F346856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 137 | 232 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10293321|Ga0070681_102933212 |
| Length | 299 |
| Sequence | LVISLHAAVLNYLQPEKIYCMTPYTKSDVLLQARNLSLTYGDKCILHDINFCIRDIVRPGLLQGQVLSLVGRSGMGKTQLFRLLSGLQTPTSGSITIRQWKPAARSDGSIETYEERTVQPGDMGVIFQNYYQFGWRTVQQSLLLAARKNKALAGKEEDTVEHYLHQFDLPDVLHCYPQQLSGGQQQRVSIIQQLLKGSNFLLLDEPFSGLDVCVLDKVVELLLQVSLSDELKTLIIVSHDIATAVAISDTVFILGKQPGREGSTLVREIDLIERELAWRKDVREERAFAETIREIKACL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 102 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 108 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 109 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 110 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 111 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 112 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 113 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 114 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 125 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 126 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 128 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 129 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 130 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 131 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 132 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 133 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 134 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 135 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 136 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 137 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.68 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 79.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004645 | 3300003203 | Bacteria | 6393 |
| 2 | rootH1_10053884 | 3300003316 | Bacteria | 1204 |
| 3 | rootH1_10091706 | 3300003316 | Bacteria | 2788 |
| 4 | rootH2_10045077 | 3300003320 | Unclassified | 2112 |
| 5 | rootH2_10059393 | 3300003320 | Bacteria | 48659 |
| 6 | rootH2_10075686 | 3300003320 | Bacteria | 1992 |
| 7 | rootH2_10111247 | 3300003320 | Bacteria | 2456 |
| 8 | rootL2_10011349 | 3300003322 | Bacteria | 2439 |
| 9 | rootL2_10011547 | 3300003322 | Bacteria | 13234 |
| 10 | rootL2_10036409 | 3300003322 | Bacteria | 1205 |
| 11 | rootH1_10129966 | 3300003323 | Bacteria | 3483 |
| 12 | JGI25160J50197_1000423 | 3300003354 | Bacteria | 26634 |
| 13 | Ga0055535_1005489 | 3300003761 | Bacteria | 2761 |
| 14 | Ga0055542_1004766 | 3300003762 | Bacteria | 3194 |
| 15 | Ga0070683_100006746 | 3300005329 | Bacteria | 9640 |
| 16 | Ga0070670_100142863 | 3300005331 | Bacteria | 2070 |
| 17 | Ga0070670_100398997 | 3300005331 | Unclassified | 1214 |
| 18 | Ga0068869_100100368 | 3300005334 | Bacteria | 2188 |
| 19 | Ga0068869_100130088 | 3300005334 | Bacteria | 1934 |
| 20 | Ga0068869_100210324 | 3300005334 | Unclassified | 1537 |
| 21 | Ga0070666_10000208 | 3300005335 | Bacteria | 40242 |
| 22 | Ga0068868_100129781 | 3300005338 | Unclassified | 2062 |
| 23 | Ga0070691_10037472 | 3300005341 | Bacteria | 2288 |
| 24 | Ga0070661_100036192 | 3300005344 | Bacteria | 3589 |
| 25 | Ga0070668_100196191 | 3300005347 | Unclassified | 1656 |
| 26 | Ga0070675_100202840 | 3300005354 | Bacteria | 1721 |
| 27 | Ga0070671_100058661 | 3300005355 | Bacteria | 3203 |
| 28 | Ga0070667_100040044 | 3300005367 | Unclassified | 3929 |
| 29 | Ga0070663_100754429 | 3300005455 | Bacteria | 831 |
| 30 | Ga0070681_10293321 | 3300005458 | Bacteria | 1536 |
| 31 | Ga0068853_100024438 | 3300005539 | Bacteria | 5066 |
| 32 | Ga0068853_100372044 | 3300005539 | Bacteria | 1333 |
| 33 | Ga0068853_100405758 | 3300005539 | Bacteria | 1276 |
| 34 | Ga0070672_100232668 | 3300005543 | Bacteria | 1548 |
| 35 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 36 | Ga0068855_100028799 | 3300005563 | Bacteria | 6645 |
| 37 | Ga0070664_100004041 | 3300005564 | Bacteria | 11785 |
| 38 | Ga0070664_100097716 | 3300005564 | Bacteria | 2550 |
| 39 | Ga0070664_100113483 | 3300005564 | Bacteria | 2367 |
| 40 | Ga0070664_100214974 | 3300005564 | Bacteria | 1718 |
| 41 | Ga0070664_100256952 | 3300005564 | Bacteria | 1571 |
| 42 | Ga0068857_100006960 | 3300005577 | Bacteria | 9734 |
| 43 | Ga0068856_100061384 | 3300005614 | Bacteria | 3713 |
| 44 | Ga0068856_100158698 | 3300005614 | Bacteria | 2272 |
| 45 | Ga0068852_100002505 | 3300005616 | Bacteria | 12646 |
| 46 | Ga0068852_100158551 | 3300005616 | Bacteria | 2110 |
| 47 | Ga0068852_100266729 | 3300005616 | Unclassified | 1646 |
| 48 | Ga0068852_100517444 | 3300005616 | Bacteria | 1190 |
| 49 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 50 | Ga0068859_100001600 | 3300005617 | Bacteria | 23125 |
| 51 | Ga0068864_100002251 | 3300005618 | Bacteria | 15955 |
| 52 | Ga0068861_100082686 | 3300005719 | Bacteria | 2517 |
| 53 | Ga0068851_10033932 | 3300005834 | Unclassified | 2545 |
| 54 | Ga0068863_100011724 | 3300005841 | Bacteria | 8478 |
| 55 | Ga0068863_100028475 | 3300005841 | Bacteria | 5335 |
| 56 | Ga0068863_100535753 | 3300005841 | Bacteria | 1155 |
| 57 | Ga0068858_100000396 | 3300005842 | Bacteria | 45694 |
| 58 | Ga0068858_100242588 | 3300005842 | Bacteria | 1710 |
| 59 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 60 | Ga0068860_100011714 | 3300005843 | Bacteria | 8643 |
| 61 | Ga0081539_10004597 | 3300005985 | Bacteria | 15067 |
| 62 | Ga0075366_10029787 | 3300006195 | Bacteria | 3207 |
| 63 | Ga0097621_100016532 | 3300006237 | Bacteria | 5579 |
| 64 | Ga0097621_100204552 | 3300006237 | Bacteria | 1715 |
| 65 | Ga0068871_100038002 | 3300006358 | Unclassified | 3841 |
| 66 | Ga0068871_100102887 | 3300006358 | Unclassified | 2394 |
| 67 | Ga0068871_100201264 | 3300006358 | Bacteria | 1719 |
| 68 | Ga0068871_100348601 | 3300006358 | Bacteria | 1309 |
| 69 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 70 | Ga0097620_100001600 | 3300006931 | Bacteria | 23125 |
| 71 | Ga0105240_10000888 | 3300009093 | Bacteria | 53670 |
| 72 | Ga0105240_10000896 | 3300009093 | Bacteria | 53128 |
| 73 | Ga0105240_10004520 | 3300009093 | Bacteria | 21135 |
| 74 | Ga0105240_10020206 | 3300009093 | Bacteria | 8890 |
| 75 | Ga0114129_10008068 | 3300009147 | Bacteria | 15001 |
| 76 | Ga0105243_10099362 | 3300009148 | Bacteria | 2412 |
| 77 | Ga0105241_10000649 | 3300009174 | Bacteria | 26087 |
| 78 | Ga0105241_10001297 | 3300009174 | Bacteria | 19017 |
| 79 | Ga0105241_10173526 | 3300009174 | Unclassified | 1782 |
| 80 | Ga0105237_10000362 | 3300009545 | Bacteria | 64230 |
| 81 | Ga0105237_10000553 | 3300009545 | Bacteria | 52367 |
| 82 | Ga0105237_10000636 | 3300009545 | Bacteria | 49001 |
| 83 | Ga0105237_10002556 | 3300009545 | Bacteria | 22482 |
| 84 | Ga0105237_10005807 | 3300009545 | Bacteria | 13845 |
| 85 | Ga0105237_10013341 | 3300009545 | Bacteria | 8620 |
| 86 | Ga0105238_10000195 | 3300009551 | Bacteria | 67049 |
| 87 | Ga0105238_10023246 | 3300009551 | Bacteria | 6318 |
| 88 | Ga0105238_10079540 | 3300009551 | Bacteria | 3268 |
| 89 | Ga0105249_10055148 | 3300009553 | Unclassified | 3635 |
| 90 | Ga0105249_10186672 | 3300009553 | Bacteria | 2020 |
| 91 | Ga0105239_10000235 | 3300010375 | Bacteria | 81782 |
| 92 | Ga0105239_10000639 | 3300010375 | Bacteria | 49788 |
| 93 | Ga0105239_10022880 | 3300010375 | Bacteria | 6889 |
| 94 | Ga0105239_10039194 | 3300010375 | Bacteria | 5191 |
| 95 | Ga0105239_10067417 | 3300010375 | Bacteria | 3931 |
| 96 | Ga0105239_10085919 | 3300010375 | Unclassified | 3468 |
| 97 | Ga0105239_10089080 | 3300010375 | Bacteria | 3403 |
| 98 | Ga0105239_10234232 | 3300010375 | Bacteria | 2060 |
| 99 | Ga0105246_10019482 | 3300011119 | Bacteria | 4337 |
| 100 | Ga0157371_10014957 | 3300013102 | Bacteria | 5838 |
| 101 | Ga0157371_10118630 | 3300013102 | Bacteria | 1881 |
| 102 | Ga0157371_10141544 | 3300013102 | Bacteria | 1713 |
| 103 | Ga0157370_10015629 | 3300013104 | Bacteria | 7710 |
| 104 | Ga0157370_10419021 | 3300013104 | Bacteria | 1232 |
| 105 | Ga0157370_10581925 | 3300013104 | Bacteria | 1026 |
| 106 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 107 | Ga0157374_10251013 | 3300013296 | Bacteria | 1741 |
| 108 | Ga0157374_10292565 | 3300013296 | Unclassified | 1610 |
| 109 | Ga0157378_10189850 | 3300013297 | Unclassified | 1937 |
| 110 | Ga0157378_10465825 | 3300013297 | Bacteria | 1257 |
| 111 | Ga0163162_10000712 | 3300013306 | Bacteria | 30828 |
| 112 | Ga0163162_10003652 | 3300013306 | Bacteria | 14763 |
| 113 | Ga0163162_10563673 | 3300013306 | Bacteria | 1266 |
| 114 | Ga0157372_10001825 | 3300013307 | Bacteria | 23102 |
| 115 | Ga0157372_10006426 | 3300013307 | Bacteria | 12511 |
| 116 | Ga0157372_10073977 | 3300013307 | Unclassified | 3841 |
| 117 | Ga0157372_10111852 | 3300013307 | Bacteria | 3129 |
| 118 | Ga0157372_10375319 | 3300013307 | Bacteria | 1657 |
| 119 | Ga0157372_10852779 | 3300013307 | Bacteria | 1058 |
| 120 | Ga0157375_10681957 | 3300013308 | Bacteria | 1182 |
| 121 | Ga0163163_10004460 | 3300014325 | Bacteria | 11936 |
| 122 | Ga0163163_10199928 | 3300014325 | Bacteria | 2047 |
| 123 | Ga0163163_10659726 | 3300014325 | Bacteria | 1109 |
| 124 | Ga0157380_10808450 | 3300014326 | Bacteria | 955 |
| 125 | Ga0157379_10402940 | 3300014968 | Unclassified | 1258 |
| 126 | Ga0157376_10001814 | 3300014969 | Bacteria | 14211 |
| 127 | Ga0157376_10029774 | 3300014969 | Unclassified | 4352 |
| 128 | Ga0157376_10034836 | 3300014969 | Bacteria | 4068 |
| 129 | Ga0209258_100145 | 3300025242 | Bacteria | 163672 |
| 130 | Ga0209646_1001234 | 3300025246 | Bacteria | 7275 |
| 131 | Ga0209148_1000177 | 3300025254 | Bacteria | 127365 |
| 132 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 133 | Ga0207656_10076406 | 3300025321 | Bacteria | 1498 |
| 134 | Ga0207680_10000072 | 3300025903 | Bacteria | 44683 |
| 135 | Ga0207647_10007605 | 3300025904 | Bacteria | 7808 |
| 136 | Ga0207645_10023094 | 3300025907 | Bacteria | 4042 |
| 137 | Ga0207707_10249810 | 3300025912 | Bacteria | 1541 |
| 138 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 139 | Ga0207695_10000584 | 3300025913 | Bacteria | 73948 |
| 140 | Ga0207695_10003629 | 3300025913 | Bacteria | 21576 |
| 141 | Ga0207695_10057947 | 3300025913 | Bacteria | 4023 |
| 142 | Ga0207695_10153309 | 3300025913 | Bacteria | 2241 |
| 143 | Ga0207671_10001808 | 3300025914 | Bacteria | 23903 |
| 144 | Ga0207671_10004517 | 3300025914 | Bacteria | 13236 |
| 145 | Ga0207671_10004537 | 3300025914 | Bacteria | 13192 |
| 146 | Ga0207671_10013354 | 3300025914 | Bacteria | 6544 |
| 147 | Ga0207671_10018736 | 3300025914 | Bacteria | 5305 |
| 148 | Ga0207671_10020007 | 3300025914 | Bacteria | 5106 |
| 149 | Ga0207671_10099649 | 3300025914 | Bacteria | 2199 |
| 150 | Ga0207649_10071304 | 3300025920 | Bacteria | 2219 |
| 151 | Ga0207694_10007871 | 3300025924 | Bacteria | 8069 |
| 152 | Ga0207650_10003871 | 3300025925 | Bacteria | 10233 |
| 153 | Ga0207650_10360476 | 3300025925 | Bacteria | 1198 |
| 154 | Ga0207644_10083805 | 3300025931 | Bacteria | 2362 |
| 155 | Ga0207706_10073445 | 3300025933 | Bacteria | 3008 |
| 156 | Ga0207691_10176666 | 3300025940 | Bacteria | 1867 |
| 157 | Ga0207689_10000383 | 3300025942 | Bacteria | 41569 |
| 158 | Ga0207689_10078953 | 3300025942 | Bacteria | 2705 |
| 159 | Ga0207661_10020351 | 3300025944 | Bacteria | 4959 |
| 160 | Ga0207679_10085597 | 3300025945 | Bacteria | 2422 |
| 161 | Ga0207679_10191830 | 3300025945 | Bacteria | 1699 |
| 162 | Ga0207667_10001058 | 3300025949 | Bacteria | 34902 |
| 163 | Ga0207651_10241419 | 3300025960 | Bacteria | 1473 |
| 164 | Ga0207651_10464781 | 3300025960 | Bacteria | 1088 |
| 165 | Ga0207651_10573141 | 3300025960 | Bacteria | 984 |
| 166 | Ga0207640_10009598 | 3300025981 | Bacteria | 5425 |
| 167 | Ga0207658_10100995 | 3300025986 | Unclassified | 2259 |
| 168 | Ga0207677_10043681 | 3300026023 | Bacteria | 2981 |
| 169 | Ga0207703_10010923 | 3300026035 | Bacteria | 7077 |
| 170 | Ga0207639_10474828 | 3300026041 | Unclassified | 1139 |
| 171 | Ga0207639_10522369 | 3300026041 | Bacteria | 1087 |
| 172 | Ga0207702_10074189 | 3300026078 | Bacteria | 2936 |
| 173 | Ga0207641_10000280 | 3300026088 | Bacteria | 64281 |
| 174 | Ga0207641_10038328 | 3300026088 | Bacteria | 4007 |
| 175 | Ga0207641_10534837 | 3300026088 | Bacteria | 1141 |
| 176 | Ga0207648_10005824 | 3300026089 | Bacteria | 12344 |
| 177 | Ga0207676_10008608 | 3300026095 | Bacteria | 7251 |
| 178 | Ga0207674_10004281 | 3300026116 | Bacteria | 17213 |
| 179 | Ga0207698_10002611 | 3300026142 | Bacteria | 10713 |
| 180 | Ga0207698_10337705 | 3300026142 | Unclassified | 1418 |
| 181 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 182 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 183 | Ga0268264_10004181 | 3300028381 | Bacteria | 12334 |
| 184 | Ga0307517_10001723 | 3300028786 | Bacteria | 36033 |
| 185 | Ga0307513_10139553 | 3300031456 | Bacteria | 2353 |
| 186 | Ga0307509_10124879 | 3300031507 | Bacteria | 2542 |
| 187 | Ga0307508_10000294 | 3300031616 | Bacteria | 61066 |
| 188 | Ga0307508_10048428 | 3300031616 | Bacteria | 3786 |
| 189 | Ga0307516_10000648 | 3300031730 | Bacteria | 47083 |
| 190 | Ga0307510_10002127 | 3300033180 | Bacteria | 22383 |
| 191 | Ga0395900_0023696 | 3300037418 | Bacteria | 6281 |
| 192 | Ga0395905_0269214 | 3300037471 | Bacteria | 1589 |
| 193 | Ga0439465_0029039 | 3300041413 | Unclassified | 1756 |
| 194 | Ga0439445_0026484 | 3300042004 | Bacteria | 1485 |
| 195 | Ga0439449_0009661 | 3300042007 | Bacteria | 3651 |
| 196 | Ga0439449_0045326 | 3300042007 | Bacteria | 1630 |
| 197 | Ga0439457_008203 | 3300042014 | Bacteria | 2470 |
| 198 | Ga0466965_0059147 | 3300044683 | Bacteria | 1912 |
| 199 | Ga0466971_0008679 | 3300044719 | Bacteria | 4434 |
| 200 | Ga0466968_0002595 | 3300044735 | Bacteria | 6641 |
| 201 | Ga0466970_0098383 | 3300044765 | Bacteria | 1592 |
| 202 | Ga0466957_0041499 | 3300044842 | Bacteria | 2783 |
| 203 | Ga0495606_0043219 | 3300046507 | Bacteria | 3007 |
| 204 | Ga0495648_0009138 | 3300046524 | Bacteria | 7728 |
| 205 | Ga0495611_0000037 | 3300046648 | Bacteria | 101602 |
| 206 | Ga0495625_0070348 | 3300046660 | Bacteria | 2457 |
| 207 | Ga0495649_0038337 | 3300046694 | Unclassified | 2630 |
| 208 | Ga0495687_000040 | 3300047443 | Bacteria | 230786 |
| 209 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 210 | Ga0495686_0014128 | 3300047472 | Bacteria | 5506 |
| 211 | Ga0496109_1036908 | 3300048912 | Unclassified | 758 |
| 212 | Ga0496120_0177410 | 3300048923 | Bacteria | 1049 |
| 213 | Ga0501257_092783 | 3300049686 | Bacteria | 787 |
| 214 | nmdc:mga05p37_9694_c1 | 3300050507 | Bacteria | 11415 |
| 215 | Ga0500578_0000091 | 3300053086 | Bacteria | 102427 |
| 216 | Ga0500578_0097216 | 3300053086 | Bacteria | 1866 |
| 217 | Ga0500644_0000111 | 3300053088 | Bacteria | 51484 |
| 218 | Ga0500644_0013388 | 3300053088 | Unclassified | 2290 |
| 219 | Ga0500646_0001750 | 3300053090 | Bacteria | 5708 |
| 220 | Ga0500583_0006617 | 3300053092 | Bacteria | 4005 |
| 221 | Ga0500583_0169774 | 3300053092 | Bacteria | 1086 |
| 222 | Ga0500658_0043263 | 3300053134 | Unclassified | 1813 |
| 223 | Ga0500559_0007433 | 3300053136 | Bacteria | 4856 |
| 224 | Ga0500568_0010453 | 3300053139 | Bacteria | 4347 |
| 225 | Ga0500588_0008322 | 3300053146 | Bacteria | 2419 |
| 226 | Ga0500588_0060836 | 3300053146 | Bacteria | 1210 |
| 227 | Ga0500616_0008777 | 3300053153 | Bacteria | 6226 |
| 228 | Ga0500616_0040886 | 3300053153 | Bacteria | 2491 |
| 229 | Ga0500622_0001440 | 3300053156 | Bacteria | 19095 |
| 230 | Ga0500622_0001592 | 3300053156 | Bacteria | 17863 |
| 231 | Ga0500622_0005685 | 3300053156 | Bacteria | 7412 |
| 232 | Ga0500636_0024039 | 3300053177 | Bacteria | 3602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_1036908 | Ga0496109_1036908_52_726 | 224 |
| 2 | 3300049686 | Ga0501257_092783 | Ga0501257_092783_13_699 | 228 |
| 3 | 3300031456 | Ga0307513_10139553 | Ga0307513_101395532 | 242 |
| 4 | 3300006195 | Ga0075366_10029787 | Ga0075366_100297873 | 245 |
| 5 | 3300025942 | Ga0207689_10078953 | Ga0207689_100789533 | 245 |
| 6 | 3300047472 | Ga0495686_0014128 | Ga0495686_0014128_3776_4570 | 245 |
| 7 | 3300003316 | rootH1_10091706 | rootH1_100917062 | 246 |
| 8 | 3300044683 | Ga0466965_0059147 | Ga0466965_0059147_484_1278 | 249 |
| 9 | 3300044735 | Ga0466968_0002595 | Ga0466968_0002595_705_1514 | 252 |
| 10 | 3300053139 | Ga0500568_0010453 | Ga0500568_0010453_2476_3285 | 252 |
| 11 | 3300003316 | rootH1_10053884 | rootH1_100538842 | 254 |
| 12 | 3300005841 | Ga0068863_100535753 | Ga0068863_1005357531 | 254 |
| 13 | 3300009545 | Ga0105237_10005807 | Ga0105237_1000580712 | 254 |
| 14 | 3300010375 | Ga0105239_10085919 | Ga0105239_100859193 | 254 |
| 15 | 3300025914 | Ga0207671_10099649 | Ga0207671_100996491 | 254 |
| 16 | 3300025981 | Ga0207640_10009598 | Ga0207640_100095982 | 254 |
| 17 | 3300026088 | Ga0207641_10534837 | Ga0207641_105348371 | 254 |
| 18 | 3300005334 | Ga0068869_100100368 | Ga0068869_1001003683 | 255 |
| 19 | 3300009148 | Ga0105243_10099362 | Ga0105243_100993623 | 255 |
| 20 | 3300025907 | Ga0207645_10023094 | Ga0207645_100230944 | 255 |
| 21 | 3300026089 | Ga0207648_10005824 | Ga0207648_1000582411 | 255 |
| 22 | 3300003322 | rootL2_10011349 | rootL2_100113491 | 256 |
| 23 | 3300005539 | Ga0068853_100372044 | Ga0068853_1003720442 | 256 |
| 24 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002539 | 256 |
| 25 | 3300005614 | Ga0068856_100158698 | Ga0068856_1001586983 | 256 |
| 26 | 3300005719 | Ga0068861_100082686 | Ga0068861_1000826864 | 256 |
| 27 | 3300005842 | Ga0068858_100242588 | Ga0068858_1002425882 | 256 |
| 28 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003156 | 256 |
| 29 | 3300009093 | Ga0105240_10000896 | Ga0105240_100008969 | 256 |
| 30 | 3300009174 | Ga0105241_10000649 | Ga0105241_1000064927 | 256 |
| 31 | 3300009545 | Ga0105237_10013341 | Ga0105237_100133415 | 256 |
| 32 | 3300009551 | Ga0105238_10000195 | Ga0105238_1000019529 | 256 |
| 33 | 3300009553 | Ga0105249_10186672 | Ga0105249_101866722 | 256 |
| 34 | 3300010375 | Ga0105239_10022880 | Ga0105239_100228804 | 256 |
| 35 | 3300013306 | Ga0163162_10000712 | Ga0163162_1000071232 | 256 |
| 36 | 3300013307 | Ga0157372_10111852 | Ga0157372_101118522 | 256 |
| 37 | 3300025913 | Ga0207695_10003629 | Ga0207695_1000362912 | 256 |
| 38 | 3300025914 | Ga0207671_10004537 | Ga0207671_1000453711 | 256 |
| 39 | 3300025924 | Ga0207694_10007871 | Ga0207694_100078715 | 256 |
| 40 | 3300026041 | Ga0207639_10474828 | Ga0207639_104748281 | 256 |
| 41 | 3300028379 | Ga0268266_10000073 | Ga0268266_10000073105 | 256 |
| 42 | 3300028381 | Ga0268264_10000063 | Ga0268264_1000006374 | 256 |
| 43 | 3300047443 | Ga0495687_000040 | Ga0495687_000040_94599_95408 | 256 |
| 44 | 3300053146 | Ga0500588_0008322 | Ga0500588_0008322_186_965 | 259 |
| 45 | iso_pu_bacteria | 2818991444 | 2819590123 | 260 |
| 46 | iso_pu_bacteria | 2929239360 | 2929241514 | 260 |
| 47 | 3300003761 | Ga0055535_1005489 | Ga0055535_10054892 | 262 |
| 48 | 3300003762 | Ga0055542_1004766 | Ga0055542_10047663 | 262 |
| 49 | 3300014326 | Ga0157380_10808450 | Ga0157380_108084501 | 262 |
| 50 | 3300025242 | Ga0209258_100145 | Ga0209258_100145115 | 262 |
| 51 | 3300025254 | Ga0209148_1000177 | Ga0209148_100017735 | 262 |
| 52 | 3300053088 | Ga0500644_0000111 | Ga0500644_0000111_14798_15586 | 262 |
| 53 | 3300053090 | Ga0500646_0001750 | Ga0500646_0001750_3865_4653 | 262 |
| 54 | 3300053092 | Ga0500583_0006617 | Ga0500583_0006617_2098_2886 | 262 |
| 55 | 3300053134 | Ga0500658_0043263 | Ga0500658_0043263_709_1497 | 262 |
| 56 | 3300053136 | Ga0500559_0007433 | Ga0500559_0007433_539_1327 | 262 |
| 57 | 3300053153 | Ga0500616_0040886 | Ga0500616_0040886_182_970 | 262 |
| 58 | 3300053177 | Ga0500636_0024039 | Ga0500636_0024039_742_1563 | 262 |
| 59 | 3300009147 | Ga0114129_10008068 | Ga0114129_1000806812 | 263 |
| 60 | 3300013102 | Ga0157371_10014957 | Ga0157371_100149573 | 263 |
| 61 | 3300013296 | Ga0157374_10251013 | Ga0157374_102510133 | 263 |
| 62 | 3300013307 | Ga0157372_10073977 | Ga0157372_100739774 | 263 |
| 63 | 3300025246 | Ga0209646_1001234 | Ga0209646_10012345 | 263 |
| 64 | 3300031507 | Ga0307509_10124879 | Ga0307509_101248793 | 263 |
| 65 | 3300042004 | Ga0439445_0026484 | Ga0439445_0026484_411_1202 | 263 |
| 66 | 3300042007 | Ga0439449_0045326 | Ga0439449_0045326_11_802 | 263 |
| 67 | 3300050507 | nmdc:mga05p37_9694_c1 | nmdc:mga05p37_9694_c1_6579_7370 | 263 |
| 68 | 3300053086 | Ga0500578_0000091 | Ga0500578_0000091_90732_91523 | 263 |
| 69 | 3300053086 | Ga0500578_0097216 | Ga0500578_0097216_1005_1796 | 263 |
| 70 | 3300053146 | Ga0500588_0060836 | Ga0500588_0060836_314_1105 | 263 |
| 71 | 3300003203 | JGI25406J46586_10004645 | JGI25406J46586_100046459 | 264 |
| 72 | 3300003320 | rootH2_10045077 | rootH2_100450773 | 264 |
| 73 | 3300003320 | rootH2_10059393 | rootH2_1005939338 | 264 |
| 74 | 3300003320 | rootH2_10075686 | rootH2_100756862 | 264 |
| 75 | 3300003320 | rootH2_10111247 | rootH2_101112472 | 264 |
| 76 | 3300003322 | rootL2_10011547 | rootL2_1001154715 | 264 |
| 77 | 3300003322 | rootL2_10036409 | rootL2_100364092 | 264 |
| 78 | 3300003323 | rootH1_10129966 | rootH1_101299662 | 264 |
| 79 | 3300003354 | JGI25160J50197_1000423 | JGI25160J50197_100042327 | 264 |
| 80 | 3300005329 | Ga0070683_100006746 | Ga0070683_1000067468 | 264 |
| 81 | 3300005331 | Ga0070670_100142863 | Ga0070670_1001428632 | 264 |
| 82 | 3300005331 | Ga0070670_100398997 | Ga0070670_1003989972 | 264 |
| 83 | 3300005334 | Ga0068869_100130088 | Ga0068869_1001300882 | 264 |
| 84 | 3300005334 | Ga0068869_100210324 | Ga0068869_1002103242 | 264 |
| 85 | 3300005335 | Ga0070666_10000208 | Ga0070666_1000020837 | 264 |
| 86 | 3300005338 | Ga0068868_100129781 | Ga0068868_1001297813 | 264 |
| 87 | 3300005341 | Ga0070691_10037472 | Ga0070691_100374723 | 264 |
| 88 | 3300005344 | Ga0070661_100036192 | Ga0070661_1000361922 | 264 |
| 89 | 3300005347 | Ga0070668_100196191 | Ga0070668_1001961912 | 264 |
| 90 | 3300005354 | Ga0070675_100202840 | Ga0070675_1002028401 | 264 |
| 91 | 3300005355 | Ga0070671_100058661 | Ga0070671_1000586611 | 264 |
| 92 | 3300005367 | Ga0070667_100040044 | Ga0070667_1000400442 | 264 |
| 93 | 3300005455 | Ga0070663_100754429 | Ga0070663_1007544291 | 264 |
| 94 | 3300005458 | Ga0070681_10293321 | Ga0070681_102933212 | 264 |
| 95 | 3300005539 | Ga0068853_100024438 | Ga0068853_1000244382 | 264 |
| 96 | 3300005539 | Ga0068853_100405758 | Ga0068853_1004057582 | 264 |
| 97 | 3300005543 | Ga0070672_100232668 | Ga0070672_1002326682 | 264 |
| 98 | 3300005563 | Ga0068855_100028799 | Ga0068855_1000287993 | 264 |
| 99 | 3300005564 | Ga0070664_100004041 | Ga0070664_1000040419 | 264 |
| 100 | 3300005564 | Ga0070664_100097716 | Ga0070664_1000977162 | 264 |
| 101 | 3300005564 | Ga0070664_100113483 | Ga0070664_1001134833 | 264 |
| 102 | 3300005564 | Ga0070664_100214974 | Ga0070664_1002149742 | 264 |
| 103 | 3300005564 | Ga0070664_100256952 | Ga0070664_1002569522 | 264 |
| 104 | 3300005577 | Ga0068857_100006960 | Ga0068857_1000069607 | 264 |
| 105 | 3300005614 | Ga0068856_100061384 | Ga0068856_1000613843 | 264 |
| 106 | 3300005616 | Ga0068852_100002505 | Ga0068852_1000025053 | 264 |
| 107 | 3300005616 | Ga0068852_100158551 | Ga0068852_1001585513 | 264 |
| 108 | 3300005616 | Ga0068852_100266729 | Ga0068852_1002667292 | 264 |
| 109 | 3300005616 | Ga0068852_100517444 | Ga0068852_1005174442 | 264 |
| 110 | 3300005617 | Ga0068859_100000006 | Ga0068859_100000006224 | 264 |
| 111 | 3300005617 | Ga0068859_100001600 | Ga0068859_1000016004 | 264 |
| 112 | 3300005618 | Ga0068864_100002251 | Ga0068864_1000022514 | 264 |
| 113 | 3300005834 | Ga0068851_10033932 | Ga0068851_100339322 | 264 |
| 114 | 3300005841 | Ga0068863_100011724 | Ga0068863_1000117243 | 264 |
| 115 | 3300005841 | Ga0068863_100028475 | Ga0068863_1000284753 | 264 |
| 116 | 3300005842 | Ga0068858_100000396 | Ga0068858_10000039628 | 264 |
| 117 | 3300005843 | Ga0068860_100011714 | Ga0068860_10001171410 | 264 |
| 118 | 3300005985 | Ga0081539_10004597 | Ga0081539_1000459710 | 264 |
| 119 | 3300006237 | Ga0097621_100016532 | Ga0097621_1000165323 | 264 |
| 120 | 3300006237 | Ga0097621_100204552 | Ga0097621_1002045522 | 264 |
| 121 | 3300006358 | Ga0068871_100038002 | Ga0068871_1000380023 | 264 |
| 122 | 3300006358 | Ga0068871_100102887 | Ga0068871_1001028872 | 264 |
| 123 | 3300006358 | Ga0068871_100201264 | Ga0068871_1002012642 | 264 |
| 124 | 3300006358 | Ga0068871_100348601 | Ga0068871_1003486011 | 264 |
| 125 | 3300006931 | Ga0097620_100000006 | Ga0097620_100000006224 | 264 |
| 126 | 3300006931 | Ga0097620_100001600 | Ga0097620_1000016004 | 264 |
| 127 | 3300009093 | Ga0105240_10000888 | Ga0105240_1000088830 | 264 |
| 128 | 3300009093 | Ga0105240_10004520 | Ga0105240_100045203 | 264 |
| 129 | 3300009093 | Ga0105240_10020206 | Ga0105240_100202068 | 264 |
| 130 | 3300009174 | Ga0105241_10001297 | Ga0105241_1000129719 | 264 |
| 131 | 3300009174 | Ga0105241_10173526 | Ga0105241_101735262 | 264 |
| 132 | 3300009545 | Ga0105237_10000362 | Ga0105237_1000036247 | 264 |
| 133 | 3300009545 | Ga0105237_10000553 | Ga0105237_1000055345 | 264 |
| 134 | 3300009545 | Ga0105237_10000636 | Ga0105237_1000063634 | 264 |
| 135 | 3300009545 | Ga0105237_10002556 | Ga0105237_1000255613 | 264 |
| 136 | 3300009551 | Ga0105238_10023246 | Ga0105238_100232463 | 264 |
| 137 | 3300009551 | Ga0105238_10079540 | Ga0105238_100795403 | 264 |
| 138 | 3300009553 | Ga0105249_10055148 | Ga0105249_100551482 | 264 |
| 139 | 3300010375 | Ga0105239_10000235 | Ga0105239_1000023543 | 264 |
| 140 | 3300010375 | Ga0105239_10000639 | Ga0105239_1000063946 | 264 |
| 141 | 3300010375 | Ga0105239_10039194 | Ga0105239_100391942 | 264 |
| 142 | 3300010375 | Ga0105239_10067417 | Ga0105239_100674173 | 264 |
| 143 | 3300010375 | Ga0105239_10089080 | Ga0105239_100890803 | 264 |
| 144 | 3300010375 | Ga0105239_10234232 | Ga0105239_102342322 | 264 |
| 145 | 3300011119 | Ga0105246_10019482 | Ga0105246_100194827 | 264 |
| 146 | 3300013102 | Ga0157371_10118630 | Ga0157371_101186301 | 264 |
| 147 | 3300013102 | Ga0157371_10141544 | Ga0157371_101415441 | 264 |
| 148 | 3300013104 | Ga0157370_10015629 | Ga0157370_100156293 | 264 |
| 149 | 3300013104 | Ga0157370_10419021 | Ga0157370_104190211 | 264 |
| 150 | 3300013104 | Ga0157370_10581925 | Ga0157370_105819251 | 264 |
| 151 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013263 | 264 |
| 152 | 3300013296 | Ga0157374_10292565 | Ga0157374_102925652 | 264 |
| 153 | 3300013297 | Ga0157378_10189850 | Ga0157378_101898502 | 264 |
| 154 | 3300013297 | Ga0157378_10465825 | Ga0157378_104658252 | 264 |
| 155 | 3300013306 | Ga0163162_10003652 | Ga0163162_1000365220 | 264 |
| 156 | 3300013306 | Ga0163162_10563673 | Ga0163162_105636731 | 264 |
| 157 | 3300013307 | Ga0157372_10001825 | Ga0157372_1000182521 | 264 |
| 158 | 3300013307 | Ga0157372_10006426 | Ga0157372_1000642611 | 264 |
| 159 | 3300013307 | Ga0157372_10375319 | Ga0157372_103753192 | 264 |
| 160 | 3300013307 | Ga0157372_10852779 | Ga0157372_108527791 | 264 |
| 161 | 3300013308 | Ga0157375_10681957 | Ga0157375_106819572 | 264 |
| 162 | 3300014325 | Ga0163163_10004460 | Ga0163163_1000446012 | 264 |
| 163 | 3300014325 | Ga0163163_10199928 | Ga0163163_101999282 | 264 |
| 164 | 3300014325 | Ga0163163_10659726 | Ga0163163_106597262 | 264 |
| 165 | 3300014968 | Ga0157379_10402940 | Ga0157379_104029401 | 264 |
| 166 | 3300014969 | Ga0157376_10001814 | Ga0157376_1000181413 | 264 |
| 167 | 3300014969 | Ga0157376_10029774 | Ga0157376_100297742 | 264 |
| 168 | 3300014969 | Ga0157376_10034836 | Ga0157376_100348363 | 264 |
| 169 | 3300025302 | Ga0207426_1000105 | Ga0207426_1000105107 | 264 |
| 170 | 3300025321 | Ga0207656_10076406 | Ga0207656_100764061 | 264 |
| 171 | 3300025903 | Ga0207680_10000072 | Ga0207680_1000007221 | 264 |
| 172 | 3300025904 | Ga0207647_10007605 | Ga0207647_100076057 | 264 |
| 173 | 3300025912 | Ga0207707_10249810 | Ga0207707_102498102 | 264 |
| 174 | 3300025913 | Ga0207695_10000066 | Ga0207695_10000066156 | 264 |
| 175 | 3300025913 | Ga0207695_10000584 | Ga0207695_1000058449 | 264 |
| 176 | 3300025913 | Ga0207695_10057947 | Ga0207695_100579474 | 264 |
| 177 | 3300025913 | Ga0207695_10153309 | Ga0207695_101533092 | 264 |
| 178 | 3300025914 | Ga0207671_10001808 | Ga0207671_1000180822 | 264 |
| 179 | 3300025914 | Ga0207671_10004517 | Ga0207671_1000451711 | 264 |
| 180 | 3300025914 | Ga0207671_10013354 | Ga0207671_100133548 | 264 |
| 181 | 3300025914 | Ga0207671_10018736 | Ga0207671_100187363 | 264 |
| 182 | 3300025914 | Ga0207671_10020007 | Ga0207671_100200075 | 264 |
| 183 | 3300025920 | Ga0207649_10071304 | Ga0207649_100713042 | 264 |
| 184 | 3300025925 | Ga0207650_10003871 | Ga0207650_100038716 | 264 |
| 185 | 3300025925 | Ga0207650_10360476 | Ga0207650_103604761 | 264 |
| 186 | 3300025931 | Ga0207644_10083805 | Ga0207644_100838053 | 264 |
| 187 | 3300025933 | Ga0207706_10073445 | Ga0207706_100734451 | 264 |
| 188 | 3300025940 | Ga0207691_10176666 | Ga0207691_101766662 | 264 |
| 189 | 3300025942 | Ga0207689_10000383 | Ga0207689_1000038342 | 264 |
| 190 | 3300025944 | Ga0207661_10020351 | Ga0207661_100203512 | 264 |
| 191 | 3300025945 | Ga0207679_10085597 | Ga0207679_100855972 | 264 |
| 192 | 3300025945 | Ga0207679_10191830 | Ga0207679_101918301 | 264 |
| 193 | 3300025949 | Ga0207667_10001058 | Ga0207667_100010589 | 264 |
| 194 | 3300025960 | Ga0207651_10241419 | Ga0207651_102414191 | 264 |
| 195 | 3300025960 | Ga0207651_10464781 | Ga0207651_104647811 | 264 |
| 196 | 3300025960 | Ga0207651_10573141 | Ga0207651_105731411 | 264 |
| 197 | 3300025986 | Ga0207658_10100995 | Ga0207658_101009953 | 264 |
| 198 | 3300026023 | Ga0207677_10043681 | Ga0207677_100436813 | 264 |
| 199 | 3300026035 | Ga0207703_10010923 | Ga0207703_100109235 | 264 |
| 200 | 3300026041 | Ga0207639_10522369 | Ga0207639_105223691 | 264 |
| 201 | 3300026078 | Ga0207702_10074189 | Ga0207702_100741893 | 264 |
| 202 | 3300026088 | Ga0207641_10000280 | Ga0207641_1000028041 | 264 |
| 203 | 3300026088 | Ga0207641_10038328 | Ga0207641_100383282 | 264 |
| 204 | 3300026095 | Ga0207676_10008608 | Ga0207676_100086084 | 264 |
| 205 | 3300026116 | Ga0207674_10004281 | Ga0207674_1000428113 | 264 |
| 206 | 3300026142 | Ga0207698_10002611 | Ga0207698_100026113 | 264 |
| 207 | 3300026142 | Ga0207698_10337705 | Ga0207698_103377052 | 264 |
| 208 | 3300028381 | Ga0268264_10004181 | Ga0268264_100041818 | 264 |
| 209 | 3300028786 | Ga0307517_10001723 | Ga0307517_1000172328 | 264 |
| 210 | 3300031616 | Ga0307508_10000294 | Ga0307508_1000029415 | 264 |
| 211 | 3300031616 | Ga0307508_10048428 | Ga0307508_100484284 | 264 |
| 212 | 3300031730 | Ga0307516_10000648 | Ga0307516_1000064832 | 264 |
| 213 | 3300033180 | Ga0307510_10002127 | Ga0307510_1000212714 | 264 |
| 214 | 3300037418 | Ga0395900_0023696 | Ga0395900_0023696_732_1526 | 264 |
| 215 | 3300037471 | Ga0395905_0269214 | Ga0395905_0269214_68_862 | 264 |
| 216 | 3300041413 | Ga0439465_0029039 | Ga0439465_0029039_933_1727 | 264 |
| 217 | 3300042007 | Ga0439449_0009661 | Ga0439449_0009661_851_1645 | 264 |
| 218 | 3300042014 | Ga0439457_008203 | Ga0439457_008203_429_1223 | 264 |
| 219 | 3300044719 | Ga0466971_0008679 | Ga0466971_0008679_3272_4114 | 264 |
| 220 | 3300044765 | Ga0466970_0098383 | Ga0466970_0098383_556_1398 | 264 |
| 221 | 3300044842 | Ga0466957_0041499 | Ga0466957_0041499_1636_2478 | 264 |
| 222 | 3300046507 | Ga0495606_0043219 | Ga0495606_0043219_757_1596 | 264 |
| 223 | 3300046524 | Ga0495648_0009138 | Ga0495648_0009138_6344_7153 | 264 |
| 224 | 3300046648 | Ga0495611_0000037 | Ga0495611_0000037_80375_81214 | 264 |
| 225 | 3300046660 | Ga0495625_0070348 | Ga0495625_0070348_854_1648 | 264 |
| 226 | 3300046694 | Ga0495649_0038337 | Ga0495649_0038337_302_1141 | 264 |
| 227 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_420912_421751 | 264 |
| 228 | 3300048923 | Ga0496120_0177410 | Ga0496120_0177410_107_946 | 264 |
| 229 | 3300053088 | Ga0500644_0013388 | Ga0500644_0013388_91_921 | 264 |
| 230 | 3300053092 | Ga0500583_0169774 | Ga0500583_0169774_137_946 | 264 |
| 231 | 3300053153 | Ga0500616_0008777 | Ga0500616_0008777_2553_3347 | 264 |
| 232 | 3300053156 | Ga0500622_0001440 | Ga0500622_0001440_3111_3905 | 264 |
| 233 | 3300053156 | Ga0500622_0001592 | Ga0500622_0001592_5507_6301 | 264 |
| 234 | 3300053156 | Ga0500622_0005685 | Ga0500622_0005685_6531_7340 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8edw-assembly1.cif.gz_A | cryo-em structure of human abca7 in bpl/ch nanodiscs | 0.8647 | 8 | 218 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.8608 | 10 | 238 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8605 | 7 | 238 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.86 | 7 | 238 |
| 5x5y-assembly1.cif.gz_A | a membrane protein complex | 0.8582 | 11 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8824 | 10 | 263 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8551 | 11 | 261 | 3.40.50.300 |
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8547 | 10 | 263 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8545 | 5 | 236 | 3.40.50.300 |
| af_E9PWJ7_506_745_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8532 | 9 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527GZS8-F1-model_v4 | ABC transporter ATP-binding protein | 0.8915 | 9 | 218 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A7G8UFM3-F1-model_v4 | ABC transporter ATP-binding protein | 0.89 | 10 | 264 |
GO:0005524
GO:0016887 |
| AF-A0A522ZIC4-F1-model_v4 | ABC transporter ATP-binding protein | 0.8831 | 7 | 263 |
GO:0005524
GO:0016887 |
| AF-A0A443KNY2-F1-model_v4 | ABC transporter ATP-binding protein | 0.883 | 10 | 264 |
GO:0005524
GO:0016887 |
| AF-A0A521QGG1-F1-model_v4 | ABC transporter ATP-binding protein | 0.8821 | 10 | 264 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar