F346856

General Info

Members Datasets Scaffolds Average Seq Length
234 137 232 267

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10293321|Ga0070681_102933212
Length 299
Sequence LVISLHAAVLNYLQPEKIYCMTPYTKSDVLLQARNLSLTYGDKCILHDINFCIRDIVRPGLLQGQVLSLVGRSGMGKTQLFRLLSGLQTPTSGSITIRQWKPAARSDGSIETYEERTVQPGDMGVIFQNYYQFGWRTVQQSLLLAARKNKALAGKEEDTVEHYLHQFDLPDVLHCYPQQLSGGQQQRVSIIQQLLKGSNFLLLDEPFSGLDVCVLDKVVELLLQVSLSDELKTLIIVSHDIATAVAISDTVFILGKQPGREGSTLVREIDLIERELAWRKDVREERAFAETIREIKACL

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.68
Nodule 0
Rhizoplane 0.43
Rhizosphere 79.91
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004645 3300003203 Bacteria 6393
2 rootH1_10053884 3300003316 Bacteria 1204
3 rootH1_10091706 3300003316 Bacteria 2788
4 rootH2_10045077 3300003320 Unclassified 2112
5 rootH2_10059393 3300003320 Bacteria 48659
6 rootH2_10075686 3300003320 Bacteria 1992
7 rootH2_10111247 3300003320 Bacteria 2456
8 rootL2_10011349 3300003322 Bacteria 2439
9 rootL2_10011547 3300003322 Bacteria 13234
10 rootL2_10036409 3300003322 Bacteria 1205
11 rootH1_10129966 3300003323 Bacteria 3483
12 JGI25160J50197_1000423 3300003354 Bacteria 26634
13 Ga0055535_1005489 3300003761 Bacteria 2761
14 Ga0055542_1004766 3300003762 Bacteria 3194
15 Ga0070683_100006746 3300005329 Bacteria 9640
16 Ga0070670_100142863 3300005331 Bacteria 2070
17 Ga0070670_100398997 3300005331 Unclassified 1214
18 Ga0068869_100100368 3300005334 Bacteria 2188
19 Ga0068869_100130088 3300005334 Bacteria 1934
20 Ga0068869_100210324 3300005334 Unclassified 1537
21 Ga0070666_10000208 3300005335 Bacteria 40242
22 Ga0068868_100129781 3300005338 Unclassified 2062
23 Ga0070691_10037472 3300005341 Bacteria 2288
24 Ga0070661_100036192 3300005344 Bacteria 3589
25 Ga0070668_100196191 3300005347 Unclassified 1656
26 Ga0070675_100202840 3300005354 Bacteria 1721
27 Ga0070671_100058661 3300005355 Bacteria 3203
28 Ga0070667_100040044 3300005367 Unclassified 3929
29 Ga0070663_100754429 3300005455 Bacteria 831
30 Ga0070681_10293321 3300005458 Bacteria 1536
31 Ga0068853_100024438 3300005539 Bacteria 5066
32 Ga0068853_100372044 3300005539 Bacteria 1333
33 Ga0068853_100405758 3300005539 Bacteria 1276
34 Ga0070672_100232668 3300005543 Bacteria 1548
35 Ga0070665_100000002 3300005548 Bacteria 849037
36 Ga0068855_100028799 3300005563 Bacteria 6645
37 Ga0070664_100004041 3300005564 Bacteria 11785
38 Ga0070664_100097716 3300005564 Bacteria 2550
39 Ga0070664_100113483 3300005564 Bacteria 2367
40 Ga0070664_100214974 3300005564 Bacteria 1718
41 Ga0070664_100256952 3300005564 Bacteria 1571
42 Ga0068857_100006960 3300005577 Bacteria 9734
43 Ga0068856_100061384 3300005614 Bacteria 3713
44 Ga0068856_100158698 3300005614 Bacteria 2272
45 Ga0068852_100002505 3300005616 Bacteria 12646
46 Ga0068852_100158551 3300005616 Bacteria 2110
47 Ga0068852_100266729 3300005616 Unclassified 1646
48 Ga0068852_100517444 3300005616 Bacteria 1190
49 Ga0068859_100000006 3300005617 Bacteria 421509
50 Ga0068859_100001600 3300005617 Bacteria 23125
51 Ga0068864_100002251 3300005618 Bacteria 15955
52 Ga0068861_100082686 3300005719 Bacteria 2517
53 Ga0068851_10033932 3300005834 Unclassified 2545
54 Ga0068863_100011724 3300005841 Bacteria 8478
55 Ga0068863_100028475 3300005841 Bacteria 5335
56 Ga0068863_100535753 3300005841 Bacteria 1155
57 Ga0068858_100000396 3300005842 Bacteria 45694
58 Ga0068858_100242588 3300005842 Bacteria 1710
59 Ga0068860_100000003 3300005843 Bacteria 575741
60 Ga0068860_100011714 3300005843 Bacteria 8643
61 Ga0081539_10004597 3300005985 Bacteria 15067
62 Ga0075366_10029787 3300006195 Bacteria 3207
63 Ga0097621_100016532 3300006237 Bacteria 5579
64 Ga0097621_100204552 3300006237 Bacteria 1715
65 Ga0068871_100038002 3300006358 Unclassified 3841
66 Ga0068871_100102887 3300006358 Unclassified 2394
67 Ga0068871_100201264 3300006358 Bacteria 1719
68 Ga0068871_100348601 3300006358 Bacteria 1309
69 Ga0097620_100000006 3300006931 Bacteria 421509
70 Ga0097620_100001600 3300006931 Bacteria 23125
71 Ga0105240_10000888 3300009093 Bacteria 53670
72 Ga0105240_10000896 3300009093 Bacteria 53128
73 Ga0105240_10004520 3300009093 Bacteria 21135
74 Ga0105240_10020206 3300009093 Bacteria 8890
75 Ga0114129_10008068 3300009147 Bacteria 15001
76 Ga0105243_10099362 3300009148 Bacteria 2412
77 Ga0105241_10000649 3300009174 Bacteria 26087
78 Ga0105241_10001297 3300009174 Bacteria 19017
79 Ga0105241_10173526 3300009174 Unclassified 1782
80 Ga0105237_10000362 3300009545 Bacteria 64230
81 Ga0105237_10000553 3300009545 Bacteria 52367
82 Ga0105237_10000636 3300009545 Bacteria 49001
83 Ga0105237_10002556 3300009545 Bacteria 22482
84 Ga0105237_10005807 3300009545 Bacteria 13845
85 Ga0105237_10013341 3300009545 Bacteria 8620
86 Ga0105238_10000195 3300009551 Bacteria 67049
87 Ga0105238_10023246 3300009551 Bacteria 6318
88 Ga0105238_10079540 3300009551 Bacteria 3268
89 Ga0105249_10055148 3300009553 Unclassified 3635
90 Ga0105249_10186672 3300009553 Bacteria 2020
91 Ga0105239_10000235 3300010375 Bacteria 81782
92 Ga0105239_10000639 3300010375 Bacteria 49788
93 Ga0105239_10022880 3300010375 Bacteria 6889
94 Ga0105239_10039194 3300010375 Bacteria 5191
95 Ga0105239_10067417 3300010375 Bacteria 3931
96 Ga0105239_10085919 3300010375 Unclassified 3468
97 Ga0105239_10089080 3300010375 Bacteria 3403
98 Ga0105239_10234232 3300010375 Bacteria 2060
99 Ga0105246_10019482 3300011119 Bacteria 4337
100 Ga0157371_10014957 3300013102 Bacteria 5838
101 Ga0157371_10118630 3300013102 Bacteria 1881
102 Ga0157371_10141544 3300013102 Bacteria 1713
103 Ga0157370_10015629 3300013104 Bacteria 7710
104 Ga0157370_10419021 3300013104 Bacteria 1232
105 Ga0157370_10581925 3300013104 Bacteria 1026
106 Ga0157374_10000013 3300013296 Bacteria 461240
107 Ga0157374_10251013 3300013296 Bacteria 1741
108 Ga0157374_10292565 3300013296 Unclassified 1610
109 Ga0157378_10189850 3300013297 Unclassified 1937
110 Ga0157378_10465825 3300013297 Bacteria 1257
111 Ga0163162_10000712 3300013306 Bacteria 30828
112 Ga0163162_10003652 3300013306 Bacteria 14763
113 Ga0163162_10563673 3300013306 Bacteria 1266
114 Ga0157372_10001825 3300013307 Bacteria 23102
115 Ga0157372_10006426 3300013307 Bacteria 12511
116 Ga0157372_10073977 3300013307 Unclassified 3841
117 Ga0157372_10111852 3300013307 Bacteria 3129
118 Ga0157372_10375319 3300013307 Bacteria 1657
119 Ga0157372_10852779 3300013307 Bacteria 1058
120 Ga0157375_10681957 3300013308 Bacteria 1182
121 Ga0163163_10004460 3300014325 Bacteria 11936
122 Ga0163163_10199928 3300014325 Bacteria 2047
123 Ga0163163_10659726 3300014325 Bacteria 1109
124 Ga0157380_10808450 3300014326 Bacteria 955
125 Ga0157379_10402940 3300014968 Unclassified 1258
126 Ga0157376_10001814 3300014969 Bacteria 14211
127 Ga0157376_10029774 3300014969 Unclassified 4352
128 Ga0157376_10034836 3300014969 Bacteria 4068
129 Ga0209258_100145 3300025242 Bacteria 163672
130 Ga0209646_1001234 3300025246 Bacteria 7275
131 Ga0209148_1000177 3300025254 Bacteria 127365
132 Ga0207426_1000105 3300025302 Bacteria 247269
133 Ga0207656_10076406 3300025321 Bacteria 1498
134 Ga0207680_10000072 3300025903 Bacteria 44683
135 Ga0207647_10007605 3300025904 Bacteria 7808
136 Ga0207645_10023094 3300025907 Bacteria 4042
137 Ga0207707_10249810 3300025912 Bacteria 1541
138 Ga0207695_10000066 3300025913 Bacteria 334103
139 Ga0207695_10000584 3300025913 Bacteria 73948
140 Ga0207695_10003629 3300025913 Bacteria 21576
141 Ga0207695_10057947 3300025913 Bacteria 4023
142 Ga0207695_10153309 3300025913 Bacteria 2241
143 Ga0207671_10001808 3300025914 Bacteria 23903
144 Ga0207671_10004517 3300025914 Bacteria 13236
145 Ga0207671_10004537 3300025914 Bacteria 13192
146 Ga0207671_10013354 3300025914 Bacteria 6544
147 Ga0207671_10018736 3300025914 Bacteria 5305
148 Ga0207671_10020007 3300025914 Bacteria 5106
149 Ga0207671_10099649 3300025914 Bacteria 2199
150 Ga0207649_10071304 3300025920 Bacteria 2219
151 Ga0207694_10007871 3300025924 Bacteria 8069
152 Ga0207650_10003871 3300025925 Bacteria 10233
153 Ga0207650_10360476 3300025925 Bacteria 1198
154 Ga0207644_10083805 3300025931 Bacteria 2362
155 Ga0207706_10073445 3300025933 Bacteria 3008
156 Ga0207691_10176666 3300025940 Bacteria 1867
157 Ga0207689_10000383 3300025942 Bacteria 41569
158 Ga0207689_10078953 3300025942 Bacteria 2705
159 Ga0207661_10020351 3300025944 Bacteria 4959
160 Ga0207679_10085597 3300025945 Bacteria 2422
161 Ga0207679_10191830 3300025945 Bacteria 1699
162 Ga0207667_10001058 3300025949 Bacteria 34902
163 Ga0207651_10241419 3300025960 Bacteria 1473
164 Ga0207651_10464781 3300025960 Bacteria 1088
165 Ga0207651_10573141 3300025960 Bacteria 984
166 Ga0207640_10009598 3300025981 Bacteria 5425
167 Ga0207658_10100995 3300025986 Unclassified 2259
168 Ga0207677_10043681 3300026023 Bacteria 2981
169 Ga0207703_10010923 3300026035 Bacteria 7077
170 Ga0207639_10474828 3300026041 Unclassified 1139
171 Ga0207639_10522369 3300026041 Bacteria 1087
172 Ga0207702_10074189 3300026078 Bacteria 2936
173 Ga0207641_10000280 3300026088 Bacteria 64281
174 Ga0207641_10038328 3300026088 Bacteria 4007
175 Ga0207641_10534837 3300026088 Bacteria 1141
176 Ga0207648_10005824 3300026089 Bacteria 12344
177 Ga0207676_10008608 3300026095 Bacteria 7251
178 Ga0207674_10004281 3300026116 Bacteria 17213
179 Ga0207698_10002611 3300026142 Bacteria 10713
180 Ga0207698_10337705 3300026142 Unclassified 1418
181 Ga0268266_10000073 3300028379 Bacteria 232074
182 Ga0268264_10000063 3300028381 Bacteria 301702
183 Ga0268264_10004181 3300028381 Bacteria 12334
184 Ga0307517_10001723 3300028786 Bacteria 36033
185 Ga0307513_10139553 3300031456 Bacteria 2353
186 Ga0307509_10124879 3300031507 Bacteria 2542
187 Ga0307508_10000294 3300031616 Bacteria 61066
188 Ga0307508_10048428 3300031616 Bacteria 3786
189 Ga0307516_10000648 3300031730 Bacteria 47083
190 Ga0307510_10002127 3300033180 Bacteria 22383
191 Ga0395900_0023696 3300037418 Bacteria 6281
192 Ga0395905_0269214 3300037471 Bacteria 1589
193 Ga0439465_0029039 3300041413 Unclassified 1756
194 Ga0439445_0026484 3300042004 Bacteria 1485
195 Ga0439449_0009661 3300042007 Bacteria 3651
196 Ga0439449_0045326 3300042007 Bacteria 1630
197 Ga0439457_008203 3300042014 Bacteria 2470
198 Ga0466965_0059147 3300044683 Bacteria 1912
199 Ga0466971_0008679 3300044719 Bacteria 4434
200 Ga0466968_0002595 3300044735 Bacteria 6641
201 Ga0466970_0098383 3300044765 Bacteria 1592
202 Ga0466957_0041499 3300044842 Bacteria 2783
203 Ga0495606_0043219 3300046507 Bacteria 3007
204 Ga0495648_0009138 3300046524 Bacteria 7728
205 Ga0495611_0000037 3300046648 Bacteria 101602
206 Ga0495625_0070348 3300046660 Bacteria 2457
207 Ga0495649_0038337 3300046694 Unclassified 2630
208 Ga0495687_000040 3300047443 Bacteria 230786
209 Ga0495686_0000010 3300047472 Bacteria 573229
210 Ga0495686_0014128 3300047472 Bacteria 5506
211 Ga0496109_1036908 3300048912 Unclassified 758
212 Ga0496120_0177410 3300048923 Bacteria 1049
213 Ga0501257_092783 3300049686 Bacteria 787
214 nmdc:mga05p37_9694_c1 3300050507 Bacteria 11415
215 Ga0500578_0000091 3300053086 Bacteria 102427
216 Ga0500578_0097216 3300053086 Bacteria 1866
217 Ga0500644_0000111 3300053088 Bacteria 51484
218 Ga0500644_0013388 3300053088 Unclassified 2290
219 Ga0500646_0001750 3300053090 Bacteria 5708
220 Ga0500583_0006617 3300053092 Bacteria 4005
221 Ga0500583_0169774 3300053092 Bacteria 1086
222 Ga0500658_0043263 3300053134 Unclassified 1813
223 Ga0500559_0007433 3300053136 Bacteria 4856
224 Ga0500568_0010453 3300053139 Bacteria 4347
225 Ga0500588_0008322 3300053146 Bacteria 2419
226 Ga0500588_0060836 3300053146 Bacteria 1210
227 Ga0500616_0008777 3300053153 Bacteria 6226
228 Ga0500616_0040886 3300053153 Bacteria 2491
229 Ga0500622_0001440 3300053156 Bacteria 19095
230 Ga0500622_0001592 3300053156 Bacteria 17863
231 Ga0500622_0005685 3300053156 Bacteria 7412
232 Ga0500636_0024039 3300053177 Bacteria 3602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_1036908 Ga0496109_1036908_52_726 224
2 3300049686 Ga0501257_092783 Ga0501257_092783_13_699 228
3 3300031456 Ga0307513_10139553 Ga0307513_101395532 242
4 3300006195 Ga0075366_10029787 Ga0075366_100297873 245
5 3300025942 Ga0207689_10078953 Ga0207689_100789533 245
6 3300047472 Ga0495686_0014128 Ga0495686_0014128_3776_4570 245
7 3300003316 rootH1_10091706 rootH1_100917062 246
8 3300044683 Ga0466965_0059147 Ga0466965_0059147_484_1278 249
9 3300044735 Ga0466968_0002595 Ga0466968_0002595_705_1514 252
10 3300053139 Ga0500568_0010453 Ga0500568_0010453_2476_3285 252
11 3300003316 rootH1_10053884 rootH1_100538842 254
12 3300005841 Ga0068863_100535753 Ga0068863_1005357531 254
13 3300009545 Ga0105237_10005807 Ga0105237_1000580712 254
14 3300010375 Ga0105239_10085919 Ga0105239_100859193 254
15 3300025914 Ga0207671_10099649 Ga0207671_100996491 254
16 3300025981 Ga0207640_10009598 Ga0207640_100095982 254
17 3300026088 Ga0207641_10534837 Ga0207641_105348371 254
18 3300005334 Ga0068869_100100368 Ga0068869_1001003683 255
19 3300009148 Ga0105243_10099362 Ga0105243_100993623 255
20 3300025907 Ga0207645_10023094 Ga0207645_100230944 255
21 3300026089 Ga0207648_10005824 Ga0207648_1000582411 255
22 3300003322 rootL2_10011349 rootL2_100113491 256
23 3300005539 Ga0068853_100372044 Ga0068853_1003720442 256
24 3300005548 Ga0070665_100000002 Ga0070665_100000002539 256
25 3300005614 Ga0068856_100158698 Ga0068856_1001586983 256
26 3300005719 Ga0068861_100082686 Ga0068861_1000826864 256
27 3300005842 Ga0068858_100242588 Ga0068858_1002425882 256
28 3300005843 Ga0068860_100000003 Ga0068860_100000003156 256
29 3300009093 Ga0105240_10000896 Ga0105240_100008969 256
30 3300009174 Ga0105241_10000649 Ga0105241_1000064927 256
31 3300009545 Ga0105237_10013341 Ga0105237_100133415 256
32 3300009551 Ga0105238_10000195 Ga0105238_1000019529 256
33 3300009553 Ga0105249_10186672 Ga0105249_101866722 256
34 3300010375 Ga0105239_10022880 Ga0105239_100228804 256
35 3300013306 Ga0163162_10000712 Ga0163162_1000071232 256
36 3300013307 Ga0157372_10111852 Ga0157372_101118522 256
37 3300025913 Ga0207695_10003629 Ga0207695_1000362912 256
38 3300025914 Ga0207671_10004537 Ga0207671_1000453711 256
39 3300025924 Ga0207694_10007871 Ga0207694_100078715 256
40 3300026041 Ga0207639_10474828 Ga0207639_104748281 256
41 3300028379 Ga0268266_10000073 Ga0268266_10000073105 256
42 3300028381 Ga0268264_10000063 Ga0268264_1000006374 256
43 3300047443 Ga0495687_000040 Ga0495687_000040_94599_95408 256
44 3300053146 Ga0500588_0008322 Ga0500588_0008322_186_965 259
45 iso_pu_bacteria 2818991444 2819590123 260
46 iso_pu_bacteria 2929239360 2929241514 260
47 3300003761 Ga0055535_1005489 Ga0055535_10054892 262
48 3300003762 Ga0055542_1004766 Ga0055542_10047663 262
49 3300014326 Ga0157380_10808450 Ga0157380_108084501 262
50 3300025242 Ga0209258_100145 Ga0209258_100145115 262
51 3300025254 Ga0209148_1000177 Ga0209148_100017735 262
52 3300053088 Ga0500644_0000111 Ga0500644_0000111_14798_15586 262
53 3300053090 Ga0500646_0001750 Ga0500646_0001750_3865_4653 262
54 3300053092 Ga0500583_0006617 Ga0500583_0006617_2098_2886 262
55 3300053134 Ga0500658_0043263 Ga0500658_0043263_709_1497 262
56 3300053136 Ga0500559_0007433 Ga0500559_0007433_539_1327 262
57 3300053153 Ga0500616_0040886 Ga0500616_0040886_182_970 262
58 3300053177 Ga0500636_0024039 Ga0500636_0024039_742_1563 262
59 3300009147 Ga0114129_10008068 Ga0114129_1000806812 263
60 3300013102 Ga0157371_10014957 Ga0157371_100149573 263
61 3300013296 Ga0157374_10251013 Ga0157374_102510133 263
62 3300013307 Ga0157372_10073977 Ga0157372_100739774 263
63 3300025246 Ga0209646_1001234 Ga0209646_10012345 263
64 3300031507 Ga0307509_10124879 Ga0307509_101248793 263
65 3300042004 Ga0439445_0026484 Ga0439445_0026484_411_1202 263
66 3300042007 Ga0439449_0045326 Ga0439449_0045326_11_802 263
67 3300050507 nmdc:mga05p37_9694_c1 nmdc:mga05p37_9694_c1_6579_7370 263
68 3300053086 Ga0500578_0000091 Ga0500578_0000091_90732_91523 263
69 3300053086 Ga0500578_0097216 Ga0500578_0097216_1005_1796 263
70 3300053146 Ga0500588_0060836 Ga0500588_0060836_314_1105 263
71 3300003203 JGI25406J46586_10004645 JGI25406J46586_100046459 264
72 3300003320 rootH2_10045077 rootH2_100450773 264
73 3300003320 rootH2_10059393 rootH2_1005939338 264
74 3300003320 rootH2_10075686 rootH2_100756862 264
75 3300003320 rootH2_10111247 rootH2_101112472 264
76 3300003322 rootL2_10011547 rootL2_1001154715 264
77 3300003322 rootL2_10036409 rootL2_100364092 264
78 3300003323 rootH1_10129966 rootH1_101299662 264
79 3300003354 JGI25160J50197_1000423 JGI25160J50197_100042327 264
80 3300005329 Ga0070683_100006746 Ga0070683_1000067468 264
81 3300005331 Ga0070670_100142863 Ga0070670_1001428632 264
82 3300005331 Ga0070670_100398997 Ga0070670_1003989972 264
83 3300005334 Ga0068869_100130088 Ga0068869_1001300882 264
84 3300005334 Ga0068869_100210324 Ga0068869_1002103242 264
85 3300005335 Ga0070666_10000208 Ga0070666_1000020837 264
86 3300005338 Ga0068868_100129781 Ga0068868_1001297813 264
87 3300005341 Ga0070691_10037472 Ga0070691_100374723 264
88 3300005344 Ga0070661_100036192 Ga0070661_1000361922 264
89 3300005347 Ga0070668_100196191 Ga0070668_1001961912 264
90 3300005354 Ga0070675_100202840 Ga0070675_1002028401 264
91 3300005355 Ga0070671_100058661 Ga0070671_1000586611 264
92 3300005367 Ga0070667_100040044 Ga0070667_1000400442 264
93 3300005455 Ga0070663_100754429 Ga0070663_1007544291 264
94 3300005458 Ga0070681_10293321 Ga0070681_102933212 264
95 3300005539 Ga0068853_100024438 Ga0068853_1000244382 264
96 3300005539 Ga0068853_100405758 Ga0068853_1004057582 264
97 3300005543 Ga0070672_100232668 Ga0070672_1002326682 264
98 3300005563 Ga0068855_100028799 Ga0068855_1000287993 264
99 3300005564 Ga0070664_100004041 Ga0070664_1000040419 264
100 3300005564 Ga0070664_100097716 Ga0070664_1000977162 264
101 3300005564 Ga0070664_100113483 Ga0070664_1001134833 264
102 3300005564 Ga0070664_100214974 Ga0070664_1002149742 264
103 3300005564 Ga0070664_100256952 Ga0070664_1002569522 264
104 3300005577 Ga0068857_100006960 Ga0068857_1000069607 264
105 3300005614 Ga0068856_100061384 Ga0068856_1000613843 264
106 3300005616 Ga0068852_100002505 Ga0068852_1000025053 264
107 3300005616 Ga0068852_100158551 Ga0068852_1001585513 264
108 3300005616 Ga0068852_100266729 Ga0068852_1002667292 264
109 3300005616 Ga0068852_100517444 Ga0068852_1005174442 264
110 3300005617 Ga0068859_100000006 Ga0068859_100000006224 264
111 3300005617 Ga0068859_100001600 Ga0068859_1000016004 264
112 3300005618 Ga0068864_100002251 Ga0068864_1000022514 264
113 3300005834 Ga0068851_10033932 Ga0068851_100339322 264
114 3300005841 Ga0068863_100011724 Ga0068863_1000117243 264
115 3300005841 Ga0068863_100028475 Ga0068863_1000284753 264
116 3300005842 Ga0068858_100000396 Ga0068858_10000039628 264
117 3300005843 Ga0068860_100011714 Ga0068860_10001171410 264
118 3300005985 Ga0081539_10004597 Ga0081539_1000459710 264
119 3300006237 Ga0097621_100016532 Ga0097621_1000165323 264
120 3300006237 Ga0097621_100204552 Ga0097621_1002045522 264
121 3300006358 Ga0068871_100038002 Ga0068871_1000380023 264
122 3300006358 Ga0068871_100102887 Ga0068871_1001028872 264
123 3300006358 Ga0068871_100201264 Ga0068871_1002012642 264
124 3300006358 Ga0068871_100348601 Ga0068871_1003486011 264
125 3300006931 Ga0097620_100000006 Ga0097620_100000006224 264
126 3300006931 Ga0097620_100001600 Ga0097620_1000016004 264
127 3300009093 Ga0105240_10000888 Ga0105240_1000088830 264
128 3300009093 Ga0105240_10004520 Ga0105240_100045203 264
129 3300009093 Ga0105240_10020206 Ga0105240_100202068 264
130 3300009174 Ga0105241_10001297 Ga0105241_1000129719 264
131 3300009174 Ga0105241_10173526 Ga0105241_101735262 264
132 3300009545 Ga0105237_10000362 Ga0105237_1000036247 264
133 3300009545 Ga0105237_10000553 Ga0105237_1000055345 264
134 3300009545 Ga0105237_10000636 Ga0105237_1000063634 264
135 3300009545 Ga0105237_10002556 Ga0105237_1000255613 264
136 3300009551 Ga0105238_10023246 Ga0105238_100232463 264
137 3300009551 Ga0105238_10079540 Ga0105238_100795403 264
138 3300009553 Ga0105249_10055148 Ga0105249_100551482 264
139 3300010375 Ga0105239_10000235 Ga0105239_1000023543 264
140 3300010375 Ga0105239_10000639 Ga0105239_1000063946 264
141 3300010375 Ga0105239_10039194 Ga0105239_100391942 264
142 3300010375 Ga0105239_10067417 Ga0105239_100674173 264
143 3300010375 Ga0105239_10089080 Ga0105239_100890803 264
144 3300010375 Ga0105239_10234232 Ga0105239_102342322 264
145 3300011119 Ga0105246_10019482 Ga0105246_100194827 264
146 3300013102 Ga0157371_10118630 Ga0157371_101186301 264
147 3300013102 Ga0157371_10141544 Ga0157371_101415441 264
148 3300013104 Ga0157370_10015629 Ga0157370_100156293 264
149 3300013104 Ga0157370_10419021 Ga0157370_104190211 264
150 3300013104 Ga0157370_10581925 Ga0157370_105819251 264
151 3300013296 Ga0157374_10000013 Ga0157374_10000013263 264
152 3300013296 Ga0157374_10292565 Ga0157374_102925652 264
153 3300013297 Ga0157378_10189850 Ga0157378_101898502 264
154 3300013297 Ga0157378_10465825 Ga0157378_104658252 264
155 3300013306 Ga0163162_10003652 Ga0163162_1000365220 264
156 3300013306 Ga0163162_10563673 Ga0163162_105636731 264
157 3300013307 Ga0157372_10001825 Ga0157372_1000182521 264
158 3300013307 Ga0157372_10006426 Ga0157372_1000642611 264
159 3300013307 Ga0157372_10375319 Ga0157372_103753192 264
160 3300013307 Ga0157372_10852779 Ga0157372_108527791 264
161 3300013308 Ga0157375_10681957 Ga0157375_106819572 264
162 3300014325 Ga0163163_10004460 Ga0163163_1000446012 264
163 3300014325 Ga0163163_10199928 Ga0163163_101999282 264
164 3300014325 Ga0163163_10659726 Ga0163163_106597262 264
165 3300014968 Ga0157379_10402940 Ga0157379_104029401 264
166 3300014969 Ga0157376_10001814 Ga0157376_1000181413 264
167 3300014969 Ga0157376_10029774 Ga0157376_100297742 264
168 3300014969 Ga0157376_10034836 Ga0157376_100348363 264
169 3300025302 Ga0207426_1000105 Ga0207426_1000105107 264
170 3300025321 Ga0207656_10076406 Ga0207656_100764061 264
171 3300025903 Ga0207680_10000072 Ga0207680_1000007221 264
172 3300025904 Ga0207647_10007605 Ga0207647_100076057 264
173 3300025912 Ga0207707_10249810 Ga0207707_102498102 264
174 3300025913 Ga0207695_10000066 Ga0207695_10000066156 264
175 3300025913 Ga0207695_10000584 Ga0207695_1000058449 264
176 3300025913 Ga0207695_10057947 Ga0207695_100579474 264
177 3300025913 Ga0207695_10153309 Ga0207695_101533092 264
178 3300025914 Ga0207671_10001808 Ga0207671_1000180822 264
179 3300025914 Ga0207671_10004517 Ga0207671_1000451711 264
180 3300025914 Ga0207671_10013354 Ga0207671_100133548 264
181 3300025914 Ga0207671_10018736 Ga0207671_100187363 264
182 3300025914 Ga0207671_10020007 Ga0207671_100200075 264
183 3300025920 Ga0207649_10071304 Ga0207649_100713042 264
184 3300025925 Ga0207650_10003871 Ga0207650_100038716 264
185 3300025925 Ga0207650_10360476 Ga0207650_103604761 264
186 3300025931 Ga0207644_10083805 Ga0207644_100838053 264
187 3300025933 Ga0207706_10073445 Ga0207706_100734451 264
188 3300025940 Ga0207691_10176666 Ga0207691_101766662 264
189 3300025942 Ga0207689_10000383 Ga0207689_1000038342 264
190 3300025944 Ga0207661_10020351 Ga0207661_100203512 264
191 3300025945 Ga0207679_10085597 Ga0207679_100855972 264
192 3300025945 Ga0207679_10191830 Ga0207679_101918301 264
193 3300025949 Ga0207667_10001058 Ga0207667_100010589 264
194 3300025960 Ga0207651_10241419 Ga0207651_102414191 264
195 3300025960 Ga0207651_10464781 Ga0207651_104647811 264
196 3300025960 Ga0207651_10573141 Ga0207651_105731411 264
197 3300025986 Ga0207658_10100995 Ga0207658_101009953 264
198 3300026023 Ga0207677_10043681 Ga0207677_100436813 264
199 3300026035 Ga0207703_10010923 Ga0207703_100109235 264
200 3300026041 Ga0207639_10522369 Ga0207639_105223691 264
201 3300026078 Ga0207702_10074189 Ga0207702_100741893 264
202 3300026088 Ga0207641_10000280 Ga0207641_1000028041 264
203 3300026088 Ga0207641_10038328 Ga0207641_100383282 264
204 3300026095 Ga0207676_10008608 Ga0207676_100086084 264
205 3300026116 Ga0207674_10004281 Ga0207674_1000428113 264
206 3300026142 Ga0207698_10002611 Ga0207698_100026113 264
207 3300026142 Ga0207698_10337705 Ga0207698_103377052 264
208 3300028381 Ga0268264_10004181 Ga0268264_100041818 264
209 3300028786 Ga0307517_10001723 Ga0307517_1000172328 264
210 3300031616 Ga0307508_10000294 Ga0307508_1000029415 264
211 3300031616 Ga0307508_10048428 Ga0307508_100484284 264
212 3300031730 Ga0307516_10000648 Ga0307516_1000064832 264
213 3300033180 Ga0307510_10002127 Ga0307510_1000212714 264
214 3300037418 Ga0395900_0023696 Ga0395900_0023696_732_1526 264
215 3300037471 Ga0395905_0269214 Ga0395905_0269214_68_862 264
216 3300041413 Ga0439465_0029039 Ga0439465_0029039_933_1727 264
217 3300042007 Ga0439449_0009661 Ga0439449_0009661_851_1645 264
218 3300042014 Ga0439457_008203 Ga0439457_008203_429_1223 264
219 3300044719 Ga0466971_0008679 Ga0466971_0008679_3272_4114 264
220 3300044765 Ga0466970_0098383 Ga0466970_0098383_556_1398 264
221 3300044842 Ga0466957_0041499 Ga0466957_0041499_1636_2478 264
222 3300046507 Ga0495606_0043219 Ga0495606_0043219_757_1596 264
223 3300046524 Ga0495648_0009138 Ga0495648_0009138_6344_7153 264
224 3300046648 Ga0495611_0000037 Ga0495611_0000037_80375_81214 264
225 3300046660 Ga0495625_0070348 Ga0495625_0070348_854_1648 264
226 3300046694 Ga0495649_0038337 Ga0495649_0038337_302_1141 264
227 3300047472 Ga0495686_0000010 Ga0495686_0000010_420912_421751 264
228 3300048923 Ga0496120_0177410 Ga0496120_0177410_107_946 264
229 3300053088 Ga0500644_0013388 Ga0500644_0013388_91_921 264
230 3300053092 Ga0500583_0169774 Ga0500583_0169774_137_946 264
231 3300053153 Ga0500616_0008777 Ga0500616_0008777_2553_3347 264
232 3300053156 Ga0500622_0001440 Ga0500622_0001440_3111_3905 264
233 3300053156 Ga0500622_0001592 Ga0500622_0001592_5507_6301 264
234 3300053156 Ga0500622_0005685 Ga0500622_0005685_6531_7340 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

208

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.8647 8 218
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.8608 10 238
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8605 7 238
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.86 7 238
5x5y-assembly1.cif.gz_A a membrane protein complex 0.8582 11 218
ID Description Score Start End Superfamily
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8824 10 263 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8551 11 261 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8547 10 263 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8545 5 236 3.40.50.300
af_E9PWJ7_506_745_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8532 9 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A527GZS8-F1-model_v4 ABC transporter ATP-binding protein 0.8915 9 218 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A7G8UFM3-F1-model_v4 ABC transporter ATP-binding protein 0.89 10 264 GO:0005524
GO:0016887
AF-A0A522ZIC4-F1-model_v4 ABC transporter ATP-binding protein 0.8831 7 263 GO:0005524
GO:0016887
AF-A0A443KNY2-F1-model_v4 ABC transporter ATP-binding protein 0.883 10 264 GO:0005524
GO:0016887
AF-A0A521QGG1-F1-model_v4 ABC transporter ATP-binding protein 0.8821 10 264 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
83.59 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map