F347140

General Info

Members Datasets Scaffolds Average Seq Length
234 161 468 345

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10159547|Ga0163161_101595472
Length 364
Sequence MHYREFGQHRRMFIRQLFNRKEYPVKGILLALGLLVTSFSSMGADMSNGADNFYKGDKVTVEKVTFKNQYGMKVAGNLFTPKDLDPESRNAAIIVGHPMGAVKEQSANLYATKMAEQGFVTLSLDLSFWGESEGTPRHAVSPDIYAEDFSAAVDFLGTRPIVDRERIGVLGICGSGSFAISAAKIDPRLKAIATVSMYDMGAANRNGLKHGVTAEQRQQIIREAAQQRDVEFQGGQTRYTSGSPLKLTGNAVGDEFYDFYRTPRGEVTPAGASAQTTTMPTLTSNVKFMNFYPFNDIESISPRPLLFISGAQAHSREFSEDAYKRAAEPKELLIIPDAGHVDLYDRVNLIPFARLTTFFKSNLK

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
21 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
50 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
51 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
55 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
77 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
95 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
118 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
119 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
120 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
127 2511231031 Pseudomonas sp. GM16 Isolate Nodule
128 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
129 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
130 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
131 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
132 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
133 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
134 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
135 2643221607 Rhizobium sp. Root73 Isolate Unclassified
136 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
137 2643221732 Bacillus sp. Root239 Isolate Unclassified
138 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
139 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
140 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
141 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
142 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
143 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
144 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
145 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
146 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
147 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
148 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
149 2842747753 Variovorax sp. R-72060 Isolate Unclassified
150 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
151 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
152 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
153 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
154 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
155 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
156 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
157 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
158 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
159 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
160 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
161 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 2.14
Rhizoplane 1.71
Rhizosphere 71.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10159547 3300017792 Bacteria 1719
2 JGI25152J39213_1001854 3300002773 Bacteria 8518
3 JGI25153J46596_10003577 3300003215 Bacteria 8639
4 JGI25160J50197_1013312 3300003354 Bacteria 2810
5 Ga0055528_1013021 3300003790 Bacteria 3184
6 Ga0065714_10004032 3300005288 Bacteria 5826
7 Ga0065714_10006232 3300005288 Bacteria 3946
8 Ga0070687_100001303 3300005343 Bacteria 8705
9 Ga0068864_100203719 3300005618 Bacteria 1819
10 Ga0081455_10002757 3300005937 Bacteria 20732
11 Ga0081455_10101168 3300005937 Bacteria 2313
12 Ga0075365_10001219 3300006038 Bacteria 11363
13 Ga0075364_10000311 3300006051 Bacteria 23806
14 Ga0105251_10022648 3300009011 Bacteria 3256
15 Ga0105250_10001933 3300009092 Bacteria 10765
16 Ga0157373_10000039 3300013100 Bacteria 117160
17 Ga0157373_10000184 3300013100 Bacteria 51738
18 Ga0157373_10120227 3300013100 Bacteria 1846
19 Ga0157371_10007196 3300013102 Bacteria 9040
20 Ga0157370_10141293 3300013104 Bacteria 2243
21 Ga0157369_10003854 3300013105 Bacteria 17824
22 Ga0163162_10000067 3300013306 Bacteria 99435
23 Ga0157375_10481726 3300013308 Bacteria 1406
24 Ga0163161_10000577 3300017792 Bacteria 29489
25 Ga0163161_10037916 3300017792 Bacteria 3455
26 Ga0163161_10142623 3300017792 Bacteria 1815
27 Ga0209129_1002445 3300025258 Bacteria 9115
28 Ga0209673_1034789 3300025273 Bacteria 1516
29 Ga0209130_1022466 3300025284 Bacteria 1407
30 Ga0209676_1002483 3300025292 Bacteria 12975
31 Ga0209025_1007612 3300025294 Bacteria 8020
32 Ga0209564_1017419 3300025295 Bacteria 2800
33 Ga0209758_1008179 3300025297 Bacteria 6860
34 Ga0209050_1004975 3300025298 Bacteria 8651
35 Ga0209256_1021122 3300025299 Bacteria 2010
36 Ga0207426_1004253 3300025302 Bacteria 7104
37 Ga0209051_1004463 3300025303 Bacteria 8614
38 Ga0207696_1009993 3300025711 Bacteria 3504
39 Ga0207662_10004962 3300025918 Bacteria 7039
40 Ga0207700_10082916 3300025928 Bacteria 2509
41 Ga0209973_1002686 3300027252 Bacteria 1691
42 Ga0307408_100000044 3300031548 Bacteria 169498
43 Ga0307408_100008061 3300031548 Bacteria 6965
44 Ga0307405_10032086 3300031731 Bacteria 3100
45 Ga0307410_10000806 3300031852 Bacteria 13255
46 Ga0307406_10000460 3300031901 Bacteria 23579
47 Ga0307406_10044461 3300031901 Bacteria 2783
48 Ga0307406_10216830 3300031901 Bacteria 1420
49 Ga0307407_10005190 3300031903 Bacteria 5622
50 Ga0307412_10030925 3300031911 Bacteria 3376
51 Ga0307409_100003653 3300031995 Bacteria 8416
52 Ga0307409_100073465 3300031995 Bacteria 2728
53 Ga0307416_100002492 3300032002 Bacteria 10588
54 Ga0307414_10010733 3300032004 Bacteria 5335
55 Ga0307411_10000774 3300032005 Bacteria 11851
56 Ga0307415_100008664 3300032126 Bacteria 5655
57 Ga0373923_0000872 3300035111 Bacteria 8011
58 Ga0395900_0178989 3300037418 Bacteria 2156
59 Ga0395905_0240510 3300037471 Bacteria 1692
60 Ga0451837_0462671 3300041494 Bacteria 1733
61 Ga0450890_000302 3300042127 Bacteria 7128
62 Ga0495617_000155 3300046452 Bacteria 43743
63 Ga0495627_000101 3300046453 Bacteria 105414
64 Ga0495627_000133 3300046453 Bacteria 89977
65 Ga0495627_000429 3300046453 Bacteria 36476
66 Ga0495603_0037185 3300046455 Bacteria 2921
67 Ga0495590_0009555 3300046457 Bacteria 3680
68 Ga0495591_000120 3300046458 Bacteria 86214
69 Ga0495591_006921 3300046458 Bacteria 4907
70 Ga0495629_0144625 3300046459 Bacteria 1654
71 Ga0495638_0070842 3300046460 Bacteria 2133
72 Ga0495653_0105714 3300046463 Bacteria 2031
73 Ga0495650_0001483 3300046471 Bacteria 22473
74 Ga0495650_0009781 3300046471 Bacteria 5420
75 Ga0495605_0000147 3300046474 Bacteria 90988
76 Ga0495605_0000711 3300046474 Bacteria 24596
77 Ga0495584_0002059 3300046491 Bacteria 11538
78 Ga0495585_0075423 3300046492 Bacteria 1833
79 Ga0495585_0102546 3300046492 Bacteria 1529
80 Ga0495607_0000209 3300046501 Bacteria 62350
81 Ga0495607_0001938 3300046501 Bacteria 17481
82 Ga0495607_0003558 3300046501 Bacteria 11864
83 Ga0495607_0076480 3300046501 Bacteria 1851
84 Ga0495583_0005145 3300046506 Bacteria 9011
85 Ga0495583_0043956 3300046506 Bacteria 2077
86 Ga0495606_0000634 3300046507 Bacteria 55249
87 Ga0495606_0001897 3300046507 Bacteria 26096
88 Ga0495606_0010010 3300046507 Bacteria 7928
89 Ga0495610_0000173 3300046512 Bacteria 72402
90 Ga0495610_0018161 3300046512 Bacteria 3980
91 Ga0495616_0000041 3300046513 Bacteria 122413
92 Ga0495616_0000166 3300046513 Bacteria 57340
93 Ga0495616_0000479 3300046513 Bacteria 30376
94 Ga0495620_0050319 3300046515 Bacteria 1778
95 Ga0495631_0000013 3300046518 Bacteria 109794
96 Ga0495631_0048040 3300046518 Bacteria 1872
97 Ga0495632_0000334 3300046519 Bacteria 44800
98 Ga0495637_0001392 3300046520 Bacteria 14426
99 Ga0495637_0002666 3300046520 Bacteria 9751
100 Ga0495637_0017909 3300046520 Bacteria 3292
101 Ga0495637_0030284 3300046520 Bacteria 2401
102 Ga0495643_0000625 3300046522 Bacteria 42011
103 Ga0495643_0001663 3300046522 Bacteria 19510
104 Ga0495648_0000172 3300046524 Bacteria 74485
105 Ga0495648_0004767 3300046524 Bacteria 11480
106 Ga0495648_0009456 3300046524 Bacteria 7551
107 Ga0495642_0000229 3300046528 Bacteria 32047
108 Ga0495654_0000043 3300046530 Bacteria 161913
109 Ga0495654_0016695 3300046530 Bacteria 3872
110 Ga0495654_0070570 3300046530 Bacteria 1656
111 Ga0495609_0000286 3300046538 Bacteria 46726
112 Ga0495609_0001870 3300046538 Bacteria 13457
113 Ga0495609_0014454 3300046538 Bacteria 3708
114 Ga0495597_0000117 3300046542 Bacteria 71911
115 Ga0495597_0001007 3300046542 Bacteria 21597
116 Ga0495633_0000564 3300046558 Bacteria 36203
117 Ga0495633_0057262 3300046558 Bacteria 1831
118 Ga0495633_0140593 3300046558 Bacteria 1116
119 Ga0495668_0010707 3300046616 Bacteria 5538
120 Ga0495611_0000024 3300046648 Bacteria 118898
121 Ga0495611_0000896 3300046648 Bacteria 16192
122 Ga0495625_0000103 3300046660 Bacteria 136109
123 Ga0495625_0000397 3300046660 Bacteria 66539
124 Ga0495625_0007929 3300046660 Bacteria 9128
125 Ga0495625_0008057 3300046660 Bacteria 9035
126 Ga0495625_0025799 3300046660 Bacteria 4450
127 Ga0495659_0075541 3300046664 Bacteria 1269
128 Ga0495661_0034761 3300046665 Bacteria 3168
129 Ga0495661_0104259 3300046665 Bacteria 1590
130 Ga0495661_0176555 3300046665 Bacteria 1135
131 Ga0495624_0037776 3300046690 Bacteria 3105
132 Ga0495670_0000020 3300046691 Bacteria 110171
133 Ga0495671_0002566 3300046692 Bacteria 11422
134 Ga0495649_0001598 3300046694 Bacteria 16904
135 Ga0495649_0029941 3300046694 Bacteria 3007
136 Ga0495589_0000057 3300046794 Bacteria 108136
137 Ga0495589_0000167 3300046794 Bacteria 59964
138 Ga0495589_0025404 3300046794 Bacteria 3006
139 Ga0495660_0000753 3300046810 Bacteria 24442
140 Ga0495660_0002399 3300046810 Bacteria 11962
141 Ga0495660_0004217 3300046810 Bacteria 8735
142 Ga0495660_0013192 3300046810 Bacteria 4787
143 Ga0495660_0040326 3300046810 Bacteria 2588
144 Ga0495660_0068145 3300046810 Bacteria 1894
145 Ga0495636_0000444 3300047318 Bacteria 15292
146 Ga0495672_0000317 3300047320 Bacteria 64031
147 Ga0495672_0003616 3300047320 Bacteria 13109
148 Ga0495676_0000058 3300047321 Bacteria 86045
149 Ga0495687_028539 3300047443 Bacteria 2595
150 Ga0495679_030325 3300047446 Bacteria 1756
151 Ga0495673_0000231 3300047469 Bacteria 81316
152 Ga0495673_0001683 3300047469 Bacteria 16993
153 Ga0495673_0005992 3300047469 Bacteria 7230
154 Ga0495673_0007428 3300047469 Bacteria 6301
155 Ga0495673_0039295 3300047469 Bacteria 2147
156 Ga0495673_0078153 3300047469 Bacteria 1376
157 Ga0495681_0002512 3300047470 Bacteria 13070
158 Ga0495686_0000266 3300047472 Bacteria 93781
159 Ga0495686_0055474 3300047472 Bacteria 2477
160 Ga0495626_0000074 3300048091 Bacteria 132552
161 Ga0495626_0001686 3300048091 Bacteria 17020
162 Ga0495626_0004167 3300048091 Bacteria 8976
163 Ga0495626_0007805 3300048091 Bacteria 5927
164 Ga0496116_0000255 3300048919 Bacteria 94048
165 Ga0496121_0000538 3300048924 Bacteria 72143
166 Ga0496121_0005437 3300048924 Bacteria 16329
167 Ga0496121_0303240 3300048924 Bacteria 1083
168 Ga0496122_0001188 3300048925 Bacteria 44580
169 Ga0496123_0000329 3300048926 Bacteria 90380
170 Ga0496123_0112376 3300048926 Bacteria 1554
171 Ga0496124_0267937 3300048927 Bacteria 1252
172 Ga0496125_0100806 3300048928 Bacteria 2127
173 Ga0495678_000222 3300049459 Bacteria 65798
174 Ga0495678_002054 3300049459 Bacteria 14395
175 Ga0495678_002659 3300049459 Bacteria 11838
176 Ga0495678_013157 3300049459 Bacteria 3895
177 Ga0495682_0000085 3300049460 Bacteria 81879
178 Ga0501034_0060956 3300049571 Bacteria 3790
179 Ga0501043_0167857 3300049579 Bacteria 1713
180 Ga0501073_0176402 3300049589 Bacteria 1479
181 Ga0501080_0492109 3300049742 Bacteria 1097
182 Ga0501083_0059195 3300049744 Bacteria 2562
183 nmdc:mga00v17_2305_c1 3300050491 Bacteria 9791
184 nmdc:mga0yw44_863_c1 3300050492 Bacteria 11369
185 nmdc:mga07m45_29084_c1 3300050496 Bacteria 3053
186 Ga0500635_0000029 3300053080 Bacteria 100914
187 Ga0500651_0000136 3300053093 Bacteria 45911
188 Ga0500556_0002036 3300053104 Bacteria 7032
189 Ga0500594_0008620 3300053118 Bacteria 2328
190 Ga0500658_0000533 3300053134 Bacteria 16061
191 Ga0500658_0001580 3300053134 Bacteria 9100
192 Ga0500559_0014752 3300053136 Bacteria 3301
193 Ga0500568_0000280 3300053139 Bacteria 42298
194 Ga0500574_000423 3300053141 Bacteria 5338
195 Ga0500616_0005497 3300053153 Bacteria 8593
196 Ga0500634_0058787 3300053161 Bacteria 2047
197 Ga0500636_0000212 3300053177 Bacteria 31559
198 Ga0500649_024905 3300053722 Bacteria 2472
199 2511414474 2511231031 Bacteria 6558529
200 2513912667 2513237144 Bacteria 7530820
201 2585226719 2582581298 Bacteria 7315509
202 2585550134 2585427529 Bacteria 7395659
203 2586004658 2585427634 Bacteria 6455027
204 2599334381 2599185156 Bacteria 5403036
205 2601667553 2600255292 Bacteria 6300551
206 2616555796 2615840698 Bacteria 7319877
207 2644049756 2643221607 Bacteria 6314006
208 2644482037 2643221686 Bacteria 6310811
209 2644723112 2643221732 Bacteria 5756404
210 2677896190 2675903420 Bacteria 6247433
211 2738806540 2738541294 Bacteria 6925949
212 2738893900 2738541309 Bacteria 6926455
213 2770199756 2767802442 Bacteria 5747986
214 2770199760 2767802442 Bacteria 5747986
215 2776267189 2775506902 Bacteria 6208009
216 2776284937 2775506904 Bacteria 5954060
217 2808978852 2808606385 Bacteria 6711065
218 2808994584 2808606388 Bacteria 6706662
219 2812367007 2811994881 Bacteria 6298475
220 2817490396 2816332298 Bacteria 6852809
221 2821128985 2821123053 Bacteria 7836056
222 2842751888 2842747753 Bacteria 5578255
223 2842925336 2842922631 Bacteria 5824079
224 2857551726 2857547612 Bacteria 6179999
225 2885084958 2885080285 Bacteria 6355622
226 2921289868 2921289301 Bacteria 7316391
227 2923521045 2923519811 Bacteria 6298479
228 2928090868 2928084124 Bacteria 7159212
229 2928097042 2928093941 Bacteria 5965005
230 2945911029 2945909444 Bacteria 7065066
231 2954011719 2954011201 Bacteria 4762601
232 2969307042 2969304461 Bacteria 6601805
233 3000377807 3000376612 Bacteria 4705565
234 8056158007 8056155041 Bacteria 6486948
235 Ga0163161_10159547
236 JGI25152J39213_1001854
237 JGI25153J46596_10003577
238 JGI25160J50197_1013312
239 Ga0055528_1013021
240 Ga0065714_10004032
241 Ga0065714_10006232
242 Ga0070687_100001303
243 Ga0068864_100203719
244 Ga0081455_10002757
245 Ga0081455_10101168
246 Ga0075365_10001219
247 Ga0075364_10000311
248 Ga0105251_10022648
249 Ga0105250_10001933
250 Ga0157373_10000039
251 Ga0157373_10000184
252 Ga0157373_10120227
253 Ga0157371_10007196
254 Ga0157370_10141293
255 Ga0157369_10003854
256 Ga0163162_10000067
257 Ga0157375_10481726
258 Ga0163161_10000577
259 Ga0163161_10037916
260 Ga0163161_10142623
261 Ga0209129_1002445
262 Ga0209673_1034789
263 Ga0209130_1022466
264 Ga0209676_1002483
265 Ga0209025_1007612
266 Ga0209564_1017419
267 Ga0209758_1008179
268 Ga0209050_1004975
269 Ga0209256_1021122
270 Ga0207426_1004253
271 Ga0209051_1004463
272 Ga0207696_1009993
273 Ga0207662_10004962
274 Ga0207700_10082916
275 Ga0209973_1002686
276 Ga0307408_100000044
277 Ga0307408_100008061
278 Ga0307405_10032086
279 Ga0307410_10000806
280 Ga0307406_10000460
281 Ga0307406_10044461
282 Ga0307406_10216830
283 Ga0307407_10005190
284 Ga0307412_10030925
285 Ga0307409_100003653
286 Ga0307409_100073465
287 Ga0307416_100002492
288 Ga0307414_10010733
289 Ga0307411_10000774
290 Ga0307415_100008664
291 Ga0373923_0000872
292 Ga0395900_0178989
293 Ga0395905_0240510
294 Ga0451837_0462671
295 Ga0450890_000302
296 Ga0495617_000155
297 Ga0495627_000101
298 Ga0495627_000133
299 Ga0495627_000429
300 Ga0495603_0037185
301 Ga0495590_0009555
302 Ga0495591_000120
303 Ga0495591_006921
304 Ga0495629_0144625
305 Ga0495638_0070842
306 Ga0495653_0105714
307 Ga0495650_0001483
308 Ga0495650_0009781
309 Ga0495605_0000147
310 Ga0495605_0000711
311 Ga0495584_0002059
312 Ga0495585_0075423
313 Ga0495585_0102546
314 Ga0495607_0000209
315 Ga0495607_0001938
316 Ga0495607_0003558
317 Ga0495607_0076480
318 Ga0495583_0005145
319 Ga0495583_0043956
320 Ga0495606_0000634
321 Ga0495606_0001897
322 Ga0495606_0010010
323 Ga0495610_0000173
324 Ga0495610_0018161
325 Ga0495616_0000041
326 Ga0495616_0000166
327 Ga0495616_0000479
328 Ga0495620_0050319
329 Ga0495631_0000013
330 Ga0495631_0048040
331 Ga0495632_0000334
332 Ga0495637_0001392
333 Ga0495637_0002666
334 Ga0495637_0017909
335 Ga0495637_0030284
336 Ga0495643_0000625
337 Ga0495643_0001663
338 Ga0495648_0000172
339 Ga0495648_0004767
340 Ga0495648_0009456
341 Ga0495642_0000229
342 Ga0495654_0000043
343 Ga0495654_0016695
344 Ga0495654_0070570
345 Ga0495609_0000286
346 Ga0495609_0001870
347 Ga0495609_0014454
348 Ga0495597_0000117
349 Ga0495597_0001007
350 Ga0495633_0000564
351 Ga0495633_0057262
352 Ga0495633_0140593
353 Ga0495668_0010707
354 Ga0495611_0000024
355 Ga0495611_0000896
356 Ga0495625_0000103
357 Ga0495625_0000397
358 Ga0495625_0007929
359 Ga0495625_0008057
360 Ga0495625_0025799
361 Ga0495659_0075541
362 Ga0495661_0034761
363 Ga0495661_0104259
364 Ga0495661_0176555
365 Ga0495624_0037776
366 Ga0495670_0000020
367 Ga0495671_0002566
368 Ga0495649_0001598
369 Ga0495649_0029941
370 Ga0495589_0000057
371 Ga0495589_0000167
372 Ga0495589_0025404
373 Ga0495660_0000753
374 Ga0495660_0002399
375 Ga0495660_0004217
376 Ga0495660_0013192
377 Ga0495660_0040326
378 Ga0495660_0068145
379 Ga0495636_0000444
380 Ga0495672_0000317
381 Ga0495672_0003616
382 Ga0495676_0000058
383 Ga0495687_028539
384 Ga0495679_030325
385 Ga0495673_0000231
386 Ga0495673_0001683
387 Ga0495673_0005992
388 Ga0495673_0007428
389 Ga0495673_0039295
390 Ga0495673_0078153
391 Ga0495681_0002512
392 Ga0495686_0000266
393 Ga0495686_0055474
394 Ga0495626_0000074
395 Ga0495626_0001686
396 Ga0495626_0004167
397 Ga0495626_0007805
398 Ga0496116_0000255
399 Ga0496121_0000538
400 Ga0496121_0005437
401 Ga0496121_0303240
402 Ga0496122_0001188
403 Ga0496123_0000329
404 Ga0496123_0112376
405 Ga0496124_0267937
406 Ga0496125_0100806
407 Ga0495678_000222
408 Ga0495678_002054
409 Ga0495678_002659
410 Ga0495678_013157
411 Ga0495682_0000085
412 Ga0501034_0060956
413 Ga0501043_0167857
414 Ga0501073_0176402
415 Ga0501080_0492109
416 Ga0501083_0059195
417 nmdc:mga00v17_2305_c1
418 nmdc:mga0yw44_863_c1
419 nmdc:mga07m45_29084_c1
420 Ga0500635_0000029
421 Ga0500651_0000136
422 Ga0500556_0002036
423 Ga0500594_0008620
424 Ga0500658_0000533
425 Ga0500658_0001580
426 Ga0500559_0014752
427 Ga0500568_0000280
428 Ga0500574_000423
429 Ga0500616_0005497
430 Ga0500634_0058787
431 Ga0500636_0000212
432 Ga0500649_024905
433 2511414474
434 2513912667
435 2585226719
436 2585550134
437 2586004658
438 2599334381
439 2601667553
440 2616555796
441 2644049756
442 2644482037
443 2644723112
444 2677896190
445 2738806540
446 2738893900
447 2770199756
448 2770199760
449 2776267189
450 2776284937
451 2808978852
452 2808994584
453 2812367007
454 2817490396
455 2821128985
456 2842751888
457 2842925336
458 2857551726
459 2885084958
460 2921289868
461 2923521045
462 2928090868
463 2928097042
464 2945911029
465 2954011719
466 2969307042
467 3000377807
468 8056158007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

74

229

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hdw-assembly1.cif.gz_A crystal structure of hypothetical protein pa2218 from pseudomonas aeruginosa 0.8635 44 364
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8458 60 364
2hdw-assembly1.cif.gz_A crystal structure of hypothetical protein pa2218 from pseudomonas aeruginosa 0.8411 44 364
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8381 60 364
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.8092 61 365
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8976 44 364 3.40.50.1820
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8748 44 364 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8449 62 199 3.40.50.1820
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8238 56 219 3.40.50.1820
af_Q6ZGV2_2_204_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8059 62 346 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0M3C2I5-F1-model_v4 deleted 0.9434 52 189
AF-A0A7K2M7E6-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9377 60 198
AF-A0A6D0FAF7-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9325 60 191 GO:0016787
AF-A0A2T2YB19-F1-model_v4 Alpha/beta hydrolase 0.9228 60 186
AF-A0A7J9PL21-F1-model_v4 Fermentation-respiration switch protein FrsA (DUF1100 family) 0.9185 52 200 GO:0016787

Map