F347143
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 170 | 468 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300020082|Ga0206353_11595085|Ga0206353_115950855 |
| Length | 420 |
| Sequence | MTQPTTTYTETDERIALRKAVASLARSYGPEYYFSRARSGGHTTELWDEAGRLGYLGVAVPEEYGGGGAGIGDLAAVLEEFCAAGAPLLLMMVSPAICATVIARFGTEQQKQTWLPRFATGEVRMSFGITEPEAGSNSHRLTTTARRDGDGWVLTGRKVFISGVDEADAVLIVGRTEDAKTGRLRPALFIVPTDAPGFEYRQIQMDITAADRQFGLFLDEVRLPAEALIGAQDADLAAMFAGLNPERIMSAAFSVGVARYALEKAVAYAGQRSVWGVPIGAHQGLAHPLAQIKIELELARLMMQKAAALYDAGDDHAAGEAANMAKYAAAEVAVRAVDQAIQVHGGNGLASEYGLGVLLGVVRASRIAPVSREMVLNFVAQHSLGLPKSYGSSGRPEPAPAVAATSEPAAPNIASHEHAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 80 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 82 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 83 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 86 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 87 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 91 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 92 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 93 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 94 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 95 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 96 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 97 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 98 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 99 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 100 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 101 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 105 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 112 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 113 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 114 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 115 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 116 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 117 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 120 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 124 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 125 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 130 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 131 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 132 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 133 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 134 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 135 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 136 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 141 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 142 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 143 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 144 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 145 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 147 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 148 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 149 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 150 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 151 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 152 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 153 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 154 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 155 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 156 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 157 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 158 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 159 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 160 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 161 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 162 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 163 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 164 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 165 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 166 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 167 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 168 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 169 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 170 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.89 |
| Metatranscriptomes | 0.43 |
| Isolates | 10.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0 |
| Rhizoplane | 14.1 |
| Rhizosphere | 59.83 |
| Stem | 0 |
| Stem Tuber | 0.43 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0206353_11595085 | 3300020082 | Bacteria | 6255 |
| 2 | LJQas_1006020 | 3300000549 | Bacteria | 1520 |
| 3 | JGI25406J46586_10020527 | 3300003203 | Bacteria | 2670 |
| 4 | rootH2_10107091 | 3300003320 | Bacteria | 1897 |
| 5 | Ga0070658_10068621 | 3300005327 | Bacteria | 2899 |
| 6 | Ga0070683_100005394 | 3300005329 | Bacteria | 10670 |
| 7 | Ga0070683_100010370 | 3300005329 | Bacteria | 8013 |
| 8 | Ga0068869_100014817 | 3300005334 | Bacteria | 5214 |
| 9 | Ga0068868_100004095 | 3300005338 | Bacteria | 10182 |
| 10 | Ga0070660_100139391 | 3300005339 | Bacteria | 1945 |
| 11 | Ga0070661_100009176 | 3300005344 | Bacteria | 6838 |
| 12 | Ga0070692_10025591 | 3300005345 | Bacteria | 2910 |
| 13 | Ga0070668_100076286 | 3300005347 | Bacteria | 2618 |
| 14 | Ga0070675_100006538 | 3300005354 | Bacteria | 8956 |
| 15 | Ga0070659_100063628 | 3300005366 | Bacteria | 2919 |
| 16 | Ga0070667_100035773 | 3300005367 | Bacteria | 4161 |
| 17 | Ga0070663_100005241 | 3300005455 | Bacteria | 7682 |
| 18 | Ga0070663_100051756 | 3300005455 | Bacteria | 2927 |
| 19 | Ga0070678_100119138 | 3300005456 | Bacteria | 2079 |
| 20 | Ga0070662_100058863 | 3300005457 | Bacteria | 2797 |
| 21 | Ga0070679_100007453 | 3300005530 | Bacteria | 10224 |
| 22 | Ga0070672_100169549 | 3300005543 | Bacteria | 1815 |
| 23 | Ga0070665_100002429 | 3300005548 | Bacteria | 20530 |
| 24 | Ga0070664_100002541 | 3300005564 | Bacteria | 14717 |
| 25 | Ga0068857_100014774 | 3300005577 | Bacteria | 6812 |
| 26 | Ga0068857_100254692 | 3300005577 | Bacteria | 1610 |
| 27 | Ga0068852_100048672 | 3300005616 | Bacteria | 3623 |
| 28 | Ga0068864_100054580 | 3300005618 | Bacteria | 3449 |
| 29 | Ga0068864_100315800 | 3300005618 | Bacteria | 1466 |
| 30 | Ga0068866_10049235 | 3300005718 | Bacteria | 2134 |
| 31 | Ga0068861_100067248 | 3300005719 | Bacteria | 2765 |
| 32 | Ga0068861_100235862 | 3300005719 | Bacteria | 1554 |
| 33 | Ga0068870_10066982 | 3300005840 | Bacteria | 1947 |
| 34 | Ga0068858_100052389 | 3300005842 | Bacteria | 3776 |
| 35 | Ga0068858_100176530 | 3300005842 | Bacteria | 2016 |
| 36 | Ga0068860_100059973 | 3300005843 | Bacteria | 3616 |
| 37 | Ga0081455_10000297 | 3300005937 | Bacteria | 65930 |
| 38 | Ga0081455_10088146 | 3300005937 | Bacteria | 2523 |
| 39 | Ga0081539_10000125 | 3300005985 | Bacteria | 180646 |
| 40 | Ga0081539_10000451 | 3300005985 | Bacteria | 87519 |
| 41 | Ga0075365_10003497 | 3300006038 | Bacteria | 8114 |
| 42 | Ga0075365_10047930 | 3300006038 | Bacteria | 2810 |
| 43 | Ga0075368_10014274 | 3300006042 | Bacteria | 2931 |
| 44 | Ga0075368_10062189 | 3300006042 | Bacteria | 1496 |
| 45 | Ga0075363_100002571 | 3300006048 | Bacteria | 7460 |
| 46 | Ga0075363_100006196 | 3300006048 | Bacteria | 5408 |
| 47 | Ga0075363_100043370 | 3300006048 | Bacteria | 2379 |
| 48 | Ga0075364_10008475 | 3300006051 | Bacteria | 6149 |
| 49 | Ga0075364_10030251 | 3300006051 | Bacteria | 3475 |
| 50 | Ga0075364_10093345 | 3300006051 | Bacteria | 1998 |
| 51 | Ga0075364_10095984 | 3300006051 | Bacteria | 1971 |
| 52 | Ga0075367_10022937 | 3300006178 | Bacteria | 3507 |
| 53 | Ga0075431_100176755 | 3300006847 | Bacteria | 2192 |
| 54 | Ga0068865_100022844 | 3300006881 | Bacteria | 4087 |
| 55 | Ga0111539_10013921 | 3300009094 | Bacteria | 10056 |
| 56 | Ga0105245_10000417 | 3300009098 | Bacteria | 39694 |
| 57 | Ga0105245_10094008 | 3300009098 | Bacteria | 2763 |
| 58 | Ga0105242_10061623 | 3300009176 | Bacteria | 3085 |
| 59 | Ga0105249_10066256 | 3300009553 | Bacteria | 3324 |
| 60 | Ga0105239_10025071 | 3300010375 | Bacteria | 6569 |
| 61 | Ga0105239_10167643 | 3300010375 | Bacteria | 2456 |
| 62 | Ga0105246_10001919 | 3300011119 | Bacteria | 12524 |
| 63 | Ga0105246_10042066 | 3300011119 | Bacteria | 3093 |
| 64 | Ga0157369_10297017 | 3300013105 | Bacteria | 1681 |
| 65 | Ga0157369_10403099 | 3300013105 | Bacteria | 1419 |
| 66 | Ga0157375_10083082 | 3300013308 | Bacteria | 3247 |
| 67 | Ga0157375_10181855 | 3300013308 | Bacteria | 2254 |
| 68 | Ga0163163_10056856 | 3300014325 | Bacteria | 3867 |
| 69 | Ga0163163_10284261 | 3300014325 | Bacteria | 1706 |
| 70 | Ga0157377_10014381 | 3300014745 | Bacteria | 4026 |
| 71 | Ga0157379_10007454 | 3300014968 | Bacteria | 9473 |
| 72 | Ga0163161_10040806 | 3300017792 | Bacteria | 3334 |
| 73 | Ga0207647_10006675 | 3300025904 | Bacteria | 8384 |
| 74 | Ga0207647_10014279 | 3300025904 | Bacteria | 5479 |
| 75 | Ga0207705_10037642 | 3300025909 | Bacteria | 3462 |
| 76 | Ga0207657_10138415 | 3300025919 | Bacteria | 1991 |
| 77 | Ga0207646_10065838 | 3300025922 | Bacteria | 3235 |
| 78 | Ga0207650_10123580 | 3300025925 | Bacteria | 2017 |
| 79 | Ga0207687_10206793 | 3300025927 | Bacteria | 1538 |
| 80 | Ga0207690_10074204 | 3300025932 | Bacteria | 2356 |
| 81 | Ga0207706_10070264 | 3300025933 | Bacteria | 3080 |
| 82 | Ga0207704_10300635 | 3300025938 | Bacteria | 1229 |
| 83 | Ga0207691_10125415 | 3300025940 | Bacteria | 2272 |
| 84 | Ga0207691_10286751 | 3300025940 | Bacteria | 1416 |
| 85 | Ga0207661_10150323 | 3300025944 | Bacteria | 2012 |
| 86 | Ga0207679_10031051 | 3300025945 | Bacteria | 3737 |
| 87 | Ga0207712_10082339 | 3300025961 | Bacteria | 2346 |
| 88 | Ga0207668_10015064 | 3300025972 | Bacteria | 4799 |
| 89 | Ga0207677_10004680 | 3300026023 | Bacteria | 7372 |
| 90 | Ga0207703_10028425 | 3300026035 | Bacteria | 4408 |
| 91 | Ga0207678_10000555 | 3300026067 | Bacteria | 34090 |
| 92 | Ga0207678_10070714 | 3300026067 | Bacteria | 2992 |
| 93 | Ga0207702_10419415 | 3300026078 | Bacteria | 1294 |
| 94 | Ga0207674_10007788 | 3300026116 | Bacteria | 12460 |
| 95 | Ga0207674_10020010 | 3300026116 | Bacteria | 7242 |
| 96 | Ga0207675_100099310 | 3300026118 | Bacteria | 2742 |
| 97 | Ga0207698_10144723 | 3300026142 | Bacteria | 2054 |
| 98 | Ga0209813_10028902 | 3300027866 | Bacteria | 1620 |
| 99 | Ga0207428_10089359 | 3300027907 | Bacteria | 2394 |
| 100 | Ga0268266_10003293 | 3300028379 | Bacteria | 16233 |
| 101 | Ga0268264_10000664 | 3300028381 | Bacteria | 40313 |
| 102 | Ga0307517_10091264 | 3300028786 | Bacteria | 2490 |
| 103 | Ga0307515_10018497 | 3300028794 | Bacteria | 12599 |
| 104 | Ga0307515_10018851 | 3300028794 | Bacteria | 12458 |
| 105 | Ga0307515_10022037 | 3300028794 | Bacteria | 11252 |
| 106 | Ga0307515_10029011 | 3300028794 | Bacteria | 9377 |
| 107 | Ga0307512_10007441 | 3300030522 | Bacteria | 10867 |
| 108 | Ga0307512_10009763 | 3300030522 | Bacteria | 9218 |
| 109 | Ga0265327_10002363 | 3300031251 | Bacteria | 20105 |
| 110 | Ga0307513_10006905 | 3300031456 | Bacteria | 14777 |
| 111 | Ga0307513_10049030 | 3300031456 | Bacteria | 4576 |
| 112 | Ga0307508_10198746 | 3300031616 | Bacteria | 1606 |
| 113 | Ga0316576_10038584 | 3300031727 | Bacteria | 3426 |
| 114 | Ga0307413_10030450 | 3300031824 | Bacteria | 3032 |
| 115 | Ga0307518_10001260 | 3300031838 | Bacteria | 19022 |
| 116 | Ga0307406_10069192 | 3300031901 | Bacteria | 2307 |
| 117 | Ga0307409_100027743 | 3300031995 | Bacteria | 4019 |
| 118 | Ga0307409_100090085 | 3300031995 | Bacteria | 2510 |
| 119 | Ga0307409_100195061 | 3300031995 | Bacteria | 1806 |
| 120 | Ga0307409_100454446 | 3300031995 | Bacteria | 1237 |
| 121 | Ga0307416_100052618 | 3300032002 | Bacteria | 3261 |
| 122 | Ga0307416_100278415 | 3300032002 | Bacteria | 1648 |
| 123 | Ga0307415_100015782 | 3300032126 | Bacteria | 4484 |
| 124 | Ga0307415_100025312 | 3300032126 | Bacteria | 3721 |
| 125 | Ga0307415_100146441 | 3300032126 | Bacteria | 1811 |
| 126 | Ga0307507_10000084 | 3300033179 | Bacteria | 145642 |
| 127 | Ga0395898_0132769 | 3300037466 | Bacteria | 2384 |
| 128 | Ga0436364_0023063 | 3300037853 | Bacteria | 2121 |
| 129 | Ga0436364_0438602 | 3300037853 | Bacteria | 13999 |
| 130 | Ga0436365_0278091 | 3300039437 | Bacteria | 4463 |
| 131 | Ga0466969_0029706 | 3300044656 | Bacteria | 2790 |
| 132 | Ga0466972_0025496 | 3300044658 | Bacteria | 2931 |
| 133 | Ga0466966_0010226 | 3300044684 | Bacteria | 6224 |
| 134 | Ga0466961_0077252 | 3300044693 | Bacteria | 2109 |
| 135 | Ga0466963_0006378 | 3300044694 | Bacteria | 6980 |
| 136 | Ga0466963_0079563 | 3300044694 | Bacteria | 2218 |
| 137 | Ga0466963_0098575 | 3300044694 | Bacteria | 1998 |
| 138 | Ga0466964_0023592 | 3300044706 | Bacteria | 2392 |
| 139 | Ga0466971_0015331 | 3300044719 | Bacteria | 3372 |
| 140 | Ga0466970_0079628 | 3300044765 | Bacteria | 1769 |
| 141 | Ga0466960_0027261 | 3300044901 | Bacteria | 2604 |
| 142 | Ga0466959_0002716 | 3300045049 | Bacteria | 11371 |
| 143 | Ga0466967_0009448 | 3300045976 | Bacteria | 7234 |
| 144 | Ga0466967_0022630 | 3300045976 | Bacteria | 5134 |
| 145 | Ga0466967_0061397 | 3300045976 | Bacteria | 3334 |
| 146 | Ga0466967_0143681 | 3300045976 | Bacteria | 2224 |
| 147 | Ga0495668_0000407 | 3300046616 | Bacteria | 56229 |
| 148 | Ga0495581_0077803 | 3300047315 | Bacteria | 1920 |
| 149 | Ga0495675_0023923 | 3300047444 | Bacteria | 3892 |
| 150 | Ga0495593_0097074 | 3300047673 | Bacteria | 1514 |
| 151 | Ga0496100_0182239 | 3300048903 | Bacteria | 1519 |
| 152 | Ga0496101_0014944 | 3300048904 | Bacteria | 5223 |
| 153 | Ga0496101_0040247 | 3300048904 | Bacteria | 3329 |
| 154 | Ga0496102_0051356 | 3300048905 | Bacteria | 3756 |
| 155 | Ga0496103_0030019 | 3300048906 | Bacteria | 3306 |
| 156 | Ga0496104_0044081 | 3300048907 | Bacteria | 4191 |
| 157 | Ga0496104_0155227 | 3300048907 | Bacteria | 2197 |
| 158 | Ga0496104_0238901 | 3300048907 | Bacteria | 1729 |
| 159 | Ga0496105_0018117 | 3300048908 | Bacteria | 5652 |
| 160 | Ga0496105_0078026 | 3300048908 | Bacteria | 2735 |
| 161 | Ga0496106_0199913 | 3300048909 | Bacteria | 1590 |
| 162 | Ga0496107_0034087 | 3300048910 | Bacteria | 3644 |
| 163 | Ga0496108_0008265 | 3300048911 | Bacteria | 8442 |
| 164 | Ga0496108_0054678 | 3300048911 | Bacteria | 3350 |
| 165 | Ga0496108_0058900 | 3300048911 | Bacteria | 3230 |
| 166 | Ga0496108_0314680 | 3300048911 | Bacteria | 1364 |
| 167 | Ga0496109_0001430 | 3300048912 | Bacteria | 19793 |
| 168 | Ga0496109_0015299 | 3300048912 | Bacteria | 6682 |
| 169 | Ga0496109_0023621 | 3300048912 | Bacteria | 5458 |
| 170 | Ga0496109_0049625 | 3300048912 | Bacteria | 3821 |
| 171 | Ga0496109_0251996 | 3300048912 | Bacteria | 1663 |
| 172 | Ga0496110_0077774 | 3300048913 | Bacteria | 2952 |
| 173 | Ga0496110_0080505 | 3300048913 | Bacteria | 2902 |
| 174 | Ga0496110_0202245 | 3300048913 | Bacteria | 1805 |
| 175 | Ga0496111_0022669 | 3300048914 | Bacteria | 4399 |
| 176 | Ga0496111_0086529 | 3300048914 | Bacteria | 2293 |
| 177 | Ga0496111_0213139 | 3300048914 | Bacteria | 1434 |
| 178 | Ga0496112_0255976 | 3300048915 | Bacteria | 1701 |
| 179 | Ga0496113_0036171 | 3300048916 | Bacteria | 3616 |
| 180 | Ga0496114_0008922 | 3300048917 | Bacteria | 7950 |
| 181 | Ga0496114_0014922 | 3300048917 | Bacteria | 6244 |
| 182 | Ga0496114_0016566 | 3300048917 | Bacteria | 5941 |
| 183 | Ga0496115_0013984 | 3300048918 | Bacteria | 6074 |
| 184 | Ga0501067_0046305 | 3300049583 | Bacteria | 2414 |
| 185 | Ga0501067_0059095 | 3300049583 | Bacteria | 2123 |
| 186 | Ga0501068_0120091 | 3300049584 | Bacteria | 1638 |
| 187 | Ga0501070_0237433 | 3300049586 | Bacteria | 1492 |
| 188 | Ga0501071_0057598 | 3300049587 | Bacteria | 2809 |
| 189 | nmdc:mga03683_40712_c1 | 3300050489 | Bacteria | 1907 |
| 190 | nmdc:mga03n38_18960_c1 | 3300050490 | Bacteria | 2724 |
| 191 | nmdc:mga03n38_94922_c1 | 3300050490 | Bacteria | 1428 |
| 192 | nmdc:mga00v17_173893_c1 | 3300050491 | Bacteria | 1389 |
| 193 | nmdc:mga0yw44_154276_c1 | 3300050492 | Bacteria | 1500 |
| 194 | nmdc:mga0yw44_56592_c1 | 3300050492 | Bacteria | 2390 |
| 195 | nmdc:mga06z11_157527_c1 | 3300050494 | Bacteria | 1296 |
| 196 | nmdc:mga04h51_11352_c1 | 3300050495 | Bacteria | 2470 |
| 197 | nmdc:mga04h51_7279_c1 | 3300050495 | Bacteria | 2913 |
| 198 | nmdc:mga07m45_30769_c1 | 3300050496 | Bacteria | 2974 |
| 199 | nmdc:mga06r32_188864_c1 | 3300050510 | Bacteria | 2048 |
| 200 | nmdc:mga06r32_196307_c1 | 3300050510 | Bacteria | 2006 |
| 201 | nmdc:mga08y16_59354_c1 | 3300050511 | Bacteria | 3996 |
| 202 | Ga0495601_0124377 | 3300053077 | Bacteria | 1677 |
| 203 | Ga0495619_0013266 | 3300053085 | Bacteria | 5193 |
| 204 | Ga0500644_0000204 | 3300053088 | Bacteria | 35880 |
| 205 | Ga0500594_0011063 | 3300053118 | Bacteria | 2104 |
| 206 | Ga0500652_044462 | 3300053131 | Bacteria | 1798 |
| 207 | Ga0500573_0015113 | 3300053140 | Bacteria | 4373 |
| 208 | Ga0500600_0079956 | 3300053149 | Bacteria | 1770 |
| 209 | Ga0501082_0205538 | 3300060353 | Bacteria | 1713 |
| 210 | 2566992556 | 2565956761 | Bacteria | 6601618 |
| 211 | 2583151226 | 2582580736 | Bacteria | 5325865 |
| 212 | 2586062206 | 2585427649 | Bacteria | 9053857 |
| 213 | 2644016911 | 2643221601 | Bacteria | 7493239 |
| 214 | 2644177953 | 2643221631 | Bacteria | 8168043 |
| 215 | 2738887549 | 2738541308 | Bacteria | 7020677 |
| 216 | 2791911555 | 2791354901 | Bacteria | 8322202 |
| 217 | 2795782614 | 2795385470 | Bacteria | 8317180 |
| 218 | 2795793121 | 2795385472 | Bacteria | 6627535 |
| 219 | 2816422391 | 2816332119 | Bacteria | 8120218 |
| 220 | 2866614616 | 2866612099 | Bacteria | 7543886 |
| 221 | 2870790296 | 2870782633 | Bacteria | 9624083 |
| 222 | 2891327711 | 2891326441 | Bacteria | 6439512 |
| 223 | 2899368223 | 2899359706 | Bacteria | 10940472 |
| 224 | 2899372834 | 2899370129 | Bacteria | 6781179 |
| 225 | 2904541582 | 2904535858 | Bacteria | 6308016 |
| 226 | 2912728593 | 2912723979 | Bacteria | 8557534 |
| 227 | 2917739416 | 2917736166 | Bacteria | 9690793 |
| 228 | 2919715331 | 2919713450 | Bacteria | 7431245 |
| 229 | 2922560041 | 2922554459 | Bacteria | 6683962 |
| 230 | 2995467549 | 2995463766 | Bacteria | 8577691 |
| 231 | 3006397613 | 3006393351 | Bacteria | 6615579 |
| 232 | 8003323795 | 8003314358 | Bacteria | 10575343 |
| 233 | 8056063484 | 8056060235 | Bacteria | 7259403 |
| 234 | 8056669625 | 8056667051 | Bacteria | 6953971 |
| 235 | Ga0206353_11595085 | |||
| 236 | LJQas_1006020 | |||
| 237 | JGI25406J46586_10020527 | |||
| 238 | rootH2_10107091 | |||
| 239 | Ga0070658_10068621 | |||
| 240 | Ga0070683_100005394 | |||
| 241 | Ga0070683_100010370 | |||
| 242 | Ga0068869_100014817 | |||
| 243 | Ga0068868_100004095 | |||
| 244 | Ga0070660_100139391 | |||
| 245 | Ga0070661_100009176 | |||
| 246 | Ga0070692_10025591 | |||
| 247 | Ga0070668_100076286 | |||
| 248 | Ga0070675_100006538 | |||
| 249 | Ga0070659_100063628 | |||
| 250 | Ga0070667_100035773 | |||
| 251 | Ga0070663_100005241 | |||
| 252 | Ga0070663_100051756 | |||
| 253 | Ga0070678_100119138 | |||
| 254 | Ga0070662_100058863 | |||
| 255 | Ga0070679_100007453 | |||
| 256 | Ga0070672_100169549 | |||
| 257 | Ga0070665_100002429 | |||
| 258 | Ga0070664_100002541 | |||
| 259 | Ga0068857_100014774 | |||
| 260 | Ga0068857_100254692 | |||
| 261 | Ga0068852_100048672 | |||
| 262 | Ga0068864_100054580 | |||
| 263 | Ga0068864_100315800 | |||
| 264 | Ga0068866_10049235 | |||
| 265 | Ga0068861_100067248 | |||
| 266 | Ga0068861_100235862 | |||
| 267 | Ga0068870_10066982 | |||
| 268 | Ga0068858_100052389 | |||
| 269 | Ga0068858_100176530 | |||
| 270 | Ga0068860_100059973 | |||
| 271 | Ga0081455_10000297 | |||
| 272 | Ga0081455_10088146 | |||
| 273 | Ga0081539_10000125 | |||
| 274 | Ga0081539_10000451 | |||
| 275 | Ga0075365_10003497 | |||
| 276 | Ga0075365_10047930 | |||
| 277 | Ga0075368_10014274 | |||
| 278 | Ga0075368_10062189 | |||
| 279 | Ga0075363_100002571 | |||
| 280 | Ga0075363_100006196 | |||
| 281 | Ga0075363_100043370 | |||
| 282 | Ga0075364_10008475 | |||
| 283 | Ga0075364_10030251 | |||
| 284 | Ga0075364_10093345 | |||
| 285 | Ga0075364_10095984 | |||
| 286 | Ga0075367_10022937 | |||
| 287 | Ga0075431_100176755 | |||
| 288 | Ga0068865_100022844 | |||
| 289 | Ga0111539_10013921 | |||
| 290 | Ga0105245_10000417 | |||
| 291 | Ga0105245_10094008 | |||
| 292 | Ga0105242_10061623 | |||
| 293 | Ga0105249_10066256 | |||
| 294 | Ga0105239_10025071 | |||
| 295 | Ga0105239_10167643 | |||
| 296 | Ga0105246_10001919 | |||
| 297 | Ga0105246_10042066 | |||
| 298 | Ga0157369_10297017 | |||
| 299 | Ga0157369_10403099 | |||
| 300 | Ga0157375_10083082 | |||
| 301 | Ga0157375_10181855 | |||
| 302 | Ga0163163_10056856 | |||
| 303 | Ga0163163_10284261 | |||
| 304 | Ga0157377_10014381 | |||
| 305 | Ga0157379_10007454 | |||
| 306 | Ga0163161_10040806 | |||
| 307 | Ga0207647_10006675 | |||
| 308 | Ga0207647_10014279 | |||
| 309 | Ga0207705_10037642 | |||
| 310 | Ga0207657_10138415 | |||
| 311 | Ga0207646_10065838 | |||
| 312 | Ga0207650_10123580 | |||
| 313 | Ga0207687_10206793 | |||
| 314 | Ga0207690_10074204 | |||
| 315 | Ga0207706_10070264 | |||
| 316 | Ga0207704_10300635 | |||
| 317 | Ga0207691_10125415 | |||
| 318 | Ga0207691_10286751 | |||
| 319 | Ga0207661_10150323 | |||
| 320 | Ga0207679_10031051 | |||
| 321 | Ga0207712_10082339 | |||
| 322 | Ga0207668_10015064 | |||
| 323 | Ga0207677_10004680 | |||
| 324 | Ga0207703_10028425 | |||
| 325 | Ga0207678_10000555 | |||
| 326 | Ga0207678_10070714 | |||
| 327 | Ga0207702_10419415 | |||
| 328 | Ga0207674_10007788 | |||
| 329 | Ga0207674_10020010 | |||
| 330 | Ga0207675_100099310 | |||
| 331 | Ga0207698_10144723 | |||
| 332 | Ga0209813_10028902 | |||
| 333 | Ga0207428_10089359 | |||
| 334 | Ga0268266_10003293 | |||
| 335 | Ga0268264_10000664 | |||
| 336 | Ga0307517_10091264 | |||
| 337 | Ga0307515_10018497 | |||
| 338 | Ga0307515_10018851 | |||
| 339 | Ga0307515_10022037 | |||
| 340 | Ga0307515_10029011 | |||
| 341 | Ga0307512_10007441 | |||
| 342 | Ga0307512_10009763 | |||
| 343 | Ga0265327_10002363 | |||
| 344 | Ga0307513_10006905 | |||
| 345 | Ga0307513_10049030 | |||
| 346 | Ga0307508_10198746 | |||
| 347 | Ga0316576_10038584 | |||
| 348 | Ga0307413_10030450 | |||
| 349 | Ga0307518_10001260 | |||
| 350 | Ga0307406_10069192 | |||
| 351 | Ga0307409_100027743 | |||
| 352 | Ga0307409_100090085 | |||
| 353 | Ga0307409_100195061 | |||
| 354 | Ga0307409_100454446 | |||
| 355 | Ga0307416_100052618 | |||
| 356 | Ga0307416_100278415 | |||
| 357 | Ga0307415_100015782 | |||
| 358 | Ga0307415_100025312 | |||
| 359 | Ga0307415_100146441 | |||
| 360 | Ga0307507_10000084 | |||
| 361 | Ga0395898_0132769 | |||
| 362 | Ga0436364_0023063 | |||
| 363 | Ga0436364_0438602 | |||
| 364 | Ga0436365_0278091 | |||
| 365 | Ga0466969_0029706 | |||
| 366 | Ga0466972_0025496 | |||
| 367 | Ga0466966_0010226 | |||
| 368 | Ga0466961_0077252 | |||
| 369 | Ga0466963_0006378 | |||
| 370 | Ga0466963_0079563 | |||
| 371 | Ga0466963_0098575 | |||
| 372 | Ga0466964_0023592 | |||
| 373 | Ga0466971_0015331 | |||
| 374 | Ga0466970_0079628 | |||
| 375 | Ga0466960_0027261 | |||
| 376 | Ga0466959_0002716 | |||
| 377 | Ga0466967_0009448 | |||
| 378 | Ga0466967_0022630 | |||
| 379 | Ga0466967_0061397 | |||
| 380 | Ga0466967_0143681 | |||
| 381 | Ga0495668_0000407 | |||
| 382 | Ga0495581_0077803 | |||
| 383 | Ga0495675_0023923 | |||
| 384 | Ga0495593_0097074 | |||
| 385 | Ga0496100_0182239 | |||
| 386 | Ga0496101_0014944 | |||
| 387 | Ga0496101_0040247 | |||
| 388 | Ga0496102_0051356 | |||
| 389 | Ga0496103_0030019 | |||
| 390 | Ga0496104_0044081 | |||
| 391 | Ga0496104_0155227 | |||
| 392 | Ga0496104_0238901 | |||
| 393 | Ga0496105_0018117 | |||
| 394 | Ga0496105_0078026 | |||
| 395 | Ga0496106_0199913 | |||
| 396 | Ga0496107_0034087 | |||
| 397 | Ga0496108_0008265 | |||
| 398 | Ga0496108_0054678 | |||
| 399 | Ga0496108_0058900 | |||
| 400 | Ga0496108_0314680 | |||
| 401 | Ga0496109_0001430 | |||
| 402 | Ga0496109_0015299 | |||
| 403 | Ga0496109_0023621 | |||
| 404 | Ga0496109_0049625 | |||
| 405 | Ga0496109_0251996 | |||
| 406 | Ga0496110_0077774 | |||
| 407 | Ga0496110_0080505 | |||
| 408 | Ga0496110_0202245 | |||
| 409 | Ga0496111_0022669 | |||
| 410 | Ga0496111_0086529 | |||
| 411 | Ga0496111_0213139 | |||
| 412 | Ga0496112_0255976 | |||
| 413 | Ga0496113_0036171 | |||
| 414 | Ga0496114_0008922 | |||
| 415 | Ga0496114_0014922 | |||
| 416 | Ga0496114_0016566 | |||
| 417 | Ga0496115_0013984 | |||
| 418 | Ga0501067_0046305 | |||
| 419 | Ga0501067_0059095 | |||
| 420 | Ga0501068_0120091 | |||
| 421 | Ga0501070_0237433 | |||
| 422 | Ga0501071_0057598 | |||
| 423 | nmdc:mga03683_40712_c1 | |||
| 424 | nmdc:mga03n38_18960_c1 | |||
| 425 | nmdc:mga03n38_94922_c1 | |||
| 426 | nmdc:mga00v17_173893_c1 | |||
| 427 | nmdc:mga0yw44_154276_c1 | |||
| 428 | nmdc:mga0yw44_56592_c1 | |||
| 429 | nmdc:mga06z11_157527_c1 | |||
| 430 | nmdc:mga04h51_11352_c1 | |||
| 431 | nmdc:mga04h51_7279_c1 | |||
| 432 | nmdc:mga07m45_30769_c1 | |||
| 433 | nmdc:mga06r32_188864_c1 | |||
| 434 | nmdc:mga06r32_196307_c1 | |||
| 435 | nmdc:mga08y16_59354_c1 | |||
| 436 | Ga0495601_0124377 | |||
| 437 | Ga0495619_0013266 | |||
| 438 | Ga0500644_0000204 | |||
| 439 | Ga0500594_0011063 | |||
| 440 | Ga0500652_044462 | |||
| 441 | Ga0500573_0015113 | |||
| 442 | Ga0500600_0079956 | |||
| 443 | Ga0501082_0205538 | |||
| 444 | 2566992556 | |||
| 445 | 2583151226 | |||
| 446 | 2586062206 | |||
| 447 | 2644016911 | |||
| 448 | 2644177953 | |||
| 449 | 2738887549 | |||
| 450 | 2791911555 | |||
| 451 | 2795782614 | |||
| 452 | 2795793121 | |||
| 453 | 2816422391 | |||
| 454 | 2866614616 | |||
| 455 | 2870790296 | |||
| 456 | 2891327711 | |||
| 457 | 2899368223 | |||
| 458 | 2899372834 | |||
| 459 | 2904541582 | |||
| 460 | 2912728593 | |||
| 461 | 2917739416 | |||
| 462 | 2919715331 | |||
| 463 | 2922560041 | |||
| 464 | 2995467549 | |||
| 465 | 3006397613 | |||
| 466 | 8003323795 | |||
| 467 | 8056063484 | |||
| 468 | 8056669625 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n5f-assembly1.cif.gz_A-2 | crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 | 0.9354 | 8 | 373 |
| 3mpi-assembly2.cif.gz_C | structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex | 0.9327 | 4 | 381 |
| 3mdd-assembly1.cif.gz_A | crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate | 0.9296 | 5 | 378 |
| 5ol2-assembly2.cif.gz_F | the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile | 0.9272 | 8 | 377 |
| 2vig-assembly1.cif.gz_A | crystal structure of human short-chain acyl coa dehydrogenase | 0.9267 | 8 | 378 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQG3_234_382_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9921 | 230 | 376 | 1.20.140.10 |
| af_P9WQG3_121_229_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9914 | 117 | 224 | 2.40.110.10 |
| 1t9gC03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9757 | 240 | 377 | 1.20.140.10 |
| 5lnxH03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9743 | 237 | 378 | 1.20.140.10 |
| 1t9gB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9739 | 240 | 377 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J6VZ32-F1-model_v4 | Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) | 0.9723 | 1 | 383 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A0J6VZ32-F1-model_v4 | Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) | 0.9698 | 1 | 383 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A6I0FAM6-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9585 | 7 | 383 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A2E4VLD0-F1-model_v4 | deleted | 0.9531 | 247 | 378 |
|
| AF-A0A2N5GDE7-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9525 | 4 | 383 |
GO:0003995
GO:0050660 |