria 1920
149 Ga0495675_0023923 3300047444 Bacteria 3892
150 Ga0495593_0097074 3300047673 Bacteria 1514
151 Ga0496100_0182239 3300048903 Bacteria 1519
152 Ga0496101_0014944 3300048904 Bacteria 5223
153 Ga0496101_0040247 3300048904 Bacteria 3329
154 Ga0496102_0051356 3300048905 Bacteria 3756
155 Ga0496103_0030019 3300048906 Bacteria 3306
156 Ga0496104_0044081 3300048907 Bacteria 4191
157 Ga0496104_0155227 3300048907 Bacteria 2197
158 Ga0496104_0238901 3300048907 Bacteria 1729
159 Ga0496105_0018117 3300048908 Bacteria 5652
160 Ga0496105_0078026 3300048908 Bacteria 2735
161 Ga0496106_0199913 3300048909 Bacteria 1590
162 Ga0496107_0034087 3300048910 Bacteria 3644
163 Ga0496108_0008265 3300048911 Bacteria 8442
164 Ga0496108_0054678 3300048911 Bacteria 3350
165 Ga0496108_0058900 3300048911 Bacteria 3230
166 Ga0496108_0314680 3300048911 Bacteria 1364
167 Ga0496109_0001430 3300048912 Bacteria 19793
168 Ga0496109_0015299 3300048912 Bacteria 6682
169 Ga0496109_0023621 3300048912 Bacteria 5458
170 Ga0496109_0049625 3300048912 Bacteria 3821
171 Ga0496109_0251996 3300048912 Bacteria 1663
172 Ga0496110_0077774 3300048913 Bacteria 2952
173 Ga0496110_0080505 3300048913 Bacteria 2902
174 Ga0496110_0202245 3300048913 Bacteria 1805
175 Ga0496111_0022669 3300048914 Bacteria 4399
176 Ga0496111_0086529 3300048914 Bacteria 2293
177 Ga0496111_0213139 3300048914 Bacteria 1434
178 Ga0496112_0255976 3300048915 Bacteria 1701
179 Ga0496113_0036171 3300048916 Bacteria 3616
180 Ga0496114_0008922 3300048917 Bacteria 7950
181 Ga0496114_0014922 3300048917 Bacteria 6244
182 Ga0496114_0016566 3300048917 Bacteria 5941
183 Ga0496115_0013984 3300048918 Bacteria 6074
184 Ga0501067_0046305 3300049583 Bacteria 2414
185 Ga0501067_0059095 3300049583 Bacteria 2123
186 Ga0501068_0120091 3300049584 Bacteria 1638
187 Ga0501070_0237433 3300049586 Bacteria 1492
188 Ga0501071_0057598 3300049587 Bacteria 2809
189 nmdc:mga03683_40712_c1 3300050489 Bacteria 1907
190 nmdc:mga03n38_18960_c1 3300050490 Bacteria 2724
191 nmdc:mga03n38_94922_c1 3300050490 Bacteria 1428
192 nmdc:mga00v17_173893_c1 3300050491 Bacteria 1389
193 nmdc:mga0yw44_154276_c1 3300050492 Bacteria 1500
194 nmdc:mga0yw44_56592_c1 3300050492 Bacteria 2390
195 nmdc:mga06z11_157527_c1 3300050494 Bacteria 1296
196 nmdc:mga04h51_11352_c1 3300050495 Bacteria 2470
197 nmdc:mga04h51_7279_c1 3300050495 Bacteria 2913
198 nmdc:mga07m45_30769_c1 3300050496 Bacteria 2974
199 nmdc:mga06r32_188864_c1 3300050510 Bacteria 2048
200 nmdc:mga06r32_196307_c1 3300050510 Bacteria 2006
201 nmdc:mga08y16_59354_c1 3300050511 Bacteria 3996
202 Ga0495601_0124377 3300053077 Bacteria 1677
203 Ga0495619_0013266 3300053085 Bacteria 5193
204 Ga0500644_0000204 3300053088 Bacteria 35880
205 Ga0500594_0011063 3300053118 Bacteria 2104
206 Ga0500652_044462 3300053131 Bacteria 1798
207 Ga0500573_0015113 3300053140 Bacteria 4373
208 Ga0500600_0079956 3300053149 Bacteria 1770
209 Ga0501082_0205538 3300060353 Bacteria 1713
210 2566992556 2565956761 Bacteria 6601618
211 2583151226 2582580736 Bacteria 5325865
212 2586062206 2585427649 Bacteria 9053857
213 2644016911 2643221601 Bacteria 7493239
214 2644177953 2643221631 Bacteria 8168043
215 2738887549 2738541308 Bacteria 7020677
216 2791911555 2791354901 Bacteria 8322202
217 2795782614 2795385470 Bacteria 8317180
218 2795793121 2795385472 Bacteria 6627535
219 2816422391 2816332119 Bacteria 8120218
220 2866614616 2866612099 Bacteria 7543886
221 2870790296 2870782633 Bacteria 9624083
222 2891327711 2891326441 Bacteria 6439512
223 2899368223 2899359706 Bacteria 10940472
224 2899372834 2899370129 Bacteria 6781179
225 2904541582 2904535858 Bacteria 6308016
226 2912728593 2912723979 Bacteria 8557534
227 2917739416 2917736166 Bacteria 9690793
228 2919715331 2919713450 Bacteria 7431245
229 2922560041 2922554459 Bacteria 6683962
230 2995467549 2995463766 Bacteria 8577691
231 3006397613 3006393351 Bacteria 6615579
232 8003323795 8003314358 Bacteria 10575343
233 8056063484 8056060235 Bacteria 7259403
234 8056669625 8056667051 Bacteria 6953971
235 Ga0206353_11595085
236 LJQas_1006020
237 JGI25406J46586_10020527
238 rootH2_10107091
239 Ga0070658_10068621
240 Ga0070683_100005394
241 Ga0070683_100010370
242 Ga0068869_100014817
243 Ga0068868_100004095
244 Ga0070660_100139391
245 Ga0070661_100009176
246 Ga0070692_10025591
247 Ga0070668_100076286
248 Ga0070675_100006538
249 Ga0070659_100063628
250 Ga0070667_100035773
251 Ga0070663_100005241
252 Ga0070663_100051756
253 Ga0070678_100119138
254 Ga0070662_100058863
255 Ga0070679_100007453
256 Ga0070672_100169549
257 Ga0070665_100002429
258 Ga0070664_100002541
259 Ga0068857_100014774
260 Ga0068857_100254692
261 Ga0068852_100048672
262 Ga0068864_100054580
263 Ga0068864_100315800
264 Ga0068866_10049235
265 Ga0068861_100067248
266 Ga0068861_100235862
267 Ga0068870_10066982
268 Ga0068858_100052389
269 Ga0068858_100176530
270 Ga0068860_100059973
271 Ga0081455_10000297
272 Ga0081455_10088146
273 Ga0081539_10000125
274 Ga0081539_10000451
275 Ga0075365_10003497
276 Ga0075365_10047930
277 Ga0075368_10014274
278 Ga0075368_10062189
279 Ga0075363_100002571
280 Ga0075363_100006196
281 Ga0075363_100043370
282 Ga0075364_10008475
283 Ga0075364_10030251
284 Ga0075364_10093345
285 Ga0075364_10095984
286 Ga0075367_10022937
287 Ga0075431_100176755
288 Ga0068865_100022844
289 Ga0111539_10013921
290 Ga0105245_10000417
291 Ga0105245_10094008
292 Ga0105242_10061623
293 Ga0105249_10066256
294 Ga0105239_10025071
295 Ga0105239_10167643
296 Ga0105246_10001919
297 Ga0105246_10042066
298 Ga0157369_10297017
299 Ga0157369_10403099
300 Ga0157375_10083082
301 Ga0157375_10181855
302 Ga0163163_10056856
303 Ga0163163_10284261
304 Ga0157377_10014381
305 Ga0157379_10007454
306 Ga0163161_10040806
307 Ga0207647_10006675
308 Ga0207647_10014279
309 Ga0207705_10037642
310 Ga0207657_10138415
311 Ga0207646_10065838
312 Ga0207650_10123580
313 Ga0207687_10206793
314 Ga0207690_10074204
315 Ga0207706_10070264
316 Ga0207704_10300635
317 Ga0207691_10125415
318 Ga0207691_10286751
319 Ga0207661_10150323
320 Ga0207679_10031051
321 Ga0207712_10082339
322 Ga0207668_10015064
323 Ga0207677_10004680
324 Ga0207703_10028425
325 Ga0207678_10000555
326 Ga0207678_10070714
327 Ga0207702_10419415
328 Ga0207674_10007788
329 Ga0207674_10020010
330 Ga0207675_100099310
331 Ga0207698_10144723
332 Ga0209813_10028902
333 Ga0207428_10089359
334 Ga0268266_10003293
335 Ga0268264_10000664
336 Ga0307517_10091264
337 Ga0307515_10018497
338 Ga0307515_10018851
339 Ga0307515_10022037
340 Ga0307515_10029011
341 Ga0307512_10007441
342 Ga0307512_10009763
343 Ga0265327_10002363
344 Ga0307513_10006905
345 Ga0307513_10049030
346 Ga0307508_10198746
347 Ga0316576_10038584
348 Ga0307413_10030450
349 Ga0307518_10001260
350 Ga0307406_10069192
351 Ga0307409_100027743
352 Ga0307409_100090085
353 Ga0307409_100195061
354 Ga0307409_100454446
355 Ga0307416_100052618
356 Ga0307416_100278415
357 Ga0307415_100015782
358 Ga0307415_100025312
359 Ga0307415_100146441
360 Ga0307507_10000084
361 Ga0395898_0132769
362 Ga0436364_0023063
363 Ga0436364_0438602
364 Ga0436365_0278091
365 Ga0466969_0029706
366 Ga0466972_0025496
367 Ga0466966_0010226
368 Ga0466961_0077252
369 Ga0466963_0006378
370 Ga0466963_0079563
371 Ga0466963_0098575
372 Ga0466964_0023592
373 Ga0466971_0015331
374 Ga0466970_0079628
375 Ga0466960_0027261
376 Ga0466959_0002716
377 Ga0466967_0009448
378 Ga0466967_0022630
379 Ga0466967_0061397
380 Ga0466967_0143681
381 Ga0495668_0000407
382 Ga0495581_0077803
383 Ga0495675_0023923
384 Ga0495593_0097074
385 Ga0496100_0182239
386 Ga0496101_0014944
387 Ga0496101_0040247
388 Ga0496102_0051356
389 Ga0496103_0030019
390 Ga0496104_0044081
391 Ga0496104_0155227
392 Ga0496104_0238901
393 Ga0496105_0018117
394 Ga0496105_0078026
395 Ga0496106_0199913
396 Ga0496107_0034087
397 Ga0496108_0008265
398 Ga0496108_0054678
399 Ga0496108_0058900
400 Ga0496108_0314680
401 Ga0496109_0001430
402 Ga0496109_0015299
403 Ga0496109_0023621
404 Ga0496109_0049625
405 Ga0496109_0251996
406 Ga0496110_0077774
407 Ga0496110_0080505
408 Ga0496110_0202245
409 Ga0496111_0022669
410 Ga0496111_0086529
411 Ga0496111_0213139
412 Ga0496112_0255976
413 Ga0496113_0036171
414 Ga0496114_0008922
415 Ga0496114_0014922
416 Ga0496114_0016566
417 Ga0496115_0013984
418 Ga0501067_0046305
419 Ga0501067_0059095
420 Ga0501068_0120091
421 Ga0501070_0237433
422 Ga0501071_0057598
423 nmdc:mga03683_40712_c1
424 nmdc:mga03n38_18960_c1
425 nmdc:mga03n38_94922_c1
426 nmdc:mga00v17_173893_c1
427 nmdc:mga0yw44_154276_c1
428 nmdc:mga0yw44_56592_c1
429 nmdc:mga06z11_157527_c1
430 nmdc:mga04h51_11352_c1
431 nmdc:mga04h51_7279_c1
432 nmdc:mga07m45_30769_c1
433 nmdc:mga06r32_188864_c1
434 nmdc:mga06r32_196307_c1
435 nmdc:mga08y16_59354_c1
436 Ga0495601_0124377
437 Ga0495619_0013266
438 Ga0500644_0000204
439 Ga0500594_0011063
440 Ga0500652_044462
441 Ga0500573_0015113
442 Ga0500600_0079956
443 Ga0501082_0205538
444 2566992556
445 2583151226
446 2586062206
447 2644016911
448 2644177953
449 2738887549
450 2791911555
451 2795782614
452 2795793121
453 2816422391
454 2866614616
455 2870790296
456 2891327711
457 2899368223
458 2899372834
459 2904541582
460 2912728593
461 2917739416
462 2919715331
463 2922560041
464 2995467549
465 3006397613
466 8003323795
467 8056063484
468 8056669625

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

236

384

0.96

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

11

122

0.95

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

248

356

0.93

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

126

220

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n5f-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 0.9354 8 373
3mpi-assembly2.cif.gz_C structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex 0.9327 4 381
3mdd-assembly1.cif.gz_A crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate 0.9296 5 378
5ol2-assembly2.cif.gz_F the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile 0.9272 8 377
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9267 8 378
ID Description Score Start End Superfamily
af_P9WQG3_234_382_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9921 230 376 1.20.140.10
af_P9WQG3_121_229_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9914 117 224 2.40.110.10
1t9gC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9757 240 377 1.20.140.10
5lnxH03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9743 237 378 1.20.140.10
1t9gB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9739 240 377 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0J6VZ32-F1-model_v4 Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) 0.9723 1 383 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A0J6VZ32-F1-model_v4 Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) 0.9698 1 383 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A6I0FAM6-F1-model_v4 Acyl-CoA dehydrogenase 0.9585 7 383 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A2E4VLD0-F1-model_v4 deleted 0.9531 247 378
AF-A0A2N5GDE7-F1-model_v4 Acyl-CoA dehydrogenase 0.9525 4 383 GO:0003995
GO:0050660

Map